1,273 Patentes de agosto de 2000 (pag. 37)

  1. 1153.-

    ENSAYOS RAPIDOS PARA PRODUCTOS DE AMPLIFICACION.

    (08/2000)
    Solicitante/s: IGEN INTERNATIONAL, INC.. Inventor/es: LINK, JOHN, R., GUDIBANDE, SATYANARAYANA, R. 12803 TWINBROOK PARK, KENTON, JOHN, H. Clasificación: C12Q1/68, C12P19/34.

    UN METODO PARA DETECTAR LA SECUENCIA DE ACIDO NUCLEICO DE PROVECHO EN EL PRODUCTO DE AMPLIFICACION DE UNA REACCION EN CADENA DE POLIMERASA U OTRA REACCION DIRECTA ELEMENTAL, COMPRENDE LOS PASOS DE: (A) INCORPORAR EN UNA MEZCLA DE REACCION EN CADENA DE POLIMERASA U OTRA MEZCLA DE REACCION DIRECTA ELEMENTAL, AL MENOS, UNA SECUENCIA DE ACIDO NUCLEICO, COMPLEMENTARIA DE LA SECUENCIA DE ACIDO NUCLEICO DE PROVECHO, MARCADA (I) EN LA TERMINACION 3` DE LA MISMA, O (II) EN LAS TERMINACIONES 3` Y 5` DE LA MISMA, CON UN COMPUESTO CAPAZ DE CREAR LUMINISCENCIA ELECTROQUIMICA; (B) DIRIGIENDO UNA REACCION EN CADENA DE POLIMERASA U OTRA REACCION DIRECTA ELEMENTAL; Y (C) MIDIENDO LA LUMINISCENCIA ELECTROQUIMICA DEL PRODUCTO DE AMPLIFICACION ETIQUETADO.

  2. 1154.-

    UTILIZACION DE UNA COMPOSICION CELULAR PARA EL TRATAMIENTO DE LOS ORGANISMOS HUMANOS O ANIMALES.

    (08/2000)
    Solicitante/s: INSTITUT PASTEUR INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM). Inventor/es: ROTH, CLAUDE, KOURILSKY, PHILIPPE, MIR, LLUIS. Clasificación: A61K48/00, C12N5/10.

    COMPOSICION DESTINADA A TRATAR LOS ORGANISMOS HUMANOS O ANIMALES COMPRENDIENDO CELULAS QUE TRANSMITEN LOS GENES QUE LES PERMITEN PRODUCIR EN VIVO UNA O VARIAS SUSTANCIAS BILOGICAMENTE ACTIVAS, DICHAS CELULAS PRESENTAN UNAS CARACTERISTICAS GENETICAS QUE LAS IMPIDEN DESARROLLARSE DURADERAMENTE EN EL ORGANISMO TRATADO Y LAS VUELVEN SUSCEPTIBLES DE SER ELIMINADAS ARTIFICIALMENTE O NATURALMENTE DEL ORGANISMO. ESTAS COMPOSICIONES PUEDEN SER EN PARTICULAR UTILIZADAS EN EL TRATAMIENTO DE TUMORES O AFECCIONES CANCEROSAS, EN CUYO CASO LAS SUBSTANCIAS UTILIZADAS SERAN LAS INTERLEUKINAS. LAS CELULAS CONTENIDAS EN ESTAS COMPOSICIONES SON AL MENOS PARCIALMENTE ALLOGENICAS O XENOGENICAS.

  3. 1155.-

    COMPOSICIONES FARMACEUTICAS QUE CONTIENEN NIFEDIPINA Y PROCEDIMIENTO PARA SU PREPARACION.

    (08/2000)
    Solicitante/s: ETHICAL PHARMACEUTICALS (U.K.) LIMITED. Inventor/es: TRIGGER, DAVID. Clasificación: A61K31/44, A61K9/16.

    SE PROPORCIONAN LOS COMPUESTOS Y LOS PROCESOS PARA SU PREPARACION EN LOS QUE LA NIFEDIPINA ESTA ENCUBIERTA SOBRE UN TRANSPORTADOR SOLUBLE EN AGUA EN UNA MEZCLA CON POLIVINILOPIRROLIDON O UN COPOLIMERO DE N Y UN POLIMERO DE BASE ACRILICA ACEPTABLE FARMACEUTICAMENTE. LA RAZON DE POLIVINILOPIRROLIDON O COPOLIMERO N ON / ACETATO DE VINILO AL CONTENIDO DE NIFEDIPINA ESTA EN LA PROPORCION DE ENTRE 1:1 A 1:10 Y LA RAZON DEL POLIMERO DE BASE ACRILICA AL CONTENIDO DE NIFEDIPINA ESTA EN LA PROPORCION DE ENTRE 1:4 A 1:20. SE PROPORCIONAN LOS COMPUESTOS ADECUADOS PARA UNA ADMINISTRACION DE NIFEDIPINA UNA VEZ AL DIA.

  4. 1156.-

    METODO PARA INHIBIR LA CARCINOGENESIS MEDIANTE TRATAMIENTO CON DESHIDRO-EPIANDROSTERONA Y SUS ANALOGOS.

    (08/2000)
    Solicitante/s: EAST CAROLINA UNIVERSITY. Inventor/es: NYCE, JONATHAN W. Clasificación: A61K31/56, A61K31/12.

    SE PRESENTA UN METODO PARA COMBATIR EL CANCER DE UN SUJETO QUE CONSISTE EN ADMINISTRAR A DICHO SUJETO DESHIDROEPIANDROSTERONA (DHEA) O UN ANALOGO DE LA MISMA EN UNA CANTIDAD EFECTIVA COMO PARA COMBATIR EL CANCER SEGUN EL CUAL LOS COLAPSOS INDUCIDOS POR LA DHEA O EL ANALOGO DE LA MISMA SE COMBATEN ADMINISTRANDO AL SUJETO UNA UBIQUINONA, EN UNA CANTIDAD EFECTIVA COMO PARA COMBATIR EL COLAPSO INDUCIDO POR LA DHEA O EL ANALOGO DE LA MISMA. UN ANALOGO DE LA DHEA PREFERENTE PARA LLEVAR A CABO EL METODO DE LA INVENCION ES LA 16 ALFA-FLUOREPIANDROSTERONA Y UNA UBIQUINONA PREFERENTE PARA LLEVAR A CABO EL METODO DE LA INVENCION ES LA COENZIMA Q10.

