Proteínas de fusión de inmunoglobulina.

Un polipéptido representado por la siguiente fórmula

N'-(Z1)p-Y-Z2-Z3-Z4-C'

en la que:



N' es el extremo N y C' es el extremo C del polipéptido.

Z1 es una secuencia de aminoácidos que consta de 5 a 9 restos de aminoácidos consecutivos procedentes del ladodel extremo C de los restos de aminoácidos en las posiciones 90 a 98 de la SEQ ID NO: 14;

Y es una secuencia de aminoácidos que consta de 5 o más restos de aminoácidos consecutivos procedentes dellado del extremo C de los restos de aminoácidos en las posiciones 99 a 162 de la SEQ ID NO: 14;

Z2 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 163 a 170 de laSEQ ID NO: 14;

20 Z3 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 121 a 220 de laSEQ ID NO: 13;

Z4 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 221 a 327 de laSEQ ID NO: 13; y

p es un número entero de 0 o 1.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/KR2008/003060.

Solicitante: POSTECH ACADEMY-INDUSTRY FOUNDATION.

Inventor/es: SUNG, YOUNG CHUL, YANG,SEHWAN.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K38/16 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00). › Péptidos que tienen más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.
  • C07K16/42 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 16/00 Inmunoglobulinas, p. ej. anticuerpos mono o policlonales. › contra inmunoglobulinas (anticuerpos anti-idiotípicos).
  • C07K19/00 C07K […] › Péptidos híbridos (Inmoglobulinas híbridas compuestas   solamente de inmoglobulinas C07K 16/46).

PDF original: ES-2415604_T3.pdf

 


Fragmento de la descripción:

Proteínas de fusión de inmunoglobulina

Campo técnico [0001] La presente invención se refiere a una proteína Fc híbrida humana y a una proteína de fusión de inmunoglobulina en la que la proteína Fc híbrida humana se une a una molécula biológicamente activa. En particular, se refiere a una proteína Fc híbrida humana, que se deriva de combinaciones de subtipos de la inmunoglobulina G humana (IgG) o combinaciones de la IgD y la IgG humanas, y una proteína de fusión en la que dicha proteína Fc está acoplada a una molécula biológicamente activa mediante un enlace covalente.

Antecedentes de la técnica [0002] Las moléculas biológicamente activas pueden ser de gran interés terapéutico. Sin embargo, tienen muchas desventajas como agente terapéutico porque su estabilidad in vivo es baja. Su vida media en circulación o vida media en suero es corta debido a que se digieren por diversos enzimas en el cuerpo vivo. Por tanto se ha deseado mejorar la vida media en circulación de las moléculas biológicamente activas.

Se sabe que aumentando el tamaño de una proteína puede aumentar su vida media, ya que se evita que el riñón elimine la proteína (Knauf y col., J. Biol. Chem. 1988. 263: 15064-15070) . Por ejemplo, se ha notificado un aumento de la estabilidad de la proteína mediante el acoplamiento de una proteína activa con la albúmina humana (Kinstler y col., Pharm. Res. 1995. 12: 1883-1888) . Sin embargo, como el acoplamiento de una proteína activa con la albúmina humana aumenta solo ligeramente su tiempo de residencia, no ha sido un procedimiento eficaz para desarrollar una formulación farmacéutica eficaz que contenga la proteína activa que se acopla a la albúmina humana.

El otro procedimiento notificado es modular la glicosilación de una proteína. La glicosilación adicional en la proteína y la introducción de ácidos siálicos en las proteínas conduce a la prevención de la degradación de las proteínas en el hígado. Sin embargo, el aumento en la glicosilación de las proteínas conduce también a una disminución de la bioactividad de las proteínas.

Para estabilizar las proteínas y evitar la depuración renal, las proteínas se han conjugado con polietilenglicol. Se ha utilizado ampliamente la conjugación covalente con el PEG para administrar un fármaco de una vida media prolongada (Delgado y col., 1991. 9. 249-304. Sin embargo, se ha notificado que la conjugación de PEG con citocinas u hormonas da como resultado una afinidad de unión reducida del receptor debido al impedimento estérico producido por la conjugación.

