CIP 2015 : A61K 39/385 : Haptenos o antígenos, unidos a soportes.

CIP2015AA61A61KA61K 39/00A61K 39/385[1] › Haptenos o antígenos, unidos a soportes.

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

A61K 39/385 · Haptenos o antígenos, unidos a soportes.

CIP2015: Invenciones publicadas en esta sección.

DERIVADOS DE OLIGOSACÁRIDOS SINTÉTICOS COMO VACUNA CONTRA BORDETELLA PERTUSSIS.

(02/07/2020). Solicitante/s: INSTITUTO FINLAY DE VACUNAS. Inventor/es: GUO,LINA, VEREZ BENCOMO,Vicente Guillermo, GUANGWU,Chen, FERNÁNDEZ CASTILLO,Sonsire.

La presente invención proporciona fragmentos de oligosacáridos sintéticos provenientes del pentasacárido terminal del lipooligosacárido de Bordetella pertussis, un método para obtener los fragmentos de oligosacáridos sintéticos y los conjugados a partir de los mismos. También proporciona las composiciones vacunales que contienen tales glicoconjugados y que inducen una respuesta inmune capaz de reducir la colonización nasofaríngea de Bordetella pertussis.

Proteínas recombinantes y sus usos terapéuticos.

(27/05/2020). Solicitante/s: Bioven 3 Limited. Inventor/es: D\'Hondt,Erik, CHARLTON,Keith Alan.

Una proteína recombinante, que comprende: una secuencia polipeptídica inmunogénica que incluye la subunidad B de la toxina del cólera (CT-B) o la subunidad B LT termolábil (LT-B) de E. coli; un espaciador peptídico configurado para reducir el impedimento estérico y seleccionado entre el grupo que consiste en SSGGGSGG, SSGGGGSGGG, TSGGGSG, TSGGGGSGG, SSGGGSGGSSG, GGSGGTSGGGSG, SGGTSGGGGSGG, GGSGGTSGGGGSGG, SSGGGGSGGGSSG, SSGGGSGGSSGGG, SSGGGGSGGGSSGGG, y GGSGGTRPSTAATS; y una secuencia polipeptídica que comprende de Cys 6 a Cys 31 del factor de crecimiento epidérmico; en la que dicha secuencia polipeptídica está separada de dicha secuencia polipeptídica inmunogénica mediante dicho espaciador peptídico.

PDF original: ES-2812564_T3.pdf

Bacterias mutantes para la producción de módulos generalizados para antígenos de membrana.

(13/05/2020). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Inventor/es: NORAIS,Nathalie, ARICO,MARIA, ERCOLI,GIUSEPPE, SORIANI,MARCO, TANI,CHIARA.

Un procedimiento para preparar vesículas a partir de una bacteria gramnegativa en el que al menos una proteína que contiene un dominio catalítico LytM se inactiva comprendiendo una etapa de obtención de vesículas a partir de un cultivo de la bacteria, en el que: (a) la al menos una proteína que contiene un dominio catalítico de LytM se inactiva mediante una mutación de inactivación génica en la región codificante del gen o su promotor que: (i) reduce el nivel de ARNm que codifica la proteína al 0 % de aquel producido por la bacteria de tipo silvestre; o (ii) inhibe la traducción del ARNm que codifica la proteína al 0 % de aquel producido por la bacteria de tipo silvestre.

PDF original: ES-2808659_T3.pdf

Composición de medio para preparar toxina botulínica.

(06/05/2020). Solicitante/s: Daewoong Co., Ltd. Inventor/es: MIN,KYOUNG MIN, KIM,KYOUNG-YUN, SUL,HYE-YOUNG.

