CIP 2015 : A01N 63/02 : Sustancias producidas por, u obtenidas a partir de microorganismos o animales.

CIP2015AA01A01NA01N 63/00A01N 63/02[1] › Sustancias producidas por, u obtenidas a partir de microorganismos o animales.

Notas[g] desde A01N 25/00 hasta A01N 65/00: Biocidas; Productos que atraen o repelen a los animales perjudiciales; Reguladores del crecimiento de los vegetales

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A01 AGRICULTURA; SILVICULTURA; CRIA; CAZA; CAPTURA; PESCA.

A01N CONSERVACION DE CUERPOS HUMANOS O ANIMALES O DE VEGETALES O DE PARTES DE ELLOS (conservación de alimentos o productos alimenticios A23 ); BIOCIDAS, p. ej. EN TANTO QUE SEAN DESINFECTANTES, PESTICIDAS O HERBICIDAS (preparaciones de uso médico, dental o para el aseo que eliminan o previenen el crecimiento o la proliferación de organismos no deseados A61K ); PRODUCTOS QUE ATRAEN O REPELEN A LOS ANIMALES; REGULADORES DEL CRECIMIENTO DE LOS VEGETALES (mezclas de pesticidas con fertilizantes C05G).

A01N 63/00 Biocidas, productos que repelen o atraen a los animales perjudiciales, o reguladores del crecimiento de los vegetales, que contienen microorganismos, virus, hongos microscópicos, animales, p. ej. nematodos, o sustancias producidas por, u obtenidas a partir de microorganismos, virus, hongos microscópicos o animales, p.ej. encimas o productos de fermentación (que contienen compuestos de constitución determinada A01N 27/00 - A01N 59/00).

A01N 63/02 · Sustancias producidas por, u obtenidas a partir de microorganismos o animales.

CIP2015: Invenciones publicadas en esta sección.

BACILLUS AMYLOLIQUEFACIENS QV15 ESTIMULANTE DEL METABOLISMO SECUNDARIO DE COMPUESTOS FENÓLICOS Y DE LA CAPACIDAD INHIBIDORA DE LOS EXTRACTOS DE FRAMBUESA Y FRESA SOBRE LOS ENZIMAS RELACIONADAS CON EL SÍNDROME METABÓLICO.

(27/12/2018) Cepa bacteriana Bacillus amyloliquefaciens QV15 (CECT 9371), microorganismo del grupo de las bacterias Gram +, género Bacillus, estimulante del metabolismo secundario de compuestos fenólicos, mejorador de los extractos de fruto y hoja de frambuesa y fresa sobre las enzimas relacionadas con la regulación de la glucosa en sangre (alfa glucosidasa), hipertensión (enzima convertidora de angiotensina ACE), e inflamación (cicloxigenasa COX2). Esta cepa ha sido aislada a partir de la rizosfera de Pinus pinea, en agar nutritivo (PCA), y ha sido caracterizada desde el punto de vista morfológico, bioquímico y genético mediante secuenciación del gen 16s. Puede ser utilizada con objeto de mejorar las propiedades de los extractos con respecto a su aplicación sobre…

Bacillus amyloliquefaciens QV15 estimulante del metabolismo secundario de compuestos fenólicos y de la capacidad inhibidora de los extractos de frambruesa y fresa sobre los enzimas relacionados con el síndrome metabólico.

(21/12/2018) Cepa bacteriana Bacillus amyloliquefaciens QVI5 (CECT 9371), microorganismo del grupo de las bacterias Gram +, género Bacillus, estimulante del metabolismo secundario de compuestos fenólicos, mejorador de los extractos de fruto y hoja de frambuesa y fresa sobre las enzimas relacionadas con la regulación de la glucosa en sangre (alfa glucosidasa), hipertensión (enzima convertidora de angiotensina ACE), e inflamación (cicloxigenasa COX2). Esta cepa ha sido aislada a partir de la rizosfera de Pinus pinea, en agar nutritivo (PCA), y ha sido caracterizada desde el punto de vista morfológico, bioquímico y genético mediante secuenciación del gen 16s. Puede ser utilizada con objeto de mejorar las propiedades de los extractos con respecto a su aplicación sobre enzimas relacionadas con el síndrome…

COMPOSICIONES FERTILIZANTES Y SU USO PARA MEJORAR LA SOLUBILIZACIÓN DEL POTASIO DEL SUELO.