Recientemente, se han investigado y desarrollado proteínas de fusión preparadas utilizando una inmunoglobulina (Ig) . La Ig es un componente principal de la sangre. La Ig humana (hIg) incluye diversos tipos tales como IgG, IgM, IgA, IgD, e IgE (Roitt y col., “Immunology” 1989, Gower Medical Publishing, Londres, Reino Unido; Nueva York, N. Y.) . las IgG humanas se pueden clasificar adicionalmente en diversos subtipos conocidos como IgG1 humana (hIgG1) , IgG2 humana (hIgG2) , IgG3 humana (hIgG3) , e IgG4 humana (hIgG4) .

Las inmunoglobulinas están constituidas por cuatro cadenas de polipéptidos, dos cadenas pesadas y dos cadenas ligeras, que están asociadas mediante enlaces disulfuro para formar tetrámeros. Cada cadena está compuesta por una región variable y una región constante. La región constante de la cadena pesada se divide además en tres o cuatro regiones (CH1, CH2, CH3, y CH4) , dependiendo de los isotipos. La porción Fc de la región constante de la cadena pesada, dependiendo del isotipo de Ig, incluye la región bisagra, los dominios CH2, CH3, y/o

CH4.

Con respecto a la vida media en suero, la IgG1, IgG2, e IgG4 tienen vidas medias largas de 21 días, mientras que otras inmunoglobulinas tienen vidas medias relativamente cortas, de menos de una semana. Las proteínas quiméricas fusionadas con una porción de Fc de la IgG muestran un aumento de la estabilidad y un 55 aumento de la vida media en suero (Capon y col., Nature 1989. 337: 525-531) . Las proteínas biológicamente activas se han fusionado en el extremo N de la región CH1, el extremo N de la región Fc, o en extremo C de la región CH3 de las IgG.

En el periodo inicial, se han creado las proteínas de fusión de la IgG con los dominios extracelulares de receptores superficiales celulares tales como CD4 (Capon y col., Nature 1989. 337: 525-531) , TNFR (Mohler y col.,

J. Immunology 1993. 151: 1548-1561) , CTLA4 (Linsley y col., J. Exp. Med. 1991. 173: 721-730) , CD86 (Morton y col., J. Immunology 1996. 156: 1047-1054) . También, existen algunas citocinas y hormonas de crecimiento que se han fusionado con los dominios de la IgG. Sin embargo, a diferencia de la fusión con los dominios extracelulares de los receptores superficiales celulares, la fusión con proteínas solubles con las IgG conduce a actividades biológicas reducidas, en comparación con las citocinas no fusionadas o los factores de crecimiento. Las proteínas quiméricas existen como dímeros, lo que conduce al impedimento estérico procedente de la interacción con sus receptores del tipo moléculas diana, debido a la presencia de dos proteínas activas en estrecha proximidad entre sí. Por tanto, debe superarse este problema para preparar una proteína de fusión eficaz.

La otra limitación de la tecnología de fusión de Fc es la presencia de respuestas inmunes indeseables. El dominio Fc de la inmunoglobulina tiene también funciones efectoras tales como la citotoxicidad mediada por célula dependiente de anticuerpo (ADCC) o la citotoxicidad dependiente del complemento (CDC) . Estas funciones efectoras se consiguen generalmente mediante la interacción entre la región Fc de la Ig y las FcR en las células efectoras o mediante la unión del complemento. Por tanto, debe llevarse a cabo el bloqueo de las funciones efectoras de la Fc para reducir las reacciones indeseables tales como la muerte celular, la liberación de citocinas, o la inflamación.

Divulgación de la invención Problema técnico [0011] En resumen, se necesitan proteínas de fusión de Fc mejoradas con una mínima pérdida de actividad biológica y con un riesgo disminuido de respuestas inmunes indeseadas.

Solución técnica [0012] La presente invención proporciona una proteína Fc híbrida, que se deriva de combinaciones de subtipos de la IgG humana o combinaciones de la IgD e IgG humanas. La región Fc híbrida es eficaz, cuando se une a una molécula biológicamente activa, para aumentar la vida media en suero de la molécula biológicamente activa así como para aumentar el nivel de expresión del polipéptido cuando se expresa un polipéptido que codifica una proteína de fusión del polipéptido Fc.

La presente invención proporciona también un polipéptido de fusión Fc híbrido en el que el Fc híbrido se une a una molécula biológicamente activa. La proteína de fusión se denomina algunas veces proteína de fusión de Fc-molécula activa o simplemente “proteína de fusión”. La proteína de fusión puede tener un enlazador entre la FC y la molécula biológicamente activa. La Fc puede estar acoplada en su extremo N con un extremo C de la molécula biológicamente activa.