  5. 1157.-

    LENTILLA INTRAOCULAR DELGADA.

    (08/2000)
    Solicitante/s: ALLERGAN, INC.. Inventor/es: BRADY, DAN, G., GRISONI, BERNARD, F., DOYLE, CHRISTOPHER, E. Clasificación: A61L27/00, A61F2/16.

    UNA LENTILLA INTRAOCULAR A IMPLANTAR EN UN OJO Y QUE CONSTA DE UNA LENTE DE SILICONA DEFORMABLE CONFIGURADA DE TAL MODO QUE LA LENTE SE PUEDA DEFORMAR PARA PERMITIR QUE LA LENTILLA INTRAOCULAR PASE A TRAVES DE UNA INCISION EN FORMA DE TUNEL ESCLERAL HECHA EN EL OJO Y DE UNA LONGITUD NO SUPERIOR A 3,2 MM APROXIMADAMENTE. LA LENTILLA INTRAOCULAR SE PUEDE UTILIZAR PARA UNA AMPLIA GAMA DE POTENCIAS DE DIOPTRIA. CUANDO LA LENTILLA INTRAOCULAR SE IMPLANTA EN EL OJO, LA LENTE TIENE UNA RIGIDEZ SUFICIENTE COMO PARA NO SUFRIR SUSTANCIALMENTE LAS DISTORSIONES OPTICAS RESULTANTES DE LA FUERZA QUE EL OJO EJERCE EN LA LENTILLA INTRAOCULAR Y LA LENTE TIENE UN TAMAÑO SUFICIENTE COMO PARA PREVENIR SUSTANCIALMENTE EL DESLUMBRAMIENTO RESULTANTE DE LA INTERACCION DE LA LUZ Y DE LA PERIFERIA DE LA LENTE.

  6. 1158.-

    METODOS Y APARATO PARA LA FORMULACION Y NEGOCIACION DE CONTRATOS DE GESTION DE RIESGOS.

    (08/2000)

    METODOS Y APARATO QUE CONCIERNE LA GESTION DE RIESGOS RELACIONADO CON EVENTOS FUTUROS HASTA AHORA DESCONOCIDOS ESPECIFICOS. ACCIONISTAS "ESPONSOR" ESPECIFICAN UN PRODUCTO EN PARTICULAR RELACIONADO CON UN EVENTO O FENOMENO PARA QUE EXISTE UN CONJUNTO DE POSIBLES RESULTADOS FUTUROS. LOS ACCIONISTAS QUE "ORDENAN" OFRECEN ENTONCES CONTRATOS RELACIONADOS CON EL FENOMENO PREDETERMINADO Y CON UN CONJUNTO DE RESULTADOS CORRESPONDIENTES. LOS CONTRATOS OFRECIDOS ESPECIFICAN UNA ADJUDICACION (O PAGO) EN EL TIEMPO FUTURO DE LA MADUREZ PARA CADA RESULTADO, Y UNA CONSIDERACION (O RECOMPENSA) PAGABLE A CAMBIO...

  7. 1159.-

    POLIPEPTIDOS DERIVADOS DE LA ENDONEXINA 2 Y QUE PRESENTAN UNA ACTIVIDAD DE RECEPTOR DEL VIRUS DE LA HEPATITIS B, Y SU UTILIZACION EN COMPOSICIONES DIAGNOSTICAS Y FARMACEUTICAS.

    (08/2000)
    Solicitante/s: N.V. INNOGENETICS S.A.. Inventor/es: YAP, SING-HIEM. Clasificación: C07K14/00, C12N15/12, A61K39/395, C12P21/08, G01N33/566, A61K38/00, A61K39/29.

    EL INVENTO SE REFIERE A UNA COMPOSICION FARMACEUTICA QUE PUEDE CONTENER COMO SUSTANCIA ACTIVA: UN POLIPEPTIDO QUE TIENE LA PROPIEDAD DE SER RECEPTOR DE AMPLIOS Y/O MAYORES HBSAG (ANTIGENO DE SUPERFICIE DE LA HEPATITIS B), Y QUE CONTIENE O ESTA CONSTITUIDO POR II ENDONEXINA HUMANA, ESTANDO EL CITADO POLIPEPTIDO PRESENTE EN UNA CANTIDAD DE 0.6 A 50 MG/KG DE PESO CORPORAL, PREFERENTEMENTE DE 10 A 15 MG/KG DE PESO CORPORAL. LAS COMPOSICIONES FARMACEUTICAS DEL INVENTO SON UTILES PARA EL TRATAMIENTO Y EL DIAGNOSTICO DE LA INFECCION POR HBV (VIRUS DE LA HEPATITIS B).

  8. 1160.-

    ENSAYO NO INVASIVO.

    (08/2000)
    Solicitante/s: BLOCK, MYRON J. Inventor/es: BLOCK, MYRON, J. Clasificación: G01N21/35, A61B5/00, G01N21/59.

    HA SIDO DESARROLLADO UN NUEVO METODO DE DETECCION DE NO INVASION PARA LA GLUCOSA Y OTROS CONSTITUYENTES DE INTERES EN UNA MUESTRA. EL APARATO Y LOS METODOS DE LA INVENCION PROVEEN UN ANALOGO DE PERCEPCION DE COLOR DE LA VISION HUMANA, PREFERIBLEMENTE EN LA REGION INFRARROJA PROXIMA, REEMPLAZANDO LOS ESPECTROFOTOMETROS USADOS EN OTROS METODOS DE DETECCION DE INFRARROJOS PROXIMOS DE NO INVASION. UNA PLURALIDAD DE UNIDADES DETECTORAS SON USADOS, CADA UNA CUBRIENDO UNA REGION ANCHA DEL ESPECTRO DETECTADO, PERCEPCION DE COLOR PARALELA Y COLORIMETRIA. EN ALGUNAS CIRCUNSTANCIAS, UNA RED NEURAL ES USADA PARA EL ANALISIS, PERMITIENDO AL SISTEMA A APRENDER. ES TAMBIEN DESCRITO UN NUEVO METODO DE DISCRIMINACION DE FONDO.