(20/12/2018). Solicitante/s: FERTINAGRO BIOTECH, S.L. Inventor/es: ATARES REAL,SERGIO, NARANJO OLIVERO,MIGUEL ANGEL, ROMERO LOPEZ,Joaquin, SALAET MADORRAN,Ignasi, FERRER GINES,María, YANCE CHAVEZ,Tula del Carmen.

La invención proporciona una composición fertilizante P, K, N, NP, PK, NK o NPK que incluye un extracto de Enterobacter xiangfangensis, cepa CECT 9264, y niacina como estimulador del crecimiento bacteriano, además de una fuente de carbono y de micronutrientes.

Composiciones desinfectantes sinérgicas con aceites esenciales.

(18/12/2018). Solicitante/s: MULTIBIND BIOTEC GMBH. Inventor/es: LISOWSKY,Thomas, ESSER,Karlheinz.

Composición desinfectante que comprende una mezcla sinérgica de: a) al menos un aceite esencial en concentraciones del 0,01 % al 1 % (peso) con respecto al peso total de la composición, b) al menos un tipo de ácido orgánico en concentraciones de 1 mM a 50 mM, c) al menos un ion metálico en concentraciones de 0,1 mM a 5 mM, en la que el ion metálico se selecciona entre el grupo que consiste en hierro, cobalto, níquel, cobre y cinc, y d) al menos un compuesto tensoactivo en concentraciones del 0,01 % al 1 % (peso) con respecto al peso total de la composición, en la que la relación molar del ácido orgánico y el ion metálico se ajusta a 10:1.

PDF original: ES-2694147_T3.pdf

Sistemas de disolventes para formulaciones de unción dorsal continua para combatir parásitos.

(13/12/2018). Solicitante/s: MERIAL, INC.. Inventor/es: SOLL,MARK DAVID, CLEVERLY,DOUGLAS, GOGOLEWSKI,RONALD PETER, THWAITES,PAUL.

Una formulación para unción dorsal continua veterinaria para el tratamiento tópico, transdérmico o la profilaxis de infecciones parasitarias, que comprende: (a) una cantidad efectiva de clorsulón; (b) una lactona macrocíclica seleccionada de ivermectina y eprinomectina; (c) un éter de glicol; y (d) un potenciador de estabilidad, en el que el potenciador de estabilidad es glicerol formal.

PDF original: ES-2693696_T3.pdf

Método para prevenir o controlar una infección fúngica.

(07/12/2018). Solicitante/s: THE NEW ZEALAND INSTITUTE FOR PLANT AND FOOD RESEARCH LIMITED. Inventor/es: WURMS,KIRSTIN VERITY, CHEE,ANNETTE AH.

Un método para prevenir o controlar una infección fúngica que comprende aplicar a una planta que lo necesita, la composición que comprende (a) 0,1 a 2,0 % v/v de aceite de soja, (b) 0,05 a 1,0 % p/v de ésteres de poliglicerol de ácidos grasos, (c) uno o más antioxidantes, y (d) opcionalmente, uno o más de grasa de leche anhidra (AMF), aceite de oliva y grasa de coco.

PDF original: ES-2692993_T3.pdf

Formulaciones, composiciones y metabolitos de Chromobacterium y sus usos.

(14/11/2018). Solicitante/s: Marrone Bio Innovations, Inc. Inventor/es: ASOLKAR,RATNAKAR, MARRONE,PAMELA, NAMNATH,JAMES.

Un método no terapéutico para modular una infestación por plagas, en donde dicha plaga se selecciona entre Acari, Anthomyidae, Triozidae, Tenebrionidae, Scarabaiedae, en una ubicación donde se desea la modulación, que comprende aplicar una cantidad de una composición obtenida de Chromobacterium subtsugae cepa Nov (NRRL B-30655), eficaz para modular dicha infestación.