La proteína de fusión puede producirse fabricando una construcción de nucleótidos que codifica y es capaz de expresar la proteína de fusión; expresándola en una célula hospedadora; y cosechar la proteína de fusión. De forma alternativa puede producirse expresando un nucleótido que codifica la Fc y acoplando esta a una molécula biológicamente activa de una manera convencional.

De acuerdo con esto, en un aspecto, la presente invención proporciona un polipéptido representado por la siguiente fórmula:

N’- (Z1) p-Y-Z2-Z3-Z4-C’

en la que:

N’ es el extremo N y C’ es el extremo C del polipéptido.

Z1 es una secuencia de aminoácidos que consta de 5 a 9 restos de aminoácidos consecutivos procedentes 55 del lado del extremo C de los restos de aminoácidos en las posiciones 90 a 98 de la SEQ ID NO: 14; Y es una secuencia de aminoácidos que consta de 5 o más restos de aminoácidos consecutivos procedentes del lado del extremo C de los restos de aminoácidos en las posiciones 99 a 162 de la SEQ ID NO: 14;

Z2 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 163 a 170 de la SEQ ID NO: 14;

Z3 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 121 a 220 de la SEQ ID NO: 13;

Z4 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 221 a 327 de la SEQ ID NO: 13; y p es un número entero... [Seguir leyendo]

 


Reivindicaciones:

1. Un polipéptido representado por la siguiente fórmula

N’- (Z1) p-Y-Z2-Z3-Z4-C’

en la que:

N’ es el extremo N y C’ es el extremo C del polipéptido.

Z1 es una secuencia de aminoácidos que consta de 5 a 9 restos de aminoácidos consecutivos procedentes del lado del extremo C de los restos de aminoácidos en las posiciones 90 a 98 de la SEQ ID NO: 14;

Y es una secuencia de aminoácidos que consta de 5 o más restos de aminoácidos consecutivos procedentes del lado del extremo C de los restos de aminoácidos en las posiciones 99 a 162 de la SEQ ID NO: 14;

Z2 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 163 a 170 de la SEQ ID NO: 14;

Z3 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 121 a 220 de la SEQ ID NO: 13;

Z4 es una secuencia de aminoácidos que consta de los restos de aminoácidos en las posiciones 221 a 327 de la SEQ ID NO: 13; y

p es un número entero de 0 o 1.

2. El polipéptido de la reivindicación 1, en el que p es 0.

3. El polipéptido de la reivindicación 1, en el que el polipéptido tiene una secuencia de aminoácidos tal como se muestra en la SEQ ID NO: 18, 19, 20, 21, 22, 23, 28 o 29.

4. Un polipéptido quimérico que es una fusión que comprende un polipéptido de una cualquiera de las reivindicaciones 1 a 3 y un polipéptido, proteína o péptido fusionado en el extremo N o el extremo C del polipéptido.

5. El polipéptido quimérico de la reivindicación 4, en el que la fusión del polipéptido, proteína o péptido tiene una vida media en circulación aumentada en comparación con la vida media en circulación de la forma natural.

6. El polipéptido quimérico de la reivindicación 4 o la reivindicación 5, en el que el polipéptido, proteína o péptido es una hormona, citocina, factor de crecimiento, molécula coestimuladora, receptor de hormona, receptor de citocina, receptor de factor de crecimiento, o péptido corto.

7. El polipéptido quimérico de una cualquiera de la reivindicación 4 a 6, en el que el polipéptido, proteína

o péptido es EPO, G-CSF, GM-CSF, insulina, hormona del crecimiento humano, GLP-1, p40, receptor de TNF , IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, proteína 1 morfogenética ósea, betacelulina, interferón alfa, IL-10, FSH, Factor VII, CTLA4, IFN-beta, PD-1, IL-10R, CXCL-11, receptor de TGF-beta , TGF-beta, IL-17, IL- 17R, BTC, OPG o RANK,

o una de sus variantes.

8. El polipéptido quimérico de una cualquiera de las reivindicaciones 4 a 7, en el que el polipéptido, proteína o péptido es una variante de p40 que contiene la sustitución Asn303Gln.

9. El polipéptido quimérico de una cualquiera de las reivindicaciones 4 a 8, en el que el polipéptido, proteína o péptido es una proteína secretada, una forma madura de una proteína secretada, o una región Fab de un anticuerpo.