Una composición de medio libre de EET para su uso en el cultivo de Clostridium botulinum, la composición de medio comprende: peptonas de origen vegetal libres de encefalopatía espongiforme transmisible (EET) que comprenden un hidrolizado de guisante de jardín, un hidrolizado de semilla de algodón y un hidrolizado de gluten de trigo con una proporción de 1:0,24-43,62:0,01-50,57 en peso; un hidrolizado de caseína; una fuente de carbono; y al menos un mineral seleccionado del grupo que consiste en K2HPO4 (fosfato dipotásico), Na2HPO4 (fosfato disódico) y KH2PO4 (fosfato monopotásico).

PDF original: ES-2805726_T3.pdf

Proteínas de fusión y vacunas de combinación.

(26/02/2020). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS S.A.. Inventor/es: POOLMAN, JAN, BLAIS,NORMAND, LABBE,STEVE.

Una composición inmunogénica que comprende una proteína de fusión de fórmula I: (X)m-(R1)n-A-(Y)o-B-(Z)p (fórmula I) en la que X es un péptido señal o MHHHHHH (SEQ ID NO. 2); m es 0 o 1; R1 es un aminoácido; n es 0, 1, 2, 3, 4, 5 o 6; A es un fragmento inmunogénico de la Proteína E seleccionado de SEQ ID NO. 122, SEQ ID NO. 123, SEQ ID NO. 124, SEQ ID NO. 125, SEQ ID NO. 126, SEQ ID NO. 179 o SEQ ID NO. 180 o una secuencia que tiene al menos un 95 % de identidad de secuencia con una cualquiera de SEQ ID NO. 122, SEQ ID NO. 123, SEQ ID NO. 124, SEQ ID NO. 125, SEQ ID NO. 126, SEQ ID NO. 179 o SEQ ID NO. 180; Y es GG; o es 1; B es un fragmento inmunogénico de PilA, al menos un 95 % idéntico a los aminoácidos 40-149 de cualquiera de SEQ ID NO. 58 a SEQ ID NO. 121; Z es GGHHHHHH (SEQ ID NO. 3); y p es 0 o 1. y un excipiente farmacéuticamente aceptable.

PDF original: ES-2776369_T3.pdf

Glucoconjugado de oligosacárido procedente de LOS con la toxina tosferínica de Bordetella pertussis y su aplicación en la profilaxis y el tratamiento de infecciones causadas por Bordetella pertussis.

(04/11/2019). Solicitante/s: Siec Badawcza Lukasiewicz - PORT Polski Osrodek Rozwoju Technologii. Inventor/es: KOJ,SABINA, NIEDZIELA,TOMASZ, LUGOWSKI,CZESLAW.

Un método para preparar un glucoconjugado que comprende un oligosacárido (OS) procedente de LOS o su fragmento y la toxina tosferínica (PT) de B. pertussis en donde el método comprende: a. cultivar B. pertussis; b. aislar LOS de las bacterias y aislar un OS; c. aislar PT del medio de cultivo de B. pertussis; d. activar OS mediante oxidación o desaminación; e. conjugar el OS activado con la toxina tosferínica a pH = 9 mediante reacción de aminación reductora. f. purificar el glucoconjugado OS-PT obtenido, en donde un contenido del oligosacárido o fragmento del mismo en el glucoconjugado con la PT es del 30-50 %.

PDF original: ES-2729398_T3.pdf

Composiciones y métodos para mejorar la inmunogenicidad de los conjugados de polisacárido-proteína.

(23/10/2019). Solicitante/s: Kanvax Biopharmaceuticals Ltd. Inventor/es: LI,JIANPING.

Un conjugado de polisacárido-proteína que comprende una proteína transportadora quimérica y un antígeno polisacárido, en donde la proteína transportadora quimérica comprende una proteína transportadora y un epítopo universal, en donde el antígeno polisacárido se conjuga covalentemente con la proteína transportadora quimérica, y en donde la proteína transportadora quimérica comprende la secuencia de aminoácidos de una cualquiera seleccionada entre el grupo que consiste en SEQ ID NOs: 8-32, 39-44, y 51-56.

