Análogos de glucagón acilados.

Un compuesto que tiene la fórmula

R1-Z-R2

en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoílo o trifluoroacetilo;

R2 es OH o NH2;

y Z es un péptido que tiene la fórmula I:

His-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-X16-X17-Ala-Ala-X20- X21-Phe-Val-X24-Trp-Leu-X27-X28-Ala-X30;

(I)

en la que

X2 se selecciona de Aib o Ser;

X12 se selecciona de Lys, Arg y Leu;

X16 se selecciona de Arg y X;

X17 se selecciona de Arg y X;

X20 se selecciona de Arg, His y X;

X21 se selecciona de Asp y Glu;

X24 se selecciona de Ala y X;

X27 se selecciona de Leu y X;

X28 se selecciona de Arg y X;

X30 es X o está ausente;

en la que al menos uno de X16, X17, X20, X24, X27, X28 y X30 es X;

y en donde cada resto X se selecciona independientemente del grupo que consiste en Glu, Lys, Ser, Cys, Dbu, Dpr y Orn;

en donde la cadena lateral de al menos un resto X se conjuga con un sustituyente lipófilo que tiene la fórmula:

(i) Z1, en donde Z1 es un residuo lipófilo conjugado directamente con la cadena lateral de X; o

(ii) Z1Z2, en dondeZ1 es un residuo lipófilo, Z2 es un espaciador y Z1 está conjugado con la cadena lateral de X mediante Z2;

con la condición de que Z no sea HSQGTFTSDYSKYLDS-K(Hexadecanoil-g-Glu)-AAHDFVEWLLRA.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/DK2010/000099.

Solicitante: ZEALAND PHARMA A/S.

Nacionalidad solicitante: Dinamarca.

Dirección: Smedeland 36 2600 Glostrup DINAMARCA.

Inventor/es: MEIER, EDDI, RIBER,Ditte, DAUGAARD,Jens Rosengren, SKOVGAARD,MARIE, TOLBORG,JAKOB LIND, KAMPEN,GITA, BÆK,CAMILLA ÆRTEBERG.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de trastornos del... > A61P5/48 (de las hormonas pancreáticas)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/605 (Glucagones)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen péptidos... > A61K38/26 (Glucagón)

PDF original: ES-2537287_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Análogos de glucagón acilados Campo de la invención La presente invención se refiere a análogos de glucagón acilados y a su uso médico, por ejemplo, en el tratamiento de obesidad y diabetes.

Antecedentes de la invención La obesidad y la diabetes son problemas de salud que están aumentado globalmente y que están asociados con diversas enfermedades, particularmente enfermedades cardiovasculares (ECV) , apnea del sueño obstructiva, ictus, cardiopatía periférica, complicaciones microvasculares y osteoartritis.

En todo el mundo hay 246 millones de personas con diabetes, y en el año 2025 se calcula que unos 380 millones tendrán diabetes. Muchas tienen factores de riesgo cardiovasculares adicionales incluyendo niveles de LDL y triglicéridos altos/aberrantes y de HDL bajos.

Las enfermedades cardiovasculares representan aproximadamente el 50 % de la mortalidad en personas con diabetes y las tasas de morbidez y mortalidad relacionadas con la obesidad y la diabetes ponen de manifiesto la necesidad médica de opciones de tratamiento eficaces.

El preproglucagón es un polipéptido precursor de 158 aminoácidos que se procesa diferencialmente en los tejidos para formar diversos péptidos estructuralmente relacionados derivados del proglucagón, incluyendo glucagón (Glu) , péptido 1 similar a glucagón (GLP-1) , péptido 2 similar a glucagón (GLP-2) y oxintomodulina (OXM) . Estas moléculas están implicadas en una amplia serie de funciones fisiológicas, incluyendo, homeostasis de la glucosa, secreción de insulina, vaciado gástrico y desarrollo intestinal, así como en la regulación de la ingesta de alimentos.

El glucagón es un péptido de 29 aminoácidos que corresponde a los aminoácidos 53 a 81 del pre-proglucagón y tiene la secuencia His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr. La oxintomodulina (OXM) es un péptido de 37 aminoácidos que incluye la secuencia completa de 29 aminoácidos del glucagón con una extensión octapeptídica carboxilo terminal (aminoácidos 82 a 89 del pre-proglucagón, que tiene la secuencia Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala y que se denomina “péptido interviniente 1” o PI-1; la secuencia completa de la oxintomodulina humana es por tanto His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala) . El fragmento principal biológicamente activo del GLP-1 se produce como un péptido amidado en el extremo C, de 30 aminoácidos, que corresponde a los aminoácidos 98 a 127 del pre-proglucagón.