PDF original: ES-2689558_T3.pdf

Procedimientos que utilizan alternativas a antibióticos en la producción de bioetanol.

(03/10/2018). Ver ilustración. Solicitante/s: BUCKMAN LABORATORIES INTERNATIONAL, INC.. Inventor/es: CLARK, RICHARD, A., MCNEEL, THOMAS, E., OPPONG, DAVID, WIATR, CHRISTOPHER L., CORCORAN,MICHAEL L, PORTO,RITA DE CASSIA BORTOTO, HOEKSTRA,PHILIP.

Un método de producción de etanol por fermentación que comprende: a) fermentar un mosto fermentable en presencia de al menos un biocida no oxidable que es una dihalonitrilopropionamida, al menos un péptido antibacteriano policíclico y una levadura en un recipiente para producir etanol y un contenido de sólidos, en el que dicho biocida no oxidante controla el crecimiento de bacterias en el mosto sin reducir la población de levaduras y en el que dicho biocida no oxidante y dicho péptido antibacteriano policíclico son sinérgicos con respecto al control biocida de al menos una bacteria durante y/o después de la fermentación para producir etanol; y b) destilar el mosto fermentado para separar al menos una porción del etanol de dicho contenido de sólidos.

PDF original: ES-2684580_T3.pdf

Producto contra cucarachas a partir de comida y ácido bórico.

(20/08/2018). Solicitante/s: MATHIEU, Michel Robert. Inventor/es: MATHIEU,Michel Robert.

1. Producto contra cucarachas a partir de comida y ácido bórico, que presenta los siguientes componentes en tanto porciento en masa: - 70% de yema de huevo (cocido). - 20% de ácido bórico. - 10% de salsa de marisco (cabeza de langostino, apio, ajo, cebolla, zanahoria, vino blanco, agua, brandy, harina, orégano, sal y aceite de oliva).

PDF original: ES-1216654_U.pdf

COMPOSICIÓN PROMOTORA DE CRECIMIENTO DE PLÁNTULAS, UN KIT, UN MÉTODO DE APLICACIÓN, USO DE LOS COMPUESTOS ORGÁNICOS VOLÁTILES QUE COMPRENDEN LA COMPOSICIÓN.

(16/08/2018). Solicitante/s: UNIVERSIDAD DE LA FRONTERA. Inventor/es: QUIROZ CORTEZ,Andrés Eduardo, FINCHEIRA ROBLES,Paola Alejandra, PARADA IBAÑEZ,Maribel Eugenia.

La presente invención se enmarca en el área de compuestos promotores de crecimiento de plantas y en particular se refiere al uso de compuestos orgánicos volátiles, tales como: 2- nonanona, 2-undecanona, 2-tridecanona y 2-pentadecanona, en adelante llamados 2K-4, los cuales presentan actividad inductora del crecimiento. Estos compuestos se aplican a hortalizas previo a su trasplante al campo de cultivo, ya que fortalecen las raíces produciendo una inducción del crecimiento a nivel radical (longitud de raíz primaria, longitud raíces secundarias, longitud y densidad de pelos radicales) y foliar (peso foliar), disminuyendo de esta manera el estrés de las hortalizas debido al cambio del ambiente, es decir, disminuye las probabilidades de dependencia en el crecimiento por el tipo de suelo y el cambio del ambiente.

PROCESO PARA OBTENER UN EXTRACTO BIOCIDA.

(05/07/2018). Solicitante/s: UNIVERSIDAD NACIONAL DE COLOMBIA. Inventor/es: ARANGO GIRALDO,Natalia, ORTIZ REYES,Adriana Del Socorro, ROMERO TABAREZ,Magally, TORRES GRAJALES,Luisa Fernanda, URIBE LONDOÑO,Miguel.