PDF original: ES-2760536_T3.pdf

Composición de vacuna que comprende polisacáridos capsulares naturales conjugados de N. Meningitidis.

(24/07/2019) Una composición inmunogénica que comprende polisacáridos capsulares de N. meningitidis de los serogrupos A, C, W135 e Y, en donde cada polisacárido capsular de N. meningitidis está conjugado con una proteína vehículo de toxoide tetánico (TT) para producir un conjugado de polisacárido capsular de N. meningitidis, en el que: - el polisacárido capsular MenA presente en el conjugado de sacárido capsular MenA tiene un tamaño promedio de más de 60 kDa y es polisacárido capsular MenA natural o microfluidizado; - el polisacárido capsular MenC presente en el conjugado de sacárido capsular MenC tiene un tamaño promedio de más de 150 kDa y es un polisacárido capsular MenC natural; - el polisacárido capsular MenW presente en…

Composición inmunogénica.

(12/06/2019). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS S.A.. Inventor/es: DENOEL, PHILIPPE, POOLMAN, JAN, CAPIAU, CARINE, DUVIVIER,Pierre, BIEMANS,Ralph L, BOUTRIAU,Dominique.

Una composición inmunogénica que no usa ningún adyuvante de sal de aluminio o no usa ningún adyuvante, comprendiendo la composición polisacáridos capsulares de N. meningitidis de al menos uno de los serogrupos A, C, W135 e Y conjugados con una proteína vehículo para producir un conjugado de polisacárido capsular de N. meningitidis, en el que el tamaño promedio de cada polisacárido de N. meningitidis es superior a 50 kDa, en el que cada polisacárido de N. meningitidis se conjuga con el vehículo de toxoide del tétano y es un polisacárido nativo o se dimensiona por microfluidización, en el que dicha composición comprende un polisacárido capsular MenC conjugado con toxoide del tétano y dicho polisacárido capsular MenC tiene un tamaño promedio de 150-210 kDa.

PDF original: ES-2741529_T3.pdf

Haptenos de paliperidona.

(05/06/2019). Solicitante/s: JANSSEN PHARMACEUTICA NV. Inventor/es: SANKARAN,BANUMATHI, HRYHORENKO,ERIC, DECORY,THOMAS R, VLIEGEN,MAARTEN, HASPESLAGH,PIETER RIK.

Los compuestos de Fórmula I**Fórmula** en donde L1 es OC(O)(CH2)n, o O(CH2)n; en donde n es 1, 2 o 3; L2 es NHC(O),**Fórmula** o está ausente; L3 es**Fórmula** en donde m es 0, 1, 2, o 3; siempre que m solo pueda ser 0 si L2 está ausente.

PDF original: ES-2739383_T3.pdf

Vacuna para prevenir la enfermedad de edema porcino.

(24/05/2019). Solicitante/s: KM Biologics Co., Ltd. Inventor/es: ARAKAWA, TAKESHI, YOKOGAWA,KENJI, WAKI,TAKASHI, HONDA,YOKO, UEFUJI,HIROTAKA, SEWAKI,TOMOMITSU, HARAKUNI,TETSUYA, MIYATA,TAKESHI.

Una proteína de fusión en la que están unidos un polipéptido que consiste en una unidad formadora de superhélice de la proteína oligomérica de la matriz de cartílago (COMP) y una subunidad B de la toxina Shiga Shx2e (Stx2eB).

PDF original: ES-2713962_T3.pdf

Formulaciones que estabilizan e inhiben la precipitación de composiciones inmunogénicas.

(16/05/2019). Solicitante/s: WYETH LLC. Inventor/es: CHEN,YING, LOOK,JEE,LOON, KHANDKE,LAKSHMI, HAN,HANYOUNG, JIN,ZHAOWEI, MALONE,RONALD, YANG,XUDONG, SEID,ROBERT CHANCERY JR.