El glucagón ayuda a mantener el nivel de glucemia uniéndose a los receptores de glucagón en los hepatocitos, haciendo que el hígado libere glucosa-almacenada en forma de glucógeno-a través de una glicogenólisis. A medida que estas reservas comienzan a agotarse, el glucagón estimula al hígado para sintetizar glucosa adicional por gluconeogénesis. Esta glucosa se libera en la corriente sanguínea, impidiendo el desarrollo de hipoglucemia. Adicionalmente, se ha demostrado que el glucagón aumenta la lipólisis y disminuye el peso corporal.

El GLP-1 disminuye los niveles de glucemia elevados mejorando la secreción de insulina estimulada por glucosa y promueve principalmente la pérdida de peso disminuyendo la ingesta de alimento.

La Oxintomodulina se libera en la sangre en respuesta a la ingesta de alimento y en relación al contenido calórico de 50 las comidas. El mecanismo de acción de la oxintomodulina no se conoce bien. En particular, no se sabe si los efectos de la hormona están exclusivamente mediados a través del receptor del glucagón y el receptor del GLP-1, o a través de uno o más receptores aún no identificados.

Se ha demostrado que otros péptidos se unen y activan tanto al receptor del glucagón como al del GLP-1 (Hjort et al,

Journal of Biological Chemistr y , 269, 30121-30124, 1994) y suprimen el aumento de peso corporal y reducen la ingesta de alimento (documentos WO 2006/134340; WO 2007/100535; WO 2008/101017, WO 2008/152403, WO 2009/155257 y WO 2009/155258) . Se ha demostrado que la estabilización de péptidos proporciona un mejor perfil farmacocinético para diversos fármacos. En particular se ha demostrado que la adición de uno o más grupos de polietilenglicol (PEG) o acilo prolonga la semivida de péptidos tales como GLP-1 y de otros péptidos con corta 60 estabilidad plasmática.

En los documentos WO 00/55184A1 y WO 00/55119 se desvelan métodos para la acilación de diversos péptidos, en particular GLP-1. Madsen et al (J. Med. Chem. 2007, 50, 6126-6132) describen el GLP-1 acilado en la posición 20 (Liraglutida) y proporcionan datos sobre su estabilidad.

En los documentos WO2007/100535, WO08/071972 y en Endocrinology 2009, 150 (4) , 1712-1721 de Druce, M R et al. también se ha demostrado que la estabilización de la OXM por PEGilación y acilación C terminal mejora el perfil farmacocinético de análogos seleccionados.

Recientemente se ha observado que la PEGilación de análogos de glucagón tiene un efecto significativo sobre el perfil farmacocinético de los compuestos ensayados (documento WO2008/101017) aunque también interfiere con la fuerza de estos compuestos.

Sumario de la invención La invención proporciona un compuesto que tiene la fórmula:

R1-Z-R2

en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoilo o trifluoroacetilo; R2 es OH o NH2; y Z es un péptido que tiene la fórmula I;

His-X2-Gtn-Giy-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-X16-X17-Ala-Ala-X20-X21- Phe-Val-X24-Trp-Leu-X27-X28-Ala-X30; (I)

en la que X2 se selecciona de Aib o Ser; X12 se selecciona de Lys, Arg y Leu; X16 se selecciona de Arg y X; X17 se selecciona de Arg y X; X20 se selecciona de Arg, His y X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y X; X27 se selecciona de Leu y X; X28 se selecciona de Arg y X; X30 es X o no está ausente; en la que al menos uno de X16, X17, X20, X24, X27, X28 y X30 es X; y en la que cada resto X se selecciona independientemente del grupo que consiste en Glu, Lys, Ser, Cys, Dbu, Dpr y Orn

en la que la cadena lateral de al menos un resto X se conjuga con un sustituyente lipófilo que tiene la fórmula:

(i) Z1, en la que Z1 es un residuo lipófilo conjugado directamente con la cadena lateral de X; o

(ii) Z1Z2, en la que Z1 un residuo lipófilo, Z2 es un espaciador y Z1 se conjuga con la cadena lateral de X mediante Z2

;

con la condición de que Z no sea HSQGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVEWLLRA.

X30 puede estar presente o ausente. En aquellas realizaciones en las que X está presente, puede ser deseable que este sea Lys.

En determinadas realizaciones, cualquier resto X, y especialmente cualquier resto X que esté conjugado con un sustituyente lipófilo, se selecciona independientemente de Lys, Glu o Cys.

En determinadas realizaciones, X16 se selecciona de Glu, Lys y Ser; X17 se selecciona de Lys y Cys; X20 se selecciona de His, Lys, Arg y Cys; X24 se selecciona de Lys, Glu y Ala; X27 se selecciona de Leu y Lys; y/o X28 se selecciona de Ser, Arg y Lys.