  9. 1161.-

    CAJA CON CIERRE.

    (08/2000)
    Solicitante/s: WHY WRAP? INCORPORATED. Inventor/es: FRIAR, C. EDWARD, JONES, M., LEE, ROBINSON, H., JR., KING, DOUGLAS, N. Clasificación: B65D5/66, B65D5/10.

    UNA CAJA PARA CONTENER PRODUCTOS ALIMENTICIOS DURANTE SU ENVIO POR CORREO O EMBARQUE Y TRANSPORTE. LA CAJA TIENE AL MENOS UN PANEL DE EXTREMO FIJADO A UN PANEL DE CUERPO POR UNA LENGUETA DE CIERRE Y UN CONJUNTO DE RANURAS DE MANERA QUE EL PANEL DE EXTREMO NO PUEDA DESASEGURARSE SIN PREVER UNA EVIDENCIA VISIBLE DE LA ALTERACION. EL BORDE PRINCIPAL DE LA LENGUETA DE CIERRE TIENE AL MENOS UN PERFIL PARCIALMENTE CONICO CUANDO LA LENGUETA SE DOBLA PARA SU INSERCION A TRAVES DE LA RANURA . LA RANURA PUEDE ESTAR CURVADA PARA PREVER UN TOPE ADICIONAL ENTRE EL CONJUNTO DE RANURAS Y LA LENGUETA DE CIERRE ASOCIADA. EL CONTENEDOR PUEDE TENER MOTIVOS DECORATIVOS IMPRESOS SOBRE LA SUPERFICIE EXTERIOR PARA SUSTITUIR UNA CAJA DE EMBALAJE DE REGALO.

  10. 1162.-

    RECIPIENTE QUE CONTIENE UN LIQUIDO DE TRANSFUSION, Y LIQUIDO DE TRANSFUSION PREPARADO.

    (08/2000)

    UN PAQUETE DE LIQUIDO DE TRANSFUSION (ENVASE QUE CONTIENE LIQUIDO DE TRANSFUSION) UTIL PARA PREPARAR UN LIQUIDO DE TRANSFUSION COMPUESTO POR AZUCAR, AMINOACIDOS, ELECTROLITOS, EMULSION DE GRASAS Y VITAMINAS. LA PRESENTE INVENCION UTILIZA UN ENVASE DISEÑADO DE MANERA QUE SU INTERIOR ESTA DIVIDIDO EN DOS COMPARTIMIENTOS INDEPENDIENTES A TRAVES DE UN MEDIO DE SEPARACION. LA PRIMERA CAMARA CONTIENE EL LIQUIDO DE TRANSFUSION CON LA EMULSION DE GRASAS, AZUCAR, LAS VITAMINAS SOLUBLES EN GRASAS Y VITAMINAS ESPECIFICAS SOLUBLES EN AGUA. LA SEGUNDA CAMARA CONTIENE UN LIQUIDO DE TRANSFUSION QUE CONTIENE...

  11. 1163.-

    CELULAS ENDOTELIALES TRANSFORMADAS.

    (08/2000)
    Solicitante/s: NOVARTIS AG NOVARTIS-ERFINDUNGEN VERWALTUNGSGESELLSCHAFT M.B.H.. Inventor/es: BACH, FRITZ, H., DE MARTIN, RAINER. Clasificación: A61K48/00, C12N15/12, C12N15/85, C12N5/10, C12N15/86, A61K38/17, A01K67/027.

    SE PUEDEN PREPARAR CELULAS ENDOTELIALES QUE PRESENTAN UNA PROTEINA QUE TIENE ACTIVIDAD IKB PARA QUE LA ACTIVACION DE NFKB DE LAS CELULAS ESTE SUBSTANCIALMENTE BLOQUEADA ALTERANDO EL MATERIAL GENETICO DE LAS CELULAS PARA QUE LA ACTIVIDAD IKB SE PRESENTE CONTINUAMENTE, INMEDIATAMENTE DESPUES DE QUE LAS CELULAS ENDOTELIALES ACTIVAN UN ESTIMULO O A PETICION EN RESPUESTA A UN ESTIMULO EXTERNO PREDETERMINADO V. G. INTRODUCIENDO IKB HETEROLOGO QUE CODIFICA SECUENCIAS O PROMOTORES EN LAS CELULAS. LOS ORGANOS Y TEJIDOS QUE COMPRENDEN TALES CELULAS ENDOTELIALES SON UTILES EN TRASPLANTES V. G. EXOTRANSPLANTES, PORQUE SON VENTAJOSAMENTE MENOS SUSCEPTIBLES DE RECHAZO.

  12. 1164.-

    PRODUCCION DE POLVO.

    (08/2000)
    Solicitante/s: FHE TECHNOLOGY LIMITED. Inventor/es: COOMBS, JEFFREY STUART. Clasificación: B05D1/02, B22F1/02.

    SE PRESENTA UN METODO PARA PRODUCIR UN MATERIAL EN FORMA DE POLVO RECUBIERTO. EN EL METODO, EL METAL FUNDIDO O LA ALEACION DE METAL ES OBLIGADO A CAER EN UNA CORRIENTE Y ENTONCES SE ATOMIZA CON UN AEROSOL. UN MATERIAL LIQUIDO O SOLIDO DE COMPOSICION DIFERENTE SE INTRODUCE Y SE OBLIGA A PONERSE EN CONTACTO CON LA CORRIENTE O CON EL AEROSOL DE MANERA QUE SE FORME UN REVESTIMIENTO SOBRE LA SUPERFICIE COMPLETA O SOBRE PARTE DE LA SUPERFICIE DE LAS GOTITAS ATOMIZADAS. EL REVESTIMIENTO PUEDE SER EL MATERIAL INTRODUCIDO O UN PRODUCTO DE REACCION.

  13. 1165.-

    CAPSULA DE CIERRE A ROSCA CON BANDA DE GARANTIA.