La invención se refiere un proceso para obtener un extracto biocida a partir de microorganismos del género Bacillus sp, Serratia sp, Pseudomonas sp, Burkholderia sp, Brevundimonas sp, Escherichia sp, Delftia sp, Acinetobacter sp, Photorhabdus sp o Xenorhabdus sp, que comprende aislar y purificar el microorganismo, preparar un pre- inóculo, inocular en presencia de una resina adsorbente, y por último, separar y eluir la resina con un solvente orgánico hasta obtener un extracto bacteriano con actividad insecticida, fungicida y/o repelente.

Plaguicidas.

(02/05/2018). Solicitante/s: UNIVERSITY OF DURHAM. Inventor/es: GATEHOUSE,JOHN A, FITCHES,ELAINE C.

Una proteína de fusión que comprende: (i) una toxina proteica ω-ACTX-Hv1a que comprende la secuencia de aminoácidos SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (SEQ ID NO: 1), o una variante de la misma que retiene sustancialmente la actividad biológica de la toxina proteica ω-ACTX-Hv1a, teniendo dicha variante una secuencia de aminoácidos que tiene al menos un 75 % de identidad con la SEQ ID NO: 1; unida operativamente a (ii) una proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado, en donde la proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado es una lectina vegetal seleccionada entre una cualquiera o más de las siguientes: lectina de galanto (GNA), lectina de ajo Allium sativum, lectina de guisante Pisum sativum (P-lec), lectina de cacahuete Arachis hypogaea, lectina de judía verde (PHA, Phytohaemagglutinin).

PDF original: ES-2674324_T3.pdf

Bacteria aislada del género Streptomyces.

(18/04/2018). Solicitante/s: Agronutrition. Inventor/es: ERRAKHI,RAFIK, ATTIA,FAOUZI, CABANES,CÉDRIC.

Bacteria aislada del género Streptomyces seleccionada del grupo que consiste en: • la bacteria depositada y registrada en la CNCM con el N.º I-4467, y • los mutantes de dicha bacteria depositados y registrados en la CNCM con el N.º I-4467 capaces de inhibir el crecimiento de al menos un microorganismo, denominado microorganismo objetivo, elegido del grupo compuesto por Botrytis cinerae, Fusarium culmorum, Pythium ultimum, Phaeomoniella chlamydospora, Phaeomoniella aelophilum, Eutypa lata, Fomitiporia mediterranea y Botryosphaeria obtusa, obteniéndose los mutantes de dicha bacteria depositada por mutagénesis de dicha bacteria depositada. comprendiendo la bacteria depositada y los mutantes de dicha bacteria depositada una secuencia de ADN, denominada ADN 16Sr, que codifica el ARN ribosómico 16S de dicha bacteria, siendo dicha secuencia de ADN idéntica a la secuencia SEQ ID_NO1.

PDF original: ES-2676460_T3.pdf

Usos agrícolas de una nueva bacteria del género Streptomyces.

(18/04/2018) Método para tratar un material vegetal, en el que se aplica una composición de tratamiento que comprende al menos un agente biológico elegido en el grupo compuesto por: - bacterias del género Streptomyces que comprenden una secuencia de ADN, denominada 16S ADNr, que codifica el ARN ribosómico 16S de dicha bacteria, 100% homólogo con la SEQ ID_NO1, - medios de cultivo que comprenden polinucleótidos que tienen una secuencia de ADN 100% homóloga con SEQ ID_NO1, obtenida por: * cultivar al menos una bacteria del género Streptomyces que comprende la secuencia de 16S rADN 100% homóloga con SEQ ID_NO1 en un medio de cultivo adecuado para permitir el crecimiento…

Composiciones que comprenden un agente de control biológico y un insecticida.