Como combinaciones específicas de restos que pueden estar presentes en el péptido de fórmula I se incluyen las siguientes:

X2 es Aib y X17 es Lys; X2 es Aib y X17 es Cys; X2 es Aib y X20 es Cys; X2 es Aib y X28 es Lys;

X12 es Arg y X17 es Lys;

X12 es Leu y X17 es Lys;

X12 es Lys y X20 es Lys;

X12 es Lys y X17 es Lys;

X16 es Lys y X17 es Lys;

X16 es Ser y X17 es Lys;

X17 es Lys y X20 es Lys;

X17 es Lys y X21 es Asp;

X17 es Lys y X24 es Glu;

X17... [Seguir leyendo]

 


Reivindicaciones:

1. Un compuesto que tiene la fórmula

R1-Z-R2

en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoílo o trifluoroacetilo; R2 es OH o NH2; y Z es un péptido que tiene la fórmula I:

His-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-X16-X17-Ala-Ala-X20-X21-Phe-Val-X24-Trp-Leu-X27-X28-Ala-X30; (I)

en la que X2 se selecciona de Aib o Ser; X12 se selecciona de Lys, Arg y Leu; X16 se selecciona de Arg y X; X17 se selecciona de Arg y X; X20 se selecciona de Arg, His y X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y X; X27 se selecciona de Leu y X; X28 se selecciona de Arg y X;

X30 es X o está ausente; en la que al menos uno de X16, X17, X20, X24, X27, X28 y X30 es X;

y en donde cada resto X se selecciona independientemente del grupo que consiste en Glu, Lys, Ser, Cys, Dbu, Dpr y Orn; en donde la cadena lateral de al menos un resto X se conjuga con un sustituyente lipófilo que tiene la fórmula:

(i) Z1, en donde Z1 es un residuo lipófilo conjugado directamente con la cadena lateral de X; o

(ii) Z1Z2, en dondeZ1 es un residuo lipófilo, Z2 es un espaciador y Z1 está conjugado con la cadena lateral de X mediante Z2;

con la condición de que Z no sea HSQGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVEWLLRA.

2. Un compuesto de acuerdo con la reivindicación 1 en el que:

(a) uno o más de dichos restos de X se seleccionan independientemente de Lys, Glu o Cys; y/o

(b) X16 se selecciona de Glu, Lys y Ser;

X17 se selecciona de Lys y Cys; X20 se selecciona de His, Lys, Arg y Cys;

X24 se selecciona de Lys, Glu y Ala; X27 se selecciona de Leu y Lys; y/o X28 se selecciona de Ser, Arg y Lys; y/o (c) el péptido de fórmula I incluye uno o más de las siguientes combinaciones de restos:

X2 es Aib y X17 es Lys; X2 es Aib y X17 es Cys; X2 es Aib y X20 es Cys; X2 es Aib y X28 es Lys;

X12 es Arg y X17 es Lys; X12 es Leu y X17 es Lys; X12 es Lys y X20 es Lys; X12 es Lys y X17 es Lys; X16 es Lys y X17 es Lys; X16 es Ser y X17 es Lys; X17 es Lys y X20 es Lys; X17 es Lys y X21 es Asp; X17 es Lys y X24 es Glu; X17 es Lys y X27 es Leu;

X17 es Lys y X27 es Lys; X17 es Lys y X28 es Ser;

X17 es Lys y X28 es Arg; X20 es Lys y X27 es Leu; X21 es Asp y X27 es Leu; X2 es Aib, X12 es Lys y X16 es Ser; X12 es Lys, X17 es Lys y X16 es Ser; X12 es Arg, X17 es Lys y X16 es Glu; X16 es Glu, X17 es Lys y X20 es Lys; X16 es Ser, X21 es Asp y X24 es Glu; X17 es Lys, X24 es Glu y X28 es Arg; X17 es Lys, X24 es Glu y X28 es Lys; X17 es Lys, X27 es Leu y X28 es Ser; X17 es Lys, X27 es Leu y X28 es Arg; X20 es Lys, X24 es Glu y X27 es Leu; X20 es Lys, X27 es Leu y X28 es Ser; X20 es Lys, X27 es Leu y X28 es Arg; X16 es Ser, X20 es His, X24 es Glu y X27 es Leu; X17 es Lys, X20 es His, X24 es Glu y X28 es Ser; X17 es Lys, X20 es Lys, X24 es Glu y X27 es Leu; o X17 es Cys, X20 es Lys, X24 es Glu y X27 es Leu.

3. Un compuesto de acuerdo con las reivindicaciones 1 o 2, en el que el péptido de fórmula I contiene un solo aminoácido del tipo conjugado con el sustituyente lipófilo, en donde, por ejemplo, el péptido contiene un solo resto de Lys, un solo resto de Cys o un solo resto de Glu, y en donde el sustituyente lipófilo está conjugado con ese resto.