10. El polipéptido quimérico de una cualquiera de las reivindicaciones 4 a 9, en el que el polipéptido, proteína o péptido se acoplan entre sí mediante un enlazador.

11. El polipéptido quimérico de la reivindicación 10, en el que el enlazador es un enlazador de albúmina o

un enlazador sintético.

12. El polipéptido quimérico de la reivindicación 11, en el que:

(a) dicho enlazador de albúmina comprende las secuencias 321 a 323, 318 a 325, 316 a 328, 313 a 330, 311 a 333, o 306 a 338 de la SEQ ID NO: 25; o (b) dicho enlazador sintético es un péptido de 10 a 20 restos de aminoácidos, en el que el péptido está compuesto por restos de Gly y Ser. 10

13. Una molécula de ácido nucleico que codifica un polipéptido de una cualquiera de las reivindicaciones anteriores.

14. Un vector de expresión que comprende la molécula de ácido nucleico de acuerdo con la reivindicación 15 13.

15. Un procedimiento para producir el polipéptido de acuerdo con una cualquiera de las reivindicaciones 1 a 12, en el que el procedimiento comprende las etapas de. (i) introducir una molécula de ácido nucleico de la reivindicación 13 en una célula hospedadora de mamífero, (ii) hacer crecer la célula en condiciones en las que se pueda expresar el polipéptido en su medio de crecimiento, y (iii) cosechar el polipéptido expresado.

16. Un polipéptido quimérico de una cualquiera de las reivindicaciones 7 a 12 para uso en un procedimiento de tratamiento médico.


 

Patentes similares o relacionadas:

Generación de complejos polipeptídicos multifuncionales y multivalentes mediante el dominio de trimerización del colágeno XVIII, del 22 de Febrero de 2019, de Leadartis, S.L: Un complejo polipeptídico trimérico que comprende tres polipéptidos monómeros, en donde (i) cada uno de dichos polipéptidos monómeros comprende un elemento estructural […]

Proteínas multifuncionales que comprenden MHC de clase I multivalente unida por disulfuro, del 20 de Febrero de 2019, de F. HOFFMANN-LA ROCHE AG: Una proteína multifuncional multivalente unida por disulfuro, caracterizada por que comprende - uno o dos dominios presentadores de antígeno, […]

Métodos y composiciones para la proteína IL-10 de citomegalovirus, del 6 de Febrero de 2019, de UAB RESEARCH FOUNDATION: Una proteína IL-10 de citomegalovirus seleccionada de: (i) una proteína IL-10 de citomegalovirus como se representa en la SEQ ID NO:3, o que consiste […]

Transportador de vacuna, del 5 de Febrero de 2019, de BIOMAY AG: Una molécula hipoalergénica derivada de PhI p 5 y que consiste en la secuencia de aminoácidos GAASNKAFAEGLSGEPKGAAESSSKAALTSK, ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGK o TVATAPEVKYTVFETALKKAITAMSEAQKAAK.

Antígenos recombinantes del VSR, del 23 de Enero de 2019, de ID BIOMEDICAL CORPORATION OF QUEBEC: Un antígeno del virus sincitial respiratorio recombinante (VSR) que se ensambla en un trímero, que comprende un polipéptido de la proteína F soluble que comprende […]

Péptidos derivados de ERK y usos de los mismos, del 16 de Enero de 2019, de YEDA RESEARCH AND DEVELOPMENT CO. LTD.: Un péptido aislado que no tiene más de 20 aminoácidos de longitud que comprende una secuencia tal como se recoge en SEQ ID NO: 4, en donde X1 y X2 son cualquier aminoácido, […]

Receptores de antígenos quiméricos anti-variante III de receptor de factor de crecimiento epidérmico y uso de los mismos para el tratamiento de cáncer, del 11 de Enero de 2019, de The United States Of America, As Represented By The Secretary, Department Of Health And Human Services (100.0%): Receptor de antígeno quimérico (CAR) que comprende un dominio de unión a antígeno contra la variante III de receptor de factor de crecimiento epidérmico, un dominio […]

Grupos dirigidos al receptor del complemento 2 (cr2) mejorados, del 9 de Enero de 2019, de The Regents of the University of Colorado, a body corporate: Una composición soluble capaz de la administración dirigida de un modulador del complemento a sitios de activación del sistema del complemento que comprenden una construcción, […]

Otras patentes de la CIP C07K19/00