(11/04/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: ANDERSCH, WOLFRAM, DR., HELLWEGE, ELKE, STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control bioIógico seleccionado del grupo que consiste en Bacillus pumilus (n.º de acceso NRRL B-30087), Bacillus subti/is AQ713 (n.º de acceso NRRL B-21661) y Bacillus subtilis AQ30002 (n.º de acceso NRRL B-50421), y al menos un insecticida seleccionado del grupo que consiste en agonistas receptores nicotínicos de acetilcolina (nCAhR) seleccionado del grupo que consiste en Clotianidina, lmidacloprida, Tiacloprida, Tiametoxam y Sulfoxaflor, y los activadores alostéricos del receptor nicotínico de acetilcolina (nAChR) esta seleccionado del grupo que consiste en Espinetoram y Espinosad en una relación en peso sinérgica de agente de control biológico e insecticida de 1:10 a 5000:1 donde el agente de control biológico es Bacillus pumilus; 1:10 a 10000:1 donde el agente de control biológico es Bacillus subtilis QST713; 1:10 a 1000:1 donde el agente de control biológico es Bacillus subtilis AQ30002.

PDF original: ES-2672500_T3.pdf

Uso combinado de las proteínas CRY1Ca y CRY1Fa para el control de insectos resistentes.

(24/01/2018). Solicitante/s: DOW AGROSCIENCES LLC. Inventor/es: WOOSLEY, AARON, T., MEADE, THOMAS, NARVA,KENNETH, STORER,NICHOLAS P, SHEETS,JOEL J, BURTON,STEPHANIE L.

Una planta o célula vegetal transgénica que comprende ADN que codifica una proteína insecticida Cry1Ca y ADN que codifica una proteína insecticida Cry1Fa.

PDF original: ES-2663283_T3.pdf

Extracto bacteriano para trastornos respiratorios y procedimiento para su preparación.

(10/01/2018). Solicitante/s: OM PHARMA. Inventor/es: BAUER,JACQUES ALAIN, SALVAGNI,MARCO, VIGROUX,JEAN-PIERRE LEON, CHALVET,LAETITIA, CHIAVAROLI,CARLO.

Un extracto de todas las especies bacterianas seleccionadas entre: Moraxella catarrhalis, Haemophilus influenzae, Klebsiella pneumoniae, Staphylococcus aureus, Streptococcus pneumoniae, Streptococcus pyogenes y Streptococcus sanguinis, que puede obtenerse lisando las especies bacterianas en un pH inicial mayor de 12, comprendiendo dicho extracto menos de 100 μg/ml de ácidos nucleicos, al menos 0,3 mg/ml de sacáridos, y no planteando el extracto ningún riesgo de enfermedades priónicas.

PDF original: ES-2665002_T3.pdf

Combinación de principios activos que contiene bacilo de fluopyram y agente de control biológico.

(10/01/2018). Solicitante/s: Bayer Intellectual Property GmbH. Inventor/es: HELLWEGE, ELKE, HUNGENBERG,HEIKE.

Combinación de principios activos que comprende: (A) Fluopyram, (B) una bacteria formadora de esporas del género Bacillus, seleccionada del grupo que consiste en Bacillus firmus cepa CNCM 1-1582, y (C) al menos un agente de control biológico seleccionado del grupo que consiste en (C1) bacteria incluyendo bacterias formadoras de esporas colonizadoras de raíces, o bacterias útiles como fungicidas, bioinsecticidas o nematicidas seleccionado entre el grupo que consiste en (C1.27) Bacillus thuringiensis subsp. tenebrionis cepa NB 176 cuyos productos se conocen como Novodor® FC de BioFa, DE.

PDF original: ES-2665361_T3.pdf

Combinaciones que incluyen las proteínas Cry34Ab/35Ab y Cry3BA para impedir el desarrollo de resistencia en las larvas de crisomélidas del maíz (Diabrotica spp.).

(13/12/2017). Solicitante/s: DOW AGROSCIENCES LLC. Inventor/es: NARVA, KENNETH, E., WOOSLEY, AARON, T., MEADE, THOMAS, HEY,TIMOTHY,D, OLSON,MONICA,BRITT, FENCIL,KRISTIN J, LI,HUARONG.

Una planta transgénica que expresa una proteína insecticida Cry34Ab, una proteína insecticida Cry35Ab y una proteína insecticida Cry3Ba.