4. Un compuesto de acuerdo con una cualquiera de las reivindicaciones anteriores en el que la secuencia peptídica de fórmula I comprende uno o más puentes intramoleculares, y en el que opcionalmente

(a) dicho puente intramolecular está formado entre las cadenas laterales de dos restos de aminoácidos que están separados por tres aminoácidos en la secuencia de aminoácidos lineal de fórmula I;

(b) el puente intramolecular está formado entre las cadenas laterales de los pares de restos 16 y 20, 17 y 21, 20 y 24 o 24y 28;

(c) el puente intramolecular es un puente salino o un anillo de lactama; y/o

(d) el puente intramolecular implica un par de restos en los que:

X16 es Glu y X20 es Lys; X16 es Glu y X20 es Arg; X16 es Lys y X20 es Glu; o X16 es Arg y X20 es Glu; X17 es Arg y X21 es Glu; X17 es Lys y X21 es Glu; X17 es Arg y X21 es Asp;o X17 es Lys y X21 es Asp; X20 es Glu y X24 es Lys; X20 es Glu y X24 es Arg; X20 es Lys y X24 es Glu; o X20 es Arg y X24 es Glu; X24 es Glu y X28 es Lys; X24 es Glu y X28 es Arg; X24 es Lys y X28 es Glu; o X24 es Arg y X28 es Glu.

5. Un compuesto de acuerdo con una cualquiera de las reivindicaciones anteriores en el que al menos uno de X16, X17, X20 y X28 está conjugado con un sustituyente lipófilo.

6. Un compuesto de acuerdo con una cualquiera de las reivindicaciones anteriores en el que:

(a) X30 está ausente; o

(b) X30 está presente y está conjugado con un sustituyente lipófilo.

7. Un compuesto de acuerdo con una cualquiera de las reivindicaciones anteriores en el que:

(a) el compuesto tiene un solo sustituyente lipófilo, en la posición 16, 17, 20, 24, 27, 28 o 30, preferentemente en la posición 16, 17 o 20, particularmente en la posición 17;

(b) el compuesto tiene exactamente dos sustituyentes lipófilos, cada uno en una de las posiciones 16, 17, 20, 24, 27, 28º 30; o

(c) el compuesto tiene sustituyentes lipófilos en las posiciones 16 y 17, 16 y 20, 16 y 24, 16 y 27, 16 y 28 o 16 y

30; en 17 y 20, 17 y 24, 17 y 27, 17 y 28 o 17 y 30; en las posiciones 20 y 24, 20 y 27, 20 y 28 o 20 y 30; en las posiciones 24 y 27, 24 y 28 o 24 y 30; en las posiciones 27 y 28 o 27 y 30; o en las posiciones 28 y 30.

8. Un compuesto de acuerdo con la reivindicación 1, que tiene la fórmula:

R1-Z-R2

en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoilo o trifluoroacetilo; R2 es OH o NH2; 10 y Z es un péptido que tiene:

(a) la fórmula IIa;

His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-X16-X17-Ala-Ala-X20-X21-Phe-Val-X24-Trp15 Leu-Leu-X28-Ala; (IIa) .

en la que X12 se selecciona de Lys, Arg y Leu;

X16 se selecciona de Ser y X; X17 es X; X20 se selecciona de His y X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y Glu;

X28 se selecciona de Ser, Lys y Arg; y en la que cada resto X se selecciona independientemente del grupo que consiste en Glu, Lys, y Cys;

(b) la fórmula IIIa;

His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-Ser-X17-Ala-Ala-X20-X21-Phe-Val-X24-Trp-Leu-Leu-X28-Ala; (IIIa)

en la que X12 se selecciona de Lys y Arg; X17 es X; X20 se selecciona de His y X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y Glu;

X28 se selecciona de Ser, Lys y Arg; y en la que cada resto X se selecciona independientemente de Glu, Lys y Cys; o (c) la fórmula IVa;

His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-Ser-X17-Ala-Ala-His-X21-Phe-Val-X24-Trp-Leu-Leu-X28-Ala; (IVa)

en la que 50 X12 se selecciona de Lys y Arg; X17 es X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y Glu; X28 se selecciona de Ser, Lys y Arg;

en donde X se selecciona del grupo que consiste en Glu, Lys y Cys; en donde la cadena lateral de al menos un resto X está conjugado con un sustituyente lipófilo que tiene la fórmula:

(i) Z1, en donde Z1 es un residuo lipófilo conjugado directamente con la cadena lateral de X; o 60 (ii) Z1Z2, en donde Z1 es un residuo lipófilo, Z2 es un espaciador y Z1 está conjugado con la cadena lateral de X mediante Z2.