Un medio de recipiente siliconado cargado con una formulación que inhibe la agregación inducida por silicona de un conjugado de polisacárido-proteína comprendido en un medio de recipiente siliconado, formulación que comprende (i) una solución salina con pH tamponado, en la que el tampón tiene un pKa de aproximadamente 3,5 a aproximadamente 7,5, (ii) una sal de aluminio y (iii) uno o más conjugados de polisacárido-proteína en la que el conjugado de polisacárido-proteína comprende uno o más polisacáridos de neumococos.

PDF original: ES-2712956_T3.pdf

Interruptores de células T con receptores de antígenos quiméricos y usos de los mismos.

(08/05/2019). Solicitante/s: THE SCRIPPS RESEARCH INSTITUTE. Inventor/es: SCHULTZ,PETER G, CAO,YU, KIM,CHANHYUK, YOUNG,TRAVIS, MA,JENNIFER, KIM,MINSOO, PINKERTON,STEPHANIE.

Interruptor para activar una célula efectora con receptor de antígeno quimérico (CAR-EC), comprendiendo el interruptor: a. un dominio de interacción con receptor de antígeno quimérico (CAR-ID) que interacciona con un receptor de antígeno quimérico en la CAR-EC; y b. un dominio de interacción con la diana (TID) que comprende un aminoácido no natural, en el que el TID interacciona con una molécula de superficie en una célula diana, y en el que el CAR-ID se une al TID por medio del aminoácido no natural.

PDF original: ES-2741308_T3.pdf

Vectores y construcciones de liberación de antígenos de virus de la gripe.

(08/05/2019). Solicitante/s: ALTIMMUNE UK LIMITED. Inventor/es: BONNET, DOMINIQUE, GEORGES,BERTRAND, BROWN,CARLTON B, SIZER,PHILIP J.

Una construcción de vector fluorocarbonado-antígeno de estructura CmFN--CyHx-(Sp)-R, donde m = 3 a 30, n <= 2m + 1, y = 0 a 15, x <= 2y, (m + y) = 3-30, Sp es un resto espaciador químico opcional y R es un péptido del virus de la gripe inmunogénico seleccionado de: DQVRESRNPGNAEIEDLIFLARSALILRGSVAHKS (SEQ ID NO: 32) DLEALMEWLKTRPILSPLTKGILGFVFTLTVPSER (SEQ ID NO: 35) VAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQG (SEQ ID NO: 4) YITRNQPEWFRNVLSIAPIMFSNKMARLGKGYMFE (SEQ ID NO: 17) APIMFSNKMARLGKGYMFESKRMKLRTQIPAEMLA (SEQ ID NO: 18) SPGMMMGMFNMLSTVLGVSILNLGQKKYTKTTY (SEQ ID NO: 19) KKKSYINKTGTFEFTSFFYRYGFVANFSMELPSFG (SEQ ID NO: 20) y homólogos de los mismos que tiene al menos 90 % de identidad con las SEQ ID NO: 32, 35, 4, 17, 18, 19 o 20.

PDF original: ES-2741729_T3.pdf

Método para preparar una mezcla de proteínas homodiméricas usando efecto de repulsión de carga.

(29/04/2019) Un método para obtener una mezcla que contiene dos o más proteínas usando un único clon celular recombinante, en donde las proteínas están en forma de un dímero que se forma por polimerización entre cadenas monoméricas, y las dos o más proteínas contienen el mismo dominio, en donde el método comprende la etapa de reemplazar parte de los restos de aminoácidos de las dos cadenas monoméricas en el mismo dominio de una o más proteínas con los restos de carga opuesta, de modo que las cadenas monoméricas de diferentes proteínas son desfavorables para formar un heterodímero debido a la interacción repulsiva entre cargas iguales, mientras que la cadena monomérica de la misma proteína es más favorable para formar un homodímero debido a la interacción atrayente entre cargas opuestas; en donde el mismo dominio se refiere a dominio CH3 de un anticuerpo…

Nanopartículas para inmunoterapia.