PDF original: ES-2665514_T3.pdf

MÉTODO PARA LA REGENERACIÓN DE TEJIDOS VEGETALES DAÑADOS.

(07/12/2017). Solicitante/s: CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS (CSIC). Inventor/es: LAROMAINE,Sagué Anna, SÁNCHEZ COLL,Nuria.

Método para la regeneración de tejidos vegetales dañados. La presente invención proporciona un método para regenerar tejidos vegetales dañados. Dicho método está basado en el uso de celulosa, preferiblemente celulosa bacteriana (CB), la cual se aplica directamente sobre la zona dañada permitiendo su rápida cicatrización. La presente invención demuestra así el potencial regenerador de la celulosa, preferiblemente celulosa bacteriana, sobre heridas en plantas. En una realización preferida del método de la invención, se emplea la celulosa en combinación con nanopartículas de plata para, además de regenerar el tejido, prevenir y/o tratar infecciones bacterianas en el mismo.

PDF original: ES-2645757_A1.pdf

Soporte de información que presenta propiedades antivirales y su procedimiento de fabricación.

(06/12/2017). Solicitante/s: Oberthur Fiduciaire SAS. Inventor/es: ROSSET,HENRI.

Soporte de información destinado a manipularse con relativa frecuencia, caracterizado por que contiene: - del 0,1 al 2% en peso, con respecto a su peso total, de al menos un virucida de origen natural, siendo dicho virucida la monolaurina, y - al menos un agente humectante, siendo dicho agente humectante el glicerol. caracterizándose por que dicho soporte de información se trata de un pasaporte, un documento de identidad, un permiso de conducir, una tarjeta de acceso, una tarjeta de fidelidad, una tarjeta de fotocopia, una tarjeta de restaurante, una carta de juego, una tarjeta para coleccionar, un medio de pago, en particular una tarjeta de pago, un billete de banco, un vale de compra o un recibo, un tique de acceso a manifestaciones culturales o deportivos, un certificado de autenticidad, o también un embalaje, un libro, un mapa geográfico, una etiqueta, un sobre o una revista.

PDF original: ES-2660864_T3.pdf

MÉTODO PARA LA REGENERACIÓN DE TEJIDOS VEGETALES DAÑADOS MEDIANTE CELULOSA BACTERIANA.

(09/11/2017). Solicitante/s: CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS (CSIC). Inventor/es: LAROMAINE,Sagué Anna, SÁNCHEZ COLL,Nuria.

La presente invención proporciona un método para regenerar tejidos vegetales dañados. Dicho método está basado en el uso de celulosa, preferiblemente celulosa bacteriana (CB), la cual se aplica directamente sobre la zona dañada permitiendo su rápida cicatrización. La presente invención demuestra así el potencial regenerador de la celulosa, preferiblemente celulosa bacteriana, sobre heridas en plantas. En una realización preferida del método de la invención, se emplea la celulosa en combinación con nanopartículas de plata para, además de regenerar el tejido, prevenir y/o tratar infecciones bacterianas en el mismo.

Método para aumentar la resistencia al estrés hídrico en plantas.

(06/09/2017). Solicitante/s: IDEN BIOTECHNOLOGY, S.L. Inventor/es: BAROJA FERNANDEZ,MIREN EDURNE, MUÑOZ PEREZ,FRANCISCO JOSE, POZUETA ROMERO,JAVIER, LI,JUN, OVECKA,Miroslav, EZQUER GARÍN,Ignacio, BAHAJI,ABDELLATIF.

Procedimiento para alterar el patrón de desarrollo, aumentar el crecimiento y la acumulación de almidón, alterar la estructura del almidón y aumentar la resistencia al estrés hídrico en plantas. El procedimiento consiste en cultivar plantas en una atmósfera en la que estén presentes volátiles emitidos por un microorganismo, sin que exista contacto físico entre el microorganismo y la planta. Se basa en el descubrimiento de que los volátiles emitidos por bacterias Gram positivas o negativas, levaduras y hongos microscópicos promueven un incremento del crecimiento de las plantas en general, con aumento de la longitud, el número de hojas y/o el número de ramas de la planta, así como incremento del almidón acumulado y la alteración estructural de este biopolímero, y modificación del patrón de desarrollo, con aumento de botones florales. También puede observarse resistencia incrementada al estrés hídrico también se observa incremento de almidón en hojas separadas de plantas completas.