9. Un compuesto de acuerdo con la reivindicación 1 que tiene la fórmula:

R1-Z-R2

en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoilo o trifluoroacetilo; R2 es OH o NH2; y Z es un péptido que tiene:

(a) la fórmula IIb;

His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-X16-X17-Ala-Ala-X20-X21-Phe-Val-X24-Trp-Leu-Leu-X28-Ala; (IIb)

en la que X12 se selecciona de Lys, Arg y Leu; X16 se selecciona de Ser y X; X17 es X; X20 se selecciona de His y X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y Glu; X28 se selecciona de Ser, Lys y Arg; y en donde cada resto X se selecciona independientemente del grupo que consiste en Glu, Lys, y Cys;

(b) la fórmula IIIb;

His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-Ser-X17-Ala-Ala-X20-X21-Phe-Val-X24-Trp-Leu-Leu-X28-Ala; (IIIb)

en la que X12 se selecciona de Lys o Arg; X17 es X; X20 se selecciona de His y X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y Glu; X28 se selecciona de Ser, Lys y Arg; y en donde cada resto X se selecciona independientemente de Glu, Lys y Cys; o

(c) la fórmula IVb;

His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-Ser-X17-Ala-Ala-His-X21-Phe-Val-X24-Trp-Leu-Leu-X28-Ala; (IVb)

en la que X12 se selecciona de Lys y Arg; X17 es X; X21 se selecciona de Asp y Glu; X24 se selecciona de Ala y Glu; X28 se selecciona de Ser, Lys y Arg; en donde X se selecciona del grupo que consiste en Glu, Lys y Cys;

en la que la cadena lateral de al menos un resto X está conjugada con un sustituyente lipófilo que tiene la fórmula:

(i) Z1, en donde Z1 es un residuo lipófilo conjugado directamente con la cadena lateral de X; o

(ii) Z1Z2, en donde Z1 es un residuo lipófilo, Z2 es un espaciador y Z1 está conjugado con la cadena lateral de X mediante Z2.

con la condición de que Z no sea HSQGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) ) -AAHDFVEWLLRA.

10. Un compuesto de acuerdo con una cualquiera de las reivindicaciones anteriores en el que el péptido de fórmula I, IIa, IIIa, IVa, IIb, IIIb o IVb tiene las secuencias:

HSQGTFTSDYSKYLDSKAAHDFVEWLLRA; HSQGTFTSDYSKYLDKKAAHDFVEWLLRA; HSQGTFTSDYSKYLDSKAAKDFVEWLLRA; HSQGTFTSDYSKYLDSKAAHDFVEWLKRA; HSQGTFTSDYSKYLDSKAAHDFVEWLLKA; HSQGTFTSDYSRYLDSKAAHDFVEWLLRA;

HSQGTFTSDYSLYLDSKAAHDFVEWLLRA; HSQGTFTSDYSKYLDSKAAHDFVEWLLRAK; HSQGTFTSDYSKYLDSKAAHDFVEWLLSAK HSQGTFTSDYSKYLDSKAAHDFVEWLKSA;

HSQGTFTSDYSKYLDSKAAHDFVKWLLRA; HSQGTFTSDYSKYLDSCAAHDFVEWLLRA; HSQGTFTSDYSKYLDSCAAHDFVEWLLSA; HSQGTFTSDYSKYLDSKAACDFVEWLLRA; HSQGTFTSDYSKYLDKSAAHDFVEWLLRA;

H-Aib-QGTFTSDYSKYLDSKAAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDSKAAHDFVEWLLSAK; H-Aib-QGTFTSDYSKYLDSKAARDFVAWLLRA; H-Aib-QGTFTSDYSKYLDSKAAKDFVAWLLRA; H-Aib-QGTFTSDYSKYLDSKAAHDFVEWLLRA;

H-Aib-QGTFTSDYSKYLDSKAAHDFVEWLLKA H-Aib-QGTFTSDYSKYLDSKAAKDFVAWLLSA H-Aib-QGTFTSDYSKYLDSKAAHDFVAWLLKA; H-Aib-QGTFTSDYSKYLDKKAAHDFVAWLLRA; H-Aib-QGTFTSDYSRYLDSKAAHDFVEWLLSA;

H-Aib-QGTFTSDYSKYLDSKAAHDFVKWLLSA; H-Aib-QGTFTSDYSLYLDSKAAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDSCAAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDSKAACDFVEWLLRA; H-Aib-QGTFTSDYSKYLDK () KAAE () DFVEWLLRA;

H-Aib-QGTFTSDYSKYLDSKAAHDFVE () WLLK () A H-Aib-QGTFTSDYSKYLDSKAAK () DFVE () WLLRA; H-Aib-QGTFTSDYSKYLDSK () AAHE () FVEWLLKA; H-Aib-QGTFTSDYSKYLDSK () AAKE () FVEWLLRA; o HSQGTFTSDYSKYLDS-K*-AAHDFVEWLLRA;