(16/04/2019). Solicitante/s: ECOLE POLYTECHNIQUE FEDERALE DE LAUSANNE (EPFL). Inventor/es: HUBBELL, JEFFREY, A., REDDY,SAI T, SWARTZ,MELODY A, VAN DER VLIES,ANDRE.

Una composición de nanopartículas que comprende: una colección aislada de partículas sintéticas que comprenden un antígeno y un polímero sintético que comprende polietilenglicol eficaz para activar la maduración de células dendríticas, en la que la colección tiene un diámetro medio de partícula de 20 nm a 70 nm.

PDF original: ES-2709391_T3.pdf

Partículas peptídicas conjugadas.

(10/04/2019). Solicitante/s: NORTHWESTERN UNIVERSITY. Inventor/es: SHEA,LONNIE D, MILLER,STEPHEN D, YAP,JONATHAN WOON TECK, GETTS,DANIEL R, MCCARTHY,DERRICK.

Una composición que comprende una partícula vehículo de poli(ácido láctico-co-glicólico) (PLGA) funcionalizada en la superficie con carboxilato con un potencial zeta negativo que comprende un antígeno encapsulado, en donde el potencial zeta de la partícula está entre -100 mV y 0 mV, y en donde la composición induce la tolerancia de dicho antígeno.

PDF original: ES-2738481_T3.pdf

Suministro multivalente de inmunomoduladores mediante ácidos nucleicos esféricos liposomales para aplicaciones profilácticas o terapéuticas.

(27/03/2019). Solicitante/s: Exicure, Inc. Inventor/es: GRYAZNOV,SERGEI, KANG,RICHARD, RADOVIC-MORENO,ALEKSANDAR FILIP, NALLAGATLA,SUBBARAO, MADER,CHRISTOPHER C.

Una nanoestructura, que comprende un nucleo liposomal que tiene una bicapa lipidica, en donde un inmunoestimulador o un inmunosupresor estan asociados a la bicapa lipidica, y los oligonucleotidos estan colocados en el exterior del nucleo liposomal, en donde los oligonucleotidos comprenden oligonucleotidos que contienen el motivo de CpG, en donde los oligonucleotidos estan unidos indirectamente al nucleo liposomal a traves de un enlazador, y en donde todos los oligonucleotidos tienen su extremo 5' expuesto a la superficie externa de la nanoestructura.

PDF original: ES-2725948_T3.pdf

Constructos de proteínas homodiméricas.

(27/03/2019). Solicitante/s: VACCIBODY AS. Inventor/es: BOGEN,BJARNE, FREDRIKSEN,AGNETE BRUNSVIK, RUFFINI,PIER ADELCHI.

Una proteína homodimérica de dos cadenas idénticas de aminoácidos, cada cadena de aminoácidos comprende una unidad de marcaje que comprende una secuencia de aminoácidos que tiene al menos un 98 % de identidad con la secuencia de aminoácidos 5-70 de SEQ ID NO:1, y una unidad antigénica. La unidad de marcaje y la unidad antigénica se conectan a través de un motivo de dimerización.

PDF original: ES-2706058_T3.pdf

Preparación de una vacuna que contiene anticuerpos trifuncionales con propiedades potenciadoras de la inmunogenicidad del antígeno.

(12/03/2019) Una composición farmacéutica que comprende: • una cantidad farmacéuticamente efectiva de un anticuerpo biespecífico y/o triespecífico trifuncional que tiene las siguientes propiedades: (a) unión a una célula T a través de CD3 y activación de dicha célula T; (b) unión a un antígeno diana aislado que está separado de su contexto natural, por ejemplo, una célula, un virus, una bacteria, un protozoo, o un hongo y que no está asociado o es parte de dicho contexto natural; (c) unión a través de su porción Fc o por una tercera especificidad (en el caso de los anticuerpos triespecíficos) a células positivas para receptores Fc-γ de tipo I,…

Formulaciones de anticuerpos anti-RSV líquidas estabilizadas.