PDF original: ES-2651097_T3.pdf

Variantes de proteínas AXMI205 y métodos para su uso.

(23/08/2017). Solicitante/s: Athenix Corp. Inventor/es: HIENRICHS,VOLKER, WILLIAMS,JAYME.

Una molécula de ácido nucleico recombinante que comprende una secuencia de nucleótidos que codifica un polipéptido que es una variante de SEQ ID NO:2, donde dicho polipéptido tiene actividad plaguicida mejorada relativa a la SEQ ID NO:2 y donde dicha secuencia de nucleótidos se selecciona de entre SEQ ID NO:4, 5 ó 6, o una secuencia de nucleótidos que codifica una secuencia de aminoácidos seleccionada de entre SEQ ID NO:7, 8, 9, 10, 11 ó 12.

PDF original: ES-2647596_T3.pdf

Proteínas de toxinas activas contra hemípteros y coleópteros de Bacillus thuringiensis.

(26/07/2017). Solicitante/s: MONSANTO TECHNOLOGY, LLC. Inventor/es: HECK, GREGORY R., FLASINSKI,Stanislaw, BAUM,JAMES, PENN,STEPHEN R, SHI,XIAOHONG, SUKURU,UMA RAO.

Un polinucleótido que codifica una proteína inhibidora de insectos TIC807, en el que dicha proteína inhibidora de insectos TIC807 comprende una secuencia polipeptídica que tiene por lo menos 70 % de identidad de secuencia con SEQ ID NO: 5.

PDF original: ES-2644945_T3.pdf

Composición vítrea seca que comprende un material bioactivo.

(07/06/2017). Solicitante/s: ADVANCED BIONUTRITION CORPORATION. Inventor/es: HAREL,MOTI, SCARBROUGH,JANUARY, DREWES,ROGER.

Un método para preparar una composición seca estable que comprende un material bioactivo, un agente formador de matriz y un agente formador de cristales, comprendiendo dicho método: (a) combinar el material bioactivo, el agente formador de matriz y el agente formador de cristales en una solución; (b) congelar instantáneamente la suspensión de la etapa (a) en nitrógeno líquido para formar una composición amorfa en perlas, hebras o gotitas; (c) secado primario de las partículas congeladas purgadas de la etapa (b) bajo vacío a una presión entre 2000 y 10000 mTORR y a una temperatura por encima del punto de congelación de las partículas; y (d) efectuar un secado secundario de las partículas secadas primariamente de la etapa (c) bajo presión a vacío completo y a una temperatura que va de 30 a 60ºC.

PDF original: ES-2639397_T3.pdf

Composiciones antibacterianas.

(12/04/2017). Solicitante/s: AmpliPhi Biosciences Corporation. Inventor/es: JIA,YING.

Un procedimiento para matar bacterias sobre una superficie que es un equipo médico, ropa de cama, muebles, paredes o suelos en un hospital que comprende aplicar a la superficie una composición desinfectante que comprende un vehículo y dos o más fagos, comprendiendo los fagos el fago K o mutantes del mismo, y el fago P68 o mutantes del mismo, caracterizado porque la concentración de ambos fagos es de al menos 5:1 ufp de fagos:ufc de bacterias para inducir la lisis externa de las bacterias para las que el fago es un patógeno cuando dichas bacterias están presentes sobre la superficie a desinfectar.

PDF original: ES-2632367_T3.pdf

Cepa bacteriana aislada del género burkholderia y metabolitos pesticidas del mismo.