HSQGTFTSDYSKYLD-K*-KAAHDFVEWLLRA; HSQGTFTSDYSKYLDSKAA-K*-DFVEWLLRA; HSQGTFTSDYSKYLDSKAAHDFVEWL-K*-RA; HSQGTFTSDYSKYLDSKAAHDFVEWLL-K*-A; HSQGTFTSDYSRYLDS-K*-AAHDFVEWLLRA;

HSQGTFTSDYSLYLDS-K*-AAHDFVEWLLRA; HSQGTFTSDYSKYLDSKAAHDFVEWLLRA-K*; HSQGTFTSDYSKYLDSKAAHDFVEWLLSA-K*; HSQGTFTSDYSKYLDSKAAHDFVEWL-K*-SA; HSQGTFTSDYSKYLDSKAAHDFV-K*-WLLRA;

HSQGTFTSDYSKYLDS-C*-AAHDFVEWLLRA; HSQGTFTSDYSKYLDS-C*-AAHDFVEWLLSA; HSQGTFTSDYSKYLDSKAA-C*-DFVEWLLRA; HSQGTFTSDYSKYLD-K*-SAAHDFVEWLLRA; H-Aib-QGTFTSDYSKYLDS-K*-AAHDFVEWLLSA;

H-Aib-QGTFTSDYSKYLDSKAAHDFVEWLLSA-K*; H-Aib-QGTFTSDYSKYLDS-K*-AARDFVAWLLRA; H-Aib-QGTFTSDYSKYLDSKAA-K*-DFVAWLLRA; H-Aib-QGTFTSDYSKYLDSKAAHDFVEWLL-K*-A; H-Aib-QGTFTSDYSKYLDS-K*-AAHDFVEWLLRA;

H-Aib-QGTFTSDYSKYLDS-K*-AAHDFVEWLLKA; H-Aib-QGTFTSDYSKYLDSKAA-K*-DFVAWLLSA; H-Aib-QGTFTSDYSKYLDSKAAHDFVAWLL-K*-A; H-Aib-QGTFTSDYSKYLD-K*-KAAHDFVAWLLRA; H-Aib-QGTFTSDYSRYLDS-K*-AAHDFVEWLLSA;

H-Aib-QGTFTSDYSKYLDSKAAHDFV-K*-WLLSA; H-Aib-QGTFTSDYSLYLDS-K*-AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-C*-AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDSKAA-C*-DFVEWLLRA; H-Aib-QGTFTSDYSKYLD-S*-KAAHDFVEWLLSA;

H-Aib-QGTFTSDYSKYLDK () K*AAE () DFVEWLLRA; H-Aib-QGTFTSDYSKYLDSK*AAHDFVE () WLLK () A H-Aib-QGTFTSDYSKYLDSK*AAK () DFVE () WLLRA; H-Aib-QGTFTSDYSKYLDSK () AAHE () FVEWLLK*A; H-Aib-QGTFTSDYSKYLDSK () AAK*E () FVEWLLRA.

Indicando el “*” la posición de un sustituyente lipófilo.

11. Un compuesto de acuerdo con una cualquiera de las reivindicaciones anteriores en el que:

(a) Z1 comprende una cadena hidrocarbonada que tiene de 10 a 24 átomos de C, de 10 a 22 átomos de C, o de 10 a 20 átomos de C, por ejemplo, en donde Z1 es un residuo de dodecanoílo, 2-butiloctanoilo, tetradecanoílo, hexadecanoílo, heptadecanoílo, octadecanoílo o eicosanoílo;

(b) Z2 es, o comprende, uno o más restos de aminoácidos, por ejemplo, en donde Z2 es un resto de γ-Glu, Glu, β-Ala o ε-Lys, o un residuo de 3-aminopropanoílo, 4-aminobutanoílo, 8-aminooctanoílo u 8-amino-3, 6dioxaoctanoílo; y/o

(c) en donde el sustituyente lipófilo se selecciona del grupo que consiste en dodecanoil-γ-Glu, Hexadecanoil-γ-Glu, Hexadecanoil-Glu, Hexadecanoil-[3-aminopropanoílo], Hexadecanoil-[8-aminooctanoílo], Hexadecanoil-ε-Lys, 2-butiloctanoil-γ-Glu, Octadecanoil-γ-Glu y Hexadecanoil-[4-aminobutanoílo].