    (08/2000)

    LA INVENCION SE REFIERE A UN DISPOSITIVO DE TAPONAMIENTO PARA RECIPIENTE CON COLLARIN SALIENTE QUE COMPRENDE UN TAPON ROSCADO PROLONGADO EN LA PARTE INFERIOR POR UN ANILLO DE INVIOLABILIDAD CONECTADO AL TAPON POR UNA ZONA DE CONEXION DE ESCASA RESISTENCIA MECANICA, COMPRENDIENDO DICHO ANILLO UNA TIRA DEFORMABLE DE UNION DELIMITADA EN LA PARTE INFERIOR POR UN SALIENTE ANULAR INTERNO CUYA CARA SUPERIOR (13A) ES NORMAL O SENSIBLEMENTE NORMAL AL EJE (1A) DEL DISPOSITIVO Y EN LA PARTE SUPERIOR POR UN SALIENTE ANULAR EXTERNO DISPUESTO A UN NIVEL INTERMEDIO ENTRE DICHO SALIENTE...

  14. 1166.-

    PEPTIDOS DE TGF-BETA 1 Y TGF-BETA 2 BIOLOGICAMENTE ACTIVOS.

    (08/2000)
    Solicitante/s: CELTRIX PHARMACEUTICALS, INC.. Inventor/es: OGAWA, YASUSHI, SCHMIDT, DAVID. Clasificación: A61K38/18, C07K14/495.

    LA INVENCION SE REFIERE A PEPTIDOS CORRESPONDIENTES A REGIONES DE LA SECUENCIA AMINOACIDA DE TGF-{BE}1 Y TGF-{BE}2, QUE CONSERVAN, BIEN EN FORMAS MONOMERICAS O POLIMERICAS, AL MENOS ALGO DE LA ACTIVIDAD BIOLOGICA DEL TGF-{BE} RESPECTIVO DE LONGITUD COMPLETA. LA FORMA MONOMERICA DEL PEPTIDO DERIVADO DE TFG-{BE}1, COMPRENDE LA SIGUIENTE SECUENCIA AMINOACIDA: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP. LA FORMA MONOMERICA DEL PEPTIDO DERIVADO DE TGF-{BE}2, COMPRENDE LA SIGUIENTE SECUENCIA AMINOACIDA: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA. LOS DIMEROS PUEDEN FORMARSE POR MEDIO DE ENLACES DISULFURO ENTRE LOS RESIDUOS DE CISTEINA AMINO-TERMINALES, LOS RESIDUOS DE CISTEINA CARBOXITERMINALES, O RESIDUOS DE CISTEINA AMINO- Y CARBOXI-TERMINALES DE LAS SUBUNIDADES MONOMERICAS.

  15. 1167.-

    COMPOSICIONES DE LIMPIEZA MULTI-SUPERFICIE Y METODO DE USO.

    (08/2000)

    COMPOSICIONES DE LIMPIEZA MULTISUPERFICIES Y METODO DE USO. COMPOSICIONES DENTRO DEL INVENTO QUE SON SUSTANCIALMENTE NO ESTRIABLES SOBRE SUPERFICIES DURAS QUE CONSTAN DE: A) UN SURFACTANTE SELECCIONADO DEL GRUPO QUE CONSISTE DE AMINO OXIDOS DENTRO DE LA FORMULA GENERAL (I), Y AMINO SALES CUATERNARIAS DENTRO DE LA FORMULA GENERAL (II), B) UN COMPUESTO ORGAMICO POLAR MUY LIGERAMENTE SOLUBLE EN AGUA, Y PREFERIBLEMENTE C) UNA CANTIDAD EFICAZ DE UN COMPUESTO ORGANICO SOLUBLE EN AGUA DE ETERES DE GLICOL SOLUBLES EN AGUA Y ALCOHOLES DE ALQUIL SOLUBLES EN AGUA, DONDE R{SUP.1} Y R{SUP.2} SON IGUAL...

  16. 1168.-

    EMPAQUETADURA TUBULAR TRENZADA CON MEDIOS DE FIJACION INTEGRALES Y SU METODO DE FABRICACION.

    (08/2000)
    Solicitante/s: FEDERAL-MOGUL SYSTEMS PROTECTION GROUP INC.. Inventor/es: TRESSLAR, MARIE C. Clasificación: F24C15/02, F16J15/06, F16J15/02.

    SE PRESENTAN JUNTAS ADECUADAS PARA SU USO A ALTAS TEMPERATURAS Y QUE TIENE APLICABILIDAD PARA SELLAR PUERTAS DE HORNOS. LAS JUNTAS SE TRENZAN A PARTIR DE UN ALAMBRE TAL COMO DE ACERO INOXIDABLE Y UN HILO TERMICAMENTE AISLANTE FORMADO, POR EJEMPLO, A PARTIR DE FIBRAS DE VIDRIO. LAS FORMAS DE ALAMBRE CONTINUO QUE TIENEN PARTES SOBRESALIENTES SEPARADAS SON RETENIDAS EN SU SITIO DENTRO DE LAS ABERTURAS FORMADAS POR LOS ALAMBRES Y SUMINISTRAN LA SUJECION DE LAS JUNTAS EN LAS ABERTURAS EN UNA SUPERFICIE . LAS JUNTAS SE MANUFACTURAN SOBRE UN TRENZADOR CIRCULAR CON APROXIMADAMENTE 1/3 DE LOS PORTADORES CARGADOS CON ALAMBRES Y 2/3 DE LOS PORTADORES CARGADOS CON HILO DE FIBRA DE VIDRIO . LAS JUNTAS SE CARACTERIZAN POR LA AUSENCIA DE UNA ESTRUCTURA DE SOPORTE ELASTICA, INTERNA. TAMBIEN SE PRESENTAN JUNTAS DEL TIPO LLAMADO "RENACUAJO" QUE COMPRENDEN HILO DE FIBRAS DE VIDRIO TRENZADO Y ALAMBRE.

  17. 1169.-

    AGENTES DE CONTRASTE QUE CONTIENEN PERFLUORO-1H,1H-NEOPENTILO Y METODO PARA USAR EL MISMO.

    (08/2000)
    Solicitante/s: MOLECULAR BIOSYSTEMS, INC.. Inventor/es: LOHRMANN, ROLF, KRISHNAN, ASHWIN. Clasificación: C07C69/65, A61B5/055, C11C3/00.