(12/04/2017) Una cepa aislada de Burkholderia A396 (NRRL No. de Acceso B-50319) que tiene las siguientes características: (A) en una secuencia genética de ARNr 16S que comprende las secuencias directas que tiene al menos 99% de identidad con las secuencias establecidas en SEQ ID NO:8, 11, y 12 y secuencias inversas que tiene al menos 99% de identidad con las secuencias establecidas en SEQ ID NO:9, 10, 13, 14 y 15; (B) actividad pesticida; (C) produce un compuesto pesticida seleccionado de (i) un compuesto que tiene una estructura (FR901228)**Fórmula** (ii) un compuesto que tiene una estructura**Fórmula** (iii) un compuesto que tiene una estructura**Fórmula** (iv) un compuesto que tiene una estructura**Fórmula** (v) un compuesto que…

BIOPINTURA ANTIFOULING QUE COMPRENDE EXTRACTOS DE MACROALGAS ATRACTANTES DE BACTERIAS EPIBIONTES Y EXTRACTOS ACTIVOS DE BACTERIAS CON CARACTERÍSTICA ANTIFOULING.

(16/03/2017). Solicitante/s: UNIVERSIDAD DE CONCEPCION. Inventor/es: URRUTIA BRIONES,Homero Enrique, SOSSA FERNANDEZ,Katherine Elizabeth, BECERRA ALLENDE,José Violidio, PEREZ MANRIQUEZ,Claudia Isabel, RUIZ-TAGLE MOENA,Nathaly Marian, VIDAL ARAYA,José Miguel, NOCKER-EINSIEDLER,Andreas.

Esta tecnología corresponde a una biopintura antifouling que comprende un sistema de protección de dos barreras, esta pintura comprende extractos de macroalgas atractantes de bacterias epibiontes con actividad antimicrofouling y extractos activos de bacterias con característica antifouling, estos extractos están inmovilizados en una matriz base polimerica. Esta biopintura se utiliza sobre superficies inertes expuestas a agua de mar, principalmente redes de uso en acuicultura, tuberías, y cascos de barcos.

Composición desactivadora de priones y métodos para su uso.

(08/03/2017). Solicitante/s: AMERICAN STERILIZER COMPANY. Inventor/es: MCDONNELL, GERALD E., KAISER,NANCY-HOPE ELIZABETH, TIREY,JASON F.

Un método para limpiar una superficie y/o artículo infectado por priones, el método comprende poner en contacto la superficie y/o el artículo con una composición desactivadora de priones que comprende al menos un agente desnaturalizante de priones que es al menos un agente complejante de cobre (II) seleccionado del grupo que consiste en ácido etilenodiaminotetracético (EDTA), benzotriazol, toliltriazol, ácido trisódico metilglicinacético (Trilon M), ácido 6,6'6"-(1,3,5-triazina-2,4,6-triiltriimino)tris(hexanoico) (Irgacor L190), etanol-2,2'-[[metil-1Hbenzotriazol- 1-il]metil]imino]bis- (Irgamet 42), y bicarbonato/carbonato de didecildimetilamonio (CarboShield 1000), y al menos subtilisina.

PDF original: ES-2620454_T3.pdf

Uso de lipo-quitooligosacáridos para aumentar la fotosíntesis en plantas y procedimientos y composiciones correspondientes.

(22/02/2017). Solicitante/s: MCGILL UNIVERSITY. Inventor/es: SMITH, DONALD, L., PRITHIVIRAJ, BALAKRISHNAN, ZHOU,XIAOMIN, SOULEIMANOV,ALFRED.

Uso de una composición que comprende uno o más lipo-quitooligosacáridos para potenciar la tasa fotosintética de una planta.

PDF original: ES-2623765_T3.pdf

Uso de oligómeros de alginatos para combatir las biopelículas.

(22/02/2017). Solicitante/s: ALGIPHARMA AS. Inventor/es: MYRVOLD, ROLF, ONSOYEN, EDVAR.

Un método para combatir la biopelícula que no está en o sobre un cuerpo humano o animal no humano, comprendiendo dicho método poner en contacto dicha biopelícula con un oligómero de alginato, en donde el oligómero de alginato tiene al menos 70% residuos de G.

PDF original: ES-2625866_T3.pdf

1 · · 3 · 4 · 5 · 6 · ››