12. Un compuesto de acuerdo con la reivindicación 11 en el que Z tiene las fórmulas:

HSQGTFTSDYSKYLD-K (Hexadecanoil-γ-Glu) -KAAHDFVEWLLRA; HSQGTFTSDYSKYLDSKAAHDFVEWL-K (Hexadecanoil-γ-Glu) -RA; HSQGTFTSDYSKYLDSKAA-K (Hexadecanoil-γ-Glu) -DFVEWLLRA; HSQGTFTSDYSKYLDSKAAHDFVEWLL-K (Hexadecanoil-γ-Glu) -A; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVEWLLRA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AARDFVAWLLRA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDSKAAHDFVEWLL-K (Hexadecanoil-γ-Glu) -A; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVEWLLKA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVE () WLLK () A; HSQGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVEWLLRA; H-Aib-QGTFTSDYSKYLDSKAA-K (Hexadecanoil-γ-Glu) -DFVAWLLRA; H-Aib-QGTFTSDYSKYLDS-K (Dodecanoil-γ-Glu) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-[3-aminopropanoil]-AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-[8-aminooctanoil]) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-ε-Lys) -AAHDFVEWLLSA; HSQGTFTSDYSKYLDS-K (Hexadecanoil) -AAHDFVEWLLSA; HSQGTFTSDYSKYLDS-K (Octadecanoil-γ-Glu) -AAHDFVEWLLSA; HSQGTFTSDYSKYLDS-K ([2-butiloctanoil]-γ-Glu) -AAHDFVEWLLSA; HSQGTFTSDYSKYLDS-K (Hexadecanoil-[4-aminobutanoil]) -AAHDFVEWLLSA; HSQGTFTSDYSKYLDS-K (Octadecanoil-γ-Glu) -AAHDFVEWLLSA; HSQGTFTSDYSKYLDS-K (Hexadecanoil-E) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (hexadecanoil) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Octadecanoil-γ-Glu) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K ([2-butiloctanoil]-y-Glu) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-[4-aminobutanoil]) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Octadecanoil-γ-Glu) -AAHDFVEWLLSA; o H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-E) -AAHDFVEWLLSA; en donde los restos marcados con “ () ” participan en un enlace intramolecular; o

en el que Z tiene las fórmulas:

H-Aib-QGTFTSDYS-K (Hexadecanoil-isoGlu) -YLDSKAAHDFVEWLLSA; H-Aib-QGTFTSDYS KYLD-K (Hexadecanoil-isoGlu) -KAAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDSKAA-K (Hexadecanoil-isoGlu) -DFVEWLLSA; H-Aib-QGTFTSDYSKYLDSKAAHDFV-K (Hexadecanoil-isoGlu) -WLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-isoLys) -AARDFVAWLLRA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-isoGlu) -AAKDFVEWLLSA; H-Aib-QGTFTSDYSKYLDE-K (Hexadecanoil-isoGlu) -AAHDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-isoGlu) -AAHEFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-isoGlu) -AAEDFVEWLLSA; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-isoGlu) -AAHDFVEWLLEA.

13. Un compuesto de acuerdo con la reivindicación 1 que es H-H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-γ-Glu) -AAHDFVEWLL-SA-NH2.

14. Un compuesto que tiene la fórmula:

R1-Z-R2

en la que R1 es H, alquilo C1-4, acetilo, formilo, benzoilo o trifluoroacetilo; R2 es OH o NH2; y Z es un péptido que tiene:

(a) la fórmula V

His-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-X17 -Ala-Ala-His-Asp-Phe-Val-Glu-Trp-Leu-Leu-X28; (V)

en la que X17 es X X28 es Ser o está ausente; o

(b) la fórmula VI:

His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-X17-Ala-Ala-His-Asp-Phe-Val-Glu-Trp-Leu-Leu-Ser-Ala; (VI)

en la que X17 es X;

en donde X se selecciona del grupo que consiste en Glu, Lys y Cys; y en donde la cadena lateral de X está conjugada con un sustituyente lipófilo que tiene la fórmula:

(i) Z1, en donde Z1 es un residuo lipófilo conjugado directamente con la cadena lateral de X; o

(ii) Z1Z2, en donde Z1 es un residuo lipófilo, Z2 es un espaciador y Z1 está conjugado con la cadena lateral de X mediante Z2;

15. Un compuesto de acuerdo con la reivindicación 14 en el que Z tiene las fórmulas:

H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-isoGlu) -AAHDFVEWLLS; H-Aib-QGTFTSDYSKYLDS-K (Hexadecanoil-isoGlu) -AAHDFVEWLL; o H-Aib-EGTFTSDYSKYLDS-K (Hexadecanoil-isoGlu) -AAHDFVEWLLSA.

16. Una composición que comprende un compuesto de acuerdo con una cualquiera de las reivindicaciones 1 a 15, o una sal o derivado del mismo, en mezcla con un vehículo, por ejemplo, en donde la composición es una composición farmacéuticamente aceptable y el vehículo es un vehículo farmacéuticamente aceptable.