    SE PROPORCIONAN COMPUESTOS ORGANICOS PARA LA FORMACION DE IMAGENES DE DIAGNOSTICO QUE CONTIENEN AL MENOS UN GRUPO ARILO QUE SE HA DERIVADO PARA CONTENER AL MENOS UNA UNIDAD PERFLUO-1H,1HNEOPENTILO.LOS GRUPOS PERFLUO-1H, 1H-NEOPENTILO PRODUCEN UNA UNICA RESONANCIA MAGNETICA PARA ASEGURAR UNA RELACION MAXIMA DE SEÑAL/RUIDO. UN COMPUESTO PRESENTADO ES 2-0-OLEOILGLICEROL 1,3BIS (7'-{3",5"-DI [2'''2'''-DI (TRIFLUOMETIL) 3''',3''',3'''TRIFLUOPROPIL] FENIL}HEPTANOATO) .EN UNA FORMA PREFERIDA,SE PROPORCIONA UNA EMULSION DE LIPIDO COMO UN VEHICULO PORTADOR PARA SUMINISTRAR EL ANALOGO DERIVADO A UN RECEPTOR MAMIFERO.TAMBIEN SE PROPORCIONAN METODOS DE USO DE ESTOS COMPUESTOS EN MRI Y TOMOGRAFIA COMPUTERIZADA.

  18. 1170.-

    METODO Y APARATO PARA PRODUCIR ROLLOS INDIVIDUALES DE MATERIAL DE EMBALAJE.

    (08/2000)

    SE DESCRIBE UN CILINDRO DE PAPEL EXPANDIDO FORMADO DE UNA ESPIRAL COMO UN RELLENO DE VACIO. SE PROPORCIONA UN SISTEMA DE DISTRIBUCION PARA DISTRIBUCION AUTOMATICA Y MANUAL DEL PAPEL EXTENDIDO DESDE UN ROLLO BOBINADO CONTINUO, NO EXTENDIDO DE UN MATERIAL DE HOJA EXTENSIBLE. EL MATERIAL DE COMPRESION FORMADO POR EL MANDRIL DE EXTENSION PUEDE UTILIZARSE COMO UNA HOJA EXTENDIDA ALREDEDOR DE UN ARTICULO O COMO UN RELLENO DE VACIO, O PUEDE FORMARSE EN CILINDROS EN ESPIRAL PARA USO COMO RELLENO DE VACIO. EL SISTEMA DE DISTRIBUCION MANUAL INCLUYE UN ELEMENTO DE SOPORTE QUE SOPORTA UN ROLLO...

  19. 1171.-

    COMPOSICION DETERGENTE PARA SUPERFICIES DURAS.

    (08/2000)
    Solicitante/s: KAO CORPORATION. Inventor/es: KUBOTA, MASAKAZU KAO ICHIKAISHATAKU 4-208, JIN, NORIKAZU KAO AKABANERYO B-422, TSUKUDA, KAZUNORI KAWAMATA HEIGHTS 203, NAGUMO, HIROSHI IMPERIAL KIRE 207. Clasificación: C11D3/20, C11D7/26, C11D1/825.

    SE EXPONE UNA COMPOSICION DETERGENTE PARA SUPERFICIES DURAS, QUE CONTIENE: (A) UNA MEZCLA FORMADA POR AL MENOS DOS COMPUESTOS REPRESENTADOS POR LA FORMULA (I), EN LA QUE S ES UN NUMERO ENTERO DE 1 A 10, REPRESENTANDO EL NUMERO DE MOLES DEL GRUPO DE OXIDO DE ETILENO, LOS CUALES SON DIFERENTES EN GRADO DE POLIMERIZACION, DICHA MEZCLA (A) SATISFACE LA RELACION , EN LA QUE NT ES EL PORCENTAJE POR PESO DE UN COMPUESTO QUE TIENE T MOL DE UN GRUPO OXIETILENO AÑADIDO BASADO EN EL PESO DE LA MEZCLA (A). LA COMPOSICION DETERGENTE TIENE EXCELENTES PROPIEDADES DETERGENTES Y ESPUMANTES Y ES UTIL PARA LA ELIMINACION DE LA SUCIEDAD GRASA DESNATURALIZADA EN LA COCINA.

  20. 1172.-

    ATOMIZADOR CON CHORRO EN V.

    (08/2000)

    SE PRESENTA UN MEDIO ATOMIZADOR Y ROCIADOR DE FLUIDO QUE CONSTA DE: UNA CAMARA MEZCLADORA EN EL INTERIOR DE LA CUAL SE INTRODUCEN EL FLUIDO PARA SER ATOMIZADO Y EL GAS DE ATOMIZACION Y EN LA CUAL EL FLUIDO SE MEZCLA Y SE DISPERSA EN EL GAS; UNA BOQUILLA GENERALMENTE CONICA QUE SE EXTIENDE DESDE LA CAMARA DE MEZCLA A TRAVES DE LA CUAL EL FLUIDO Y EL GAS MEZCLADOS SON EMPUJADOS; Y UNA CAMARA EN EL INTERIOR DE LA CUAL EL FLUIDO Y EL GAS MEZCLADOS, ATOMIZADOS SON ROCIADOS. LA BOQUILLA CONICA ES ADECUADAMENTE UN CONDUCTO FRUSTOCONICO, RELATIVAMENTE ESTRECHO QUE CONTIENE UN MEDIO DE...

  21. 1173.-

    HOJA DE SIERRA DE CINTA MEJORADA.

    (08/2000)
    Solicitante/s: AMERICAN SAW & MFG. COMPANY. Inventor/es: HOLSTON, JAMES, R., KORB, WILLIAM, B. Clasificación: B23D61/12.