(06/03/2019). Solicitante/s: MEDIMMUNE, LLC. Inventor/es: CHANG,STEPHEN, SHANE,ERICA, ISSAACS,BENJAMIN,S, ALLAN,CHRISTIAN,B, OLIVER,CYNTHIA N.

Una formulación de palivizumab acuosa estable, que comprende, (a) en agua, 103 ± 3 mg/ml de palivizumab, histidina 25 mM y glicina 1,6 mM, donde la formulación tiene un pH de 6,0 y la formulación es estable de 2 °C a 8 °C durante 15 meses según se determina mediante cromatografía de exclusión por tamaño de alto rendimiento (HPSEC). (b) en un portador acuoso, al menos 75 mg/ml de palivizumab o un fragmento de unión al antígeno del mismo, histidina de 20 mM a 30 mM y glicina inferior a 3 mM, donde la formulación es estable de 38 °C a 42 °C durante al menos 60 días según se determina mediante HPSEC.

PDF original: ES-2702968_T3.pdf

Proteínas de tipo superhélice modificadas que presentan unas propiedades mejoradas.

(16/01/2019). Solicitante/s: Osivax SAS. Inventor/es: HILL,FERGAL, DEL CAMPO ASCARATEIL,JUDITH, TURKI HANI,IMENE.

Proteína modificada que comprende: (i) una proteína que presenta un dominio de superhélice y por lo menos un péptido cargado positivamente unido directamente al dominio de superhélice, en la que dicha proteína modificada es como se expone en la SEC ID nº 42 (IMX313P) o en la SEC ID nº 7 (IMX313T) o (ii) una proteína que presenta un dominio de superhélice trimérica unido directamente a un péptido de secuencia SEC ID nº 37 (SPRRRRRRRRRS).

PDF original: ES-2719256_T3.pdf

Sistema para la liberación en una célula XCR1 positiva y usos del mismo.

(03/10/2018) Uso de un sistema de liberación para administrar una sustancia en una célula presentadora de antígenos profesional XCR1 positiva in vitro, comprendiendo el sistema de liberación i) una molécula que se une al receptor de quimiocina (motivo C) 1 (XCR1), en la que la molécula i) es un anticuerpo anti-XCR1 o un fragmento del mismo o es un ligando de quimiocina (motivo C) 1 (XCL1) o una variante funcionalmente activa del mismo, y ii) una sustancia que se va a liberar, siendo la sustancia un inmunogén, en el que sustancia se une a la molécula covalentemente y en el que la variante funcionalmente activa de XCL1 - se diferencia de XCL1 de cualquiera…

Bioconjugados preparados a partir de proteínas N-glicosiladas recombinantes procedentes de células procariotas.

(01/10/2018) Un método para producir un bioconjugado de Shigella que comprende producir, aislar y purificar una proteína N-glicosilada recombinante, que comprende las etapas de: a) proporcionar una bacteria gram-negativa recombinante que comprende ácidos nucleicos que codifican i) un operón pgl funcional procedente de Campylobacter spp., preferiblemente de C. jejuni, y ii) al menos una proteína diana recombinante, la exotoxina de Pseudomonas aeruginosa (EPA), que com-prende una o varias de las siguientes secuencias de consenso de aminoácidos N-glicosiladas optimiza-das: D/E - X - N - Z - S/T, en donde X y Z pueden ser cualquier aminoácido natural excepto Pro, y en donde se introduce al menos 10 una de dicha o dichas secuencias de consenso de aminoácidos N-glicosiladas optimizadas, y (iii) la síntesis del polisacárido…

Péptido que contiene múltiples sequones de glicosilación ligada a N.