17. Un compuesto de acuerdo con una cualquiera de las reivindicaciones 1 a 15 para su uso en un método de tratamiento médico, por ejemplo

(a) para su uso en la prevención de aumento de peso o para promover la pérdida de peso;

(b) para su uso en un método para mejorar los niveles de glucosa en circulación, la tolerancia a la glucosa y/o los niveles de colesterol en circulación, disminuir los niveles de LDL en circulación y/o aumentar la relación HDL/LDL; o

(c) para su uso en un método de tratamiento de una afección causada o caracterizada por sobrepeso, por ejemplo, el tratamiento y/o la prevención de obesidad, obesidad mórbida, inflamación relacionada con obesidad, enfermedad de la vesícula relacionada con la obesidad, apnea del sueño inducida por obesidad, síndrome metabólico, prediabetes, resistencia a insulina, intolerancia a glucosa, diabetes de tipo 2, diabetes de tipo I, hipertensión, dislipidemia aterogénica, ateroesclerosis, arterioesclerosis, cardiopatía coronaria, enfermedad de la arteria periférica, ictus o enfermedad microvascular.

18. Un compuesto para su uso de acuerdo con la reivindicación 17 en donde el compuesto es para administración como parte de una terapia de combinación con un agente para el tratamiento de la diabetes, obesidad, dislipidemia o hipertensión.

19. Un compuesto para su uso de acuerdo con la reivindicación 18 en el que el agente para el tratamiento de la diabetes es metformina, una sulfonilurea, una glinida, un inhibidor de DPP-IV, una glitazona, insulina o un análogo de insulina.

20. Un compuesto para su uso de acuerdo con la reivindicación 18 en el que el agente para tratamiento de la obesidad es un agonista del receptor del péptido 1 similar a glucagón, el péptido YY o un análogo del mismo, un antagonista del receptor canabinoide 1, un inhibidor de lipasa, un agonista del receptor 4 de melanocortina o un antagonista del receptor 1 de la hormona concentradora de melanina.

21. Un compuesto para su uso de acuerdo con la reivindicación 18 en el que el agente para tratamiento de la hipertensión es un inhibidor de la enzima convertidora de angiotensina, un bloqueante del receptor de angiotensina II, un diurético, un beta bloqueante o un bloqueante de los canales de calcio.

22. Un compuesto para su uso de acuerdo con la reivindicación 18 en el que el agente para el tratamiento de la dislipidemia es una estatina, un fibrato, una niacina y/o un inhibidor de la absorción de colesterol.

23. Uso de un compuesto de acuerdo con una cualquiera de las reivindicaciones 1 a 15 en la preparación de un medicamento para:

(a) prevenir el aumento de peso o promover la pérdida de peso en un individuo que lo necesite;

(b) mejorar los niveles de glucosa en circulación, la tolerancia a la glucosa y/o los niveles de colesterol en circulación, reducir los niveles de LDL en circulación y/o aumentar la relación HDL/LDL en un individuo que lo necesite; o

(c) tratamiento de una afección ocasionada o caracterizada por sobrepeso, por ejemplo, el tratamiento y/o la prevención de obesidad, obesidad mórbida, inflamación relacionada con obesidad, enfermedad de la vesícula relacionada con obesidad, apnea del sueño inducida por obesidad, prediabetes, resistencia a insulina, intolerancia a glucosa, diabetes de tipo 2, diabetes de tipo I, hipertensión, dislipidemia aterogénica, ateroesclerosis, arterioesclerosis, arterioesclerosis, cardiopatía coronaria, enfermedad de la arteria periférica, ictus o enfermedad microvascular en un individuo que lo necesite.

24. Uso de acuerdo con la reivindicación 23 en el que el compuesto es para administración como parte de una terapia de combinación con un agente para tratamiento de diabetes, obesidad, dislipidemia o hipertensión, por ejemplo

(a) en donde el agente para el tratamiento de la diabetes es metformina, una sulfonilurea, una glinida, un inhibidor de DPP-IV, una glitazona, insulina o un análogo de insulina;

(b) en donde el agente para el tratamiento de la obesidad es un agonista del receptor del péptido 1 similar a glucagón, el péptido YY o un análogo del mismo, un antagonista del receptor 1 canabinoide, un inhibidor de lipasa, un agonista del receptor 4 de melanocortina o un antagonista del receptor 1 de la hormona concentradora de melanina.

(c) en donde el agente para tratamiento de la hipertensión es un inhibidor de la enzima convertidora de angiotensina, un bloqueante del receptor de angiotensina II, diuréticos, un beta bloqueante o un bloqueante de los canales de calcio; o

(d) en donde el agente para el tratamiento de la dislipidemia es una estatina, un fibrato, una niacina y/o un inhibidor de la absorción de colesterol.