    UNA HOJA DE SIERRA MEJORADA INCLUYE GRUPOS DE DIENTES DE SIERRA DISPUESTOS A LO LARGO DE LOS BORDES CORTANTES DE LA HOJA. CADA GRUPO DE DIENTES INCLUYE, EN RELACION CON LA DIRECCION CORTANTE DE LA HOJA, UN DIENTE DELANTERO NO AFILADO, SIN TRISCAR SEGUIDO POR DOS PARES DE DIENTES TRASEROS DISPUESTOS ALTERNATIVAMENTE EN DIRECCIONES LATERALES OPUESTAS HACIA EL EXTERIOR DE LA LINEA CENTRAL DE LA HOJA. EL PRIMER PAR DE DIENTES TRASEROS TIENEN GENERALMENTE LA MISMA ALTURA QUE EL DIENTE DELANTERO Y EL SEGUNDO PAR DE DIENTES TRASEROS ES MAS CORTO Y TIENE UNA DISPOSICION SUBSTANCIALMENTE MAS ANCHA QUE EL PRIMER PAR. EL PAR DE DIENTES TRASEROS QUE SON MAS CORTOS Y MAS ANCHOS SE DISPONEN CONSECUTIVAMENTE Y EN RELACION INTERPUESTA ENTRE EL PRIMER PAR DE DIENTES TRASEROS. LA DISTANCIA DE DISPOSICION DEL PRIMER PAR DE DIENTES TRASEROS ES APROXIMADAMENTE UN 50% DE LA DISTANCIA DE LA DISPOSICION DEL SEGUNDO PAR DE DIENTES TRASEROS.

  22. 1174.-

    APARATO DE SEPARACION DE FLOCULO.

    (08/2000)
    Ver ilustración. Solicitante/s: BCDE GROUP WASTE MANAGEMENT LTD OY. Inventor/es: SUOMINEN, HANNU, L. Clasificación: C02F1/465.

    LA INVENCION SE REFIERE A UN APARATO SEPARADOR DE FLOCULOS QUE CONSTA DE UNA CELDA ELECTROLITICA PROVISTA DE ELECTRODOS DE HIERRO Y UNA CUBETA SEPARADORA A LA QUE EL FLOCULO ES ARRASTRADO HACIA ARRIBA POR UN GAS HIDROGENO PRODUCIDO EN LA ELECTROLISIS. LA CUBETA SEPARADORA CONSTA DE UN TUBO VERTICAL CON UN LONGITUD DE AL MENOS 10 VECES, Y PREFERENTEMENTE DE AL MENOS 15 A 20 VECES SU DIAMETRO.

  23. 1175.-

    ARANDELA DE GRAN SUPERFICIE.

    (08/2000)
    Solicitante/s: SFS INDUSTRIE HOLDING AG. Inventor/es: OSTERLE, HELMUT, BAUMGARTNER, STEFAN. Clasificación: E04D3/36, E04D5/14.

    EN UNA ARANDELA DE SUPERFICIE GRANDE CON UNA ABERTURA PARA MEDIOS DE FIJACION, SE DISPONE DE COMPONENTES DE ENGRANE SOBRE LA SUPERFICIE EN LA DIRECCION DE SUJECION QUE ENGRANAN CON UNA BANDA DE TAPA A SER SUJETA. LA ARANDELA DISPONE TAMBIEN DE CONTRAFUERTES EN FORMA DE PERLAS. LAS REGIONES DE ESQUINA DE LA ARANDELA DESCANSAN FUERA DE LAS SECCIONES CON CONTRAFUERTES Y PUEDEN SER DOBLADAS ELASTICAMENTE HACIA ABAJO ALREDEDOR DE UNA LINEA (L) A UN ANGULO AGUDO CON RESPECTO A LOS DOS EJES CENTRALES DE LA ARANDELA ASI COMO EN UNA REGION DE CARGA DADA. LOS COMPONENTES DE ENGRANE ESTAN FORMADOS EN ESTAS REGIONES DE ESQUINA.

  24. 1176.-

    ALEACION DE ACERO, BANDA DE ACERO FABRICADA CON ESTA ALEACION Y UTILIZACION DE LA BANDA DE ACERO.

    (08/2000)
    Solicitante/s: UDDELHOLM STRIP STEEL AKTIEBOLAG. Inventor/es: KRZYSZTALOWICKZ, DANIEL. Clasificación: C22C38/18, C22C38/34.

    UNA ALEACION DE ACERO CONTIENE EN PORCENTAJE EN PESO 0,5-1,0 DE C, 1-2 DE SI, 0,2 DE MN MAX, PREFERIBLEMENTE 0,001 DE S MAX, 0,1-0,5 DE CR, EL RESTO ESENCIALMENTE SOLO HIERRO. EN LA FORMA DE UNA LAMINA LAMINADA EN FRIO, ENDURECIDA Y TEMPLADA PUEDE SER UTILIZADA COMO UN MATERIAL DE REFUERZO PARA HOJAS DE SIERRA DE BANDA, HOJAS DE SIERRA DE MARCO Y HOJAS DE SIERRA CIRCULARES, DONDE LOS DIENTES ESTAN GUARNECIDOS CON UN MATERIAL DIFERENTE AL MATERIAL DE REFUERZO. ESTA LAMINA DE ACERO TIENE UNA ESTRUCTURA QUE CONSTA DE MARTENSITA TEMPLADA, Y POSIBLEMENTE CARBUROS RESTANTES OBTENIBLES MEDIANTE EL ENDURECIMIENTO A UNA TEMPERATURA ENTRE 780 Y 1000 (GRADOS) C Y TEMPLADO A UNA TEMPERATURA ENTRE 200 Y 550 (GRADOS) C.

  25. 1177.-

    COMPUESTOS DE 6-(2-IMIDAZOLINILAMINO)QUINOLINA UTILES COMO AGONISTAS DE ADRENOCEPTORES 2-ALFA.

    (08/2000)
    Solicitante/s: THE PROCTER & GAMBLE COMPANY. Inventor/es: CUPPS, THOMAS, LEE, MAURER, PETER, JULIAN. Clasificación: A61K31/47, C07D401/12, A61K31/415.