(01/10/2018). Solicitante/s: THE GOVERNORS OF THE UNIVERSITY OF ALBERTA. Inventor/es: SZYMANSKI,CHRISTINE, NOTHAFT,HARALD.

Un péptido que comprende por lo menos dos repeticiones, preferiblemente nueve repeticiones, de la secuencia de aminoácidos como se establece en la SEQ ID NO: 1, en el que las repeticiones de la secuencia de aminoácidos como se establece en la SEQ ID 5 NO: 1 son contiguas o separadas por no más de 6 aminoácidos, en el que el péptido se glicosila en por lo menos una de las repeticiones de la secuencia de aminoácidos como se establece en la SEQ ID NO: 1.

PDF original: ES-2684087_T3.pdf

Péptidos antiandrógenos y sus usos en la terapia del cáncer.

(25/04/2018). Solicitante/s: CANCER RESEARCH TECHNOLOGY LIMITED. Inventor/es: AURICCHIO,FERDINANDO, MIGLIACCIO,ANTIMO.

Una molécula derivada de péptido aislada o purificada o parcialmente purificada que presenta la fórmula general: X- [(Pro)n-His-Pro-His-Ala-Arg-Ile-Lys]m- Y (S1) en la que X es H, o un grupo acetilo o cualquier aminoácido natural o secuencia de aminoácidos provista con un grupo NH2 libre o al menos derivado de acetilo; Y es un grupo OH o un grupo NH2; "n" es un número entero de 1 a 10 y "m" es un número entero de 1 a 3; y en la que la secuencia de aminoácidos de la molécula derivada de péptido se selecciona del grupo que consiste en: Pro-Pro-Pro-His-Pro-His-Ala-Arg-Ile-Lys (SEQ. ID NO. 1); Pro-Pro-Pro-Pro-Pro-His-Pro-His-Ala-Arg-Ile-Lys (SEQ. ID NO. 2); Pro-Pro-Pro-Pro-Pro-Pro-Pro-His-Pro-His-Ala-Arg-Ile-Lys (SEQ. ID NO. 3); y Gly-Pro-Pro-Pro-Pro-Pro-Pro-Pro-Pro-His-Pro-His-Ala-Arg-Ile-Lys (SEQ. ID NO. 4).

PDF original: ES-2677566_T3.pdf

Ensayo para entactógenos.

(18/04/2018) Un compuesto de la fórmula: **(Ver fórmula)** en la que: R1 es H, alquilo inferior o un grupo protector, en el que el término alquilo inferior representa un radical hidrocarburo monovalente saturado ramificado o no ramificado que contiene de 1 a 10 átomos de carbono, y en el que el grupo protector es t-butoxicarbonilo (t-Boc), fluorenilmetiloxicarbonilo (Fmoc), acetaminometilo (Acm), trifenil metilo (Trt), benciloxicarbonilo, bifenilisopropiloxicarbonilo, 1-amiloxicarbonilo, isoborniloxicarbonilo, alfa-dimetil-3,5- dimetoxibenciloxicarbonilo, o-nitrofenil-sulfenilo, 2-ciano-1,1-dimetil-etoxicarbonilo bromobenciloxi, carbamoilo o formilo R2 es -(CH2)nC(O)R6 o -(CH2)nR6, R3 y R4 son independientemente H o alquilo inferior o un grupo protector, en el que el término alquilo inferior representa…

Conjugados de sacáridos no lineales.

(04/04/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Inventor/es: COSTANTINO, PAOLO, DEL GIUDICE, GIUSEPPE, BERTI,Francesco, BROGIONI,GIULIA, ROMANO,MARIA.

Una composición que comprende un conjugado de sacárido no lineal que comprende un sacárido seleccionado de un polisacárido y un oligosacárido, en la que el sacárido está enlazado a al menos dos péptidos vehículo, en la que: los al menos dos péptidos vehículo comprenden al menos un epítopo de linfocito T y no tienen epítopos conformacionales de linfocitos B, al menos uno de los al menos dos péptidos está enlazado internamente al sacárido y al menos uno de los al menos dos péptidos comprende un epítopo de linfocito T PV1 (péptido derivado de la proteína VP1 del virus de la polio tipo 1).