    LA PRESENTE INVENCION TRATA DE COMPUESTOS QUE TIENEN LA ESTRUCTURA (I) EN DONDE: (A) R ES ALCANILO O ALQUENILO INSUSTITUIDO DE C{SUB,1}-C{SUB,3}; R' SE SELECCIONA ENTRE ALQUENILO O ALQUINILO DE C{SUB,1}-C{SUB,3} INSUSTITUIDO; ALQUILTIO O ALCOXI INSUSTITUIDO DE C{SUB,1}-C{SUB,3}; HIDROXI; TIOL; Y HALOGENO; Y (C) R" SE SELECCIONA ENTRE HIDROGENO, ALCANILO O ALQUENILO INSUSTITUIDO DE C{SUB,1}-C{SUB,3}, METILO MONOSUSTIUIDO CON HIDROXI, TIOL O AMINO; ALQUILTIO O ALCOXI INSUSTITUIDO DE C{SUB,1}-C{SUB,3}; AMINO; AMIDA INSUSTITUIDA; AMIDA INSUSTITUIDA O SUSTITUIDA CON C{SUB,1}-C{SUB,3}, HALOGENO; SULFOXIDO INSUSTITUIDO; SULFONILO INSUSTITUIDO Y CIANO; COMPOSICIONES FARMACEUTICAS QUE LLEVAN ESTOS COMPUESTOS, Y LA UTILIZACION DE TALES COMPUESTOS PARA PREVENIR O TRATAR TRANSTORNOS RESPIRATORIOS, OCULARES Y/O GASTROINTESTINALES.

  26. 1178.-

    DISPOSICION DE SENSOR PARA EL CONTROL DE INSTALACIONES DE VENTILACION EN VEHICULOS.

    (08/2000)

    LA INVENCION SE REFIERE A UNA DISPOSICION DE SENSOR PARA CONTROL DE INSTALACIONES DE VENTILACION EN VEHICULOS, QUE RECIRCULAN O SUMINISTRAN AIRE EN DEPENDENCIA DE LA CONCENTRACION CONTAMINANTE EN EL AIRE FUERA DEL VEHICULO. LA DISPOSICION DE SENSOR COMPRENDE UN ELEMENTO SENSOR DE GAS CUYA RESISTENCIA ELECTRICA SE REDUCE CUANDO TIENE LUGAR UNA REDUCCION DE GASES Y SE INCREMENTA CUANDO PARECEN GASES DE OXIDACION. LA DISPOSICION COMPRENDE ADEMAS UNA UNIDAD DE EVALUACION CUYA POTENCIA ESTA CONECTADA AL DISPOSITIVO DE CONTROL DE LA INSTALACION DE VENTILACION. PARA SIMPLIFICAR...

  27. 1179.-

    SECUENCIACION DE ACIDOS NUCLEICOS.

    (08/2000)
    Solicitante/s: MEDICAL RESEARCH COUNCIL. Inventor/es: SIBSON, DAVID ROSS. Clasificación: C12Q1/68.

    LA INVENCION SUMINISTRA UN METODO PARA SECUENCIAR UN ACIDO NUCLEICO, QUE COMPRENDE BIEN LA ELIMINACION SECUENCIAL DE LAS BASES DEL ACIDO NUCLEICO UN NUMERO PREDETERMINADO A LA VEZ, SIENDO LIGADO EL PRODUCTO RESTANTE DE CADA PASO DE ELIMINACION DE LA BASE PREDETERMINADA A UN ADAPTADOR ETIQUETADO ESPECIFICO PARA LAS BASES Y QUE INCLUYE UNA SECUENCIA DE OLIGONUCLEOTIDO, O BIEN HIBRIDIZANDO UN INICIADOR PARA EL ACIDO NUCLEICO A SER SECUENCIADO Y EXTENDIENDO SECUENCIALMENTE EL INICIADOR UN NUMERO PREDETERMINADO DE BASES A LA VEZ, LAS BASES AÑADIDAS SON COMPLEMENTARIAS A LAS BASES DEL ACIDO NUCLEICO QUE ESTA SIENDO SECUENCIADO, Y CADA UNO DE LOS PASOS DE ADICION DE BASES SE REALIZA MEDIANTE EL USO DE UN ADAPTADOR ETIQUETADO ESPECIFICO PARA LAS BASES Y QUE INCLUYE UNA SECUENCIA DE OLIGONUCLEOTIDO QUE CONTIENE LAS BASES PREDETERMINADAS, EN CUALQUIER CASO, LA ETIQUETA DEL ADAPTADOR ETIQUETADO ES ESPECIFICA PARA SUS BASES PREDETERMINADAS, RESPECTIVAS.

  28. 1180.-

    INSTRUMENTO ENDOSCOPICO PARA EFECTUAR LIGADURAS.

    (08/2000)
    Solicitante/s: DABEGRAN TECHNOLOGIES, INC. Inventor/es: AHMED, MUNIR. Clasificación: A61B17/00.

    INSTRUMENTO ENDOSCOPICO PARA LIGAR LESIONES MULTIPLES DENTRO DE UN ORGANO CORPORAL HUECO. UNA PLURALIDAD DE CORDELES SE DISPONEN SOBRE EL TUBO PARA EXTENDERSE LONGITUDINALMENTE SOBRE EL MISMO Y PLEGARSE SOBRE EL EXTREMO DISTAL DEL TUBO. UNA PLURALIDAD DE ANILLOS ELASTICOS SE MONTA SOBRE EL TUBO EN POSICION EXTENDIDA SOLAPANDO LOS CORDELES . EL SEGMENTO DE CADA CORDEL ENTRE CADA PAR DE ANILLOS ADYACENTES SE HALLA AFLOJADO CON UNA LONGITUD IGUAL O SUPERIOR A LA DISTANCIA EXISTENTE ENTRE EL EXTREMO DISTAL DEL TUBO EL ANILLO MAS ALEJADO DEL PAR. MEDIANTE UN CORDEL ENLAZADO ENHEBRADO A TRAVES DE UN CANAL DE TRABAJO DEL ENDOSCOPIO Y CONECTADO A LOS CORDELES , SE PUEDE EJERCER UNA TRACCION SOBRE EL MISMO PARA RETRAER SIMULTANEAMENTE LOS CORDELES Y DESALOJAR CADA ANILLO EN UNA SECUENCIA ESCALONADA CONTROLADA CON UN PROCESO EN EL QUE SOLO UN ANILLO ELASTICO A LA VEZ SE MUEVE SOBRE EL TUBO EN EL PROCESO DE SU DESALOJO PARA LIGAR UNA LESION QUE HA SIDO PARCIALMENTE SUCCIONADA DENTRO EL TUBO.

  29. 1181.-

    PROCEDIMIENTO Y APARATO PARA REVESTIR UNA TUBERIA CON UN REVESTIMIENTO POLIMERICO.

    (08/2000)

    UN REVESTIMIENTO DE POLIETILENO ES ARRASTRADO A TRAVES DE UN TROQUEL Y A TRAVES DEL TUBO Y REVERTIDO AL DIAMETRO INTERNO DEL TUBO. LA FUERZA DEL ARRASTRE ES LA MITAD DEL ESFUERZO DE RENDIMIENTO DEL REVESTIMIENTO O MENOS. EL TROQUEL TIENE UNA ENTRADA; UNA GARGANTA Y UNA SALIDA, LA ENTRADA DECRECE EN DIAMETRO HACIA LA GARGANTA Y LA SALIDA SE INCREMENTA EN DIAMETRO FUERA DE LA GARGANTA. EL REVESTIMIENTO TIENE UN DIAMETRO MAXIMO ANTES DEL TROQUEL, UN DIAMETRO MINIMO EN EL TROQUEL Y UN DIAMETRO INTERMEDIO DESPUES DEL TROQUEL. EL REVESTIMIENTO SE PLIEGA HACIA EL INTERIOR...

  30. 1182.-

    METODO Y DISPOSITIVO DE SINCRONIZACION.

    (08/2000)
    Solicitante/s: PHILIPS ELECTRONICS N.V.. Inventor/es: MAAS, JOHANNES, ADRIANUS, ANNA, GERARDUS, MEERTENS, JOHANNES, BERNARDUS. Clasificación: H04N5/08.

    UNA DISPOSICION DE SINCRONIZACION COMPRENDE UN CIRCUITO DE VENTANA (WINC1, WINC2) PARA GENERAR UNA SEÑAL DE VENTANA PERIODICA (LW,RW), Y UN CIRCUITO DE ACTIVACION (GC) PARA SUMINISTRAR UN IMPULSO DE ACTIVACION PERIODICO (HP). EL IMPULSO DE ACTIVACION (HP) ESTA RELACIONADO CON UN IMPULSO DE SINCRONIZACION PRESENTADO (HS) SI EL IMPULSO DE SINCRONIZACION PRESENTADO (HS) OCURRE DURANTE LA SEÑAL DE VENTANA (LW, RW). EL CIRCUITO DE ACTIVACION (GC) GENERA EL IMPULSO DE ACTIVACION (HP) RELACIONADO CON UN BORDE CONDUCTOR DE LA SEÑAL DE VENTANA (LW) SI EL IMPULSO DE SINCRONIZACION PRESENTADO (HS) OCURRE ANTES DEL INICIO DE LA SEÑAL DE VENTANA (LW, RW), Y EL CIRCUITO DE ACTIVACION (GC) GENERA EL IMPULSO DE ACTIVACION (HP) RELACIONADO CON EL BORDE DE SALIDA DE LA SEÑAL DE VENTANA (RW) SI EL IMPULSO DE SINCRONIZACION PRESENTADO (HS) OCURRE DESPUES DEL FINAL DE LA SEÑAL DE VENTANA (LW, RW).

  31. 1183.-

    MOTOR DE PERCUSION HIDRAULICA.

    (08/2000)
    Solicitante/s: G-DRILL AB. Inventor/es: GUSTAFSSON, PER. Clasificación: E21B4/14.

    UN MOTOR HIDRAULICO DE IMPACTO EN FORMA DE UNA MAQUINA PERFORADORA DE AGUJEROS EN UNA ROCA ACCIONADO POR AGUA TIENE UN RODETE DE VALVULA QUE TIENE DOS SUPERFICIES DE CONTROL DIRIGIDAS IGUAL DE GRANDES Y OPUESTAS (A1 Y A2). LA VALVULA TIENE TAMBIEN UNA TERCERA SUPERFICIE DE CONTROL (A3) QUE ES MAS PEQUEÑA QUE LAS OTRAS DOS Y QUE ESTA CONTINUAMENTE BAJO PRESION. LA TERCERA SUPERFICIE DE CONTROL (A3) ACTUA EN LA MISMA DIRECCION QUE LA SEGUNDA SUPERFICIE DE CONTROL (A2). CUANDO LA PRIMERA SUPERFICIE DE CONTROL (A1) ESTA BAJO PRESION PERO LA SEGUNDA SUPERFICIE DE CONTROL (A2) NO LO ESTA, ENTONCES LA VALVULA SE MUEVE EN UNA DIRECCION, Y CUANDO LA PRIMERA Y SEGUNDA SUPERFICIES DE CONTROL (A1 Y A2) ESTAN BAJO UNA PRESION IGUAL (PRESION COMPLETA O SIN PRESION), ENTONCES LA VALVULA SE MUEVE EN LA OTRA DIRECCION MEDIANTE LA TERCERA SUPERFICIE DE CONTROL (A3).

  32. 1184.-

    VACUNA CONTRA INFECCIONES MICOBACTERIANAS.

    (08/2000)
    Solicitante/s: MEDICAL RESEARCH COUNCIL. Inventor/es: LOWRIE, DOUGLAS BRUCE. Clasificación: C12N5/10, A61K39/04.

    UNA ESTRUCTURA DE UN ACIDO NUCLEICO DESNUDO QUE CONTIENE UNA SECUENCIA DE CODIFICACION QUE CODIFICA UNA PROTEINA DE ESTRES MICOBACTERIANA O ANTIGENO RICO EN PROLINA O UN FRAGMENTO ANTIGENICAMENTE EFECTIVO DEL MISMO ENLAZADO DE FORMA OPERATIVA A UN PROMOTOR CAPAZ DE EXPRESAR LA SECUENCIA DE CODIFICACION ANTEDICHA EN UNA CELULA HUESPED DE UN MAMIFERO QUE ES UTIL COMO VACUNA CONTRA UNA INFECCION MICOBACTERIANA TAL COMO LA TUBERCULOSIS Y LA LEPRA.

<< · 19 · 28 · 32 · 34 · 35 · < · 37 · > · >>