PDF original: ES-2672996_T3.pdf

Disolución de polisacáridos capsulares y vacunas de combinación.

(21/03/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Inventor/es: COSTANTINO, PAOLO.

Un procedimiento de purificación y conjugación de un polisacárido capsular bacteriano a una proteína vehículo, que comprende: purificar el polisacárido, que comprende las etapas de (a) precipitación del polisacárido utilizando uno o más detergentes catiónicos, seguida de (b) disolución del polisacárido precipitado utilizando etanol a una concentración final de entre el 75 % y el 95 %, conjugación del polisacárido a una proteína vehículo, en el que la proteína vehículo es una toxina o toxoide bacteriano, y en el que el sacárido conjugado tiene una relación de sacárido:proteína (p/p) entre 0,5:1 y 5:1, en el que el polisacárido capsular bacteriano es del grupo serológico A, W135 o Y de Neisseria meningitidis, o de Haemophilus influenzae, o de Streptococcus pneumoniae, y en el que el uno o más detergentes catiónicos comprenden bromuro de cetiltrimetilamonio.

PDF original: ES-2670196_T3.pdf

Disolución de polisacáridos capsulares y vacunas de combinación.

(21/03/2018) Un procedimiento de purificación y conjugación de un polisacárido capsular bacteriano a una proteína vehículo, que comprende: purificar el polisacárido, que comprende las etapas de (a) precipitación del polisacárido utilizando uno más detergentes catiónicos, seguida de (b) disolución del polisacárido precipitado utilizando un alcohol, (c) tratamiento del polisacárido obtenido en la etapa (b) para retirar los contaminantes utilizando una o más etapas de filtración, después, (d) precipitación del polisacárido obtenido en la etapa (c) mediante intercambio de cationes, y conjugación del polisacárido a una proteína vehículo, en la que la proteína vehículo es una toxina o toxoide bacteriano, y en la que la conjugación…

Purificación de polisacáridos capsulares bacterianos.

(31/01/2018) Un procedimiento de purificación de un polisacárido capsular bacteriano, que comprende las etapas de (a) precipitación del polisacárido, (b) solubilización del polisacárido precipitado utilizando un alcohol, (c) tratamiento del polisacárido obtenido en la etapa (b) para eliminar contaminantes utilizando una o más etapas de filtración o ultrafiltración por tamaño, después, (d) precipitación del polisacárido obtenido en la etapa (c) mediante cationes de intercambio, en el que la etapa (a) utiliza uno o más detergentes catiónicos que tienen la siguiente fórmula general:**Fórmula** en la que: R1, R2 y R3 son iguales o diferentes y cada uno significa alquilo o arilo; o R1 y R2 junto con el átomo de nitrógeno al que estos están unidos forman un anillo heterocíclico saturado de 5 o 6 miembros, y R3 significa alquilo o arilo; o R1, R2 y R3 junto…

Composición farmacéutica y vacuna contra infecciones estafilocócicas.

(10/01/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS S.A.. Inventor/es: DENOEL, PHILIPPE, POOLMAN, JAN, MAIRA LITRAN,TOMAS, BIEMANS,RALPH,LEON, DUVIVIER,Pierre.

Una composición inmunogénica que comprende PNAG de estafilococos que está N-acetilada en menos del 40 % en la que la PNAG está conjugada con una proteína portadora mediante un enlazador unido a un grupo amina en la PNAG para formar un conjugado de PNAG en la que el conjugado de PNAG tiene la estructura **(Ver fórmula)** en la que R1 es alquilo C1-C6 y R2 es alquilo C2-C6.

PDF original: ES-2659925_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .