Polipéptido de fusión serpina-dedo.

Polipéptido de fusión que comprende en dirección N-terminal hacia C-terminal el polipéptido serpina-dedo SEAAASTAVVIA

(SEQ ID Nº: 07) o SEAAASMFLEAI (SEQ ID Nº: 11) fusionado con una inmunoglobulina u hormona o citocina o factor de crecimiento o ligando de receptores o agonista o antagonista o agente citotóxico o agente antivírico o agente de contraste o inhibidor de enzimas o activador de enzimas o modulador de la actividad enzimática, con un polipéptido conector de péptidos intercalado.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2011/065884.

Solicitante: F. HOFFMANN-LA ROCHE AG.

Nacionalidad solicitante: Suiza.

Dirección: GRENZACHERSTRASSE, 124 4070 BASEL SUIZA.

Inventor/es: KOPETZKI, ERHARD, ENGH,RICHARD, SCHLOTHAUER,Tilman.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Técnicas de mutación o de ingeniería genética;... > C12N15/62 (Secuencias de ADN que codifican proteínas de fusión)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/16 (VIH-1)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/81 (Inhibidores de proteasa)

PDF original: ES-2535704_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Polipéptido de fusión serpina-dedo.

La presente invención se refiere a polipéptidos de fusión formados por un polipéptido serpina-dedo y un segundo péptido, polipéptido o proteína, así como al uso de estos polipéptidos de fusión

Antecedentes de la presente invención

Los inhibidores de serina proteasas (serpinas) regulan múltiples vías fisiológicas, p.ej. de inflamación, coagulación, fibrinólisis, apoptosis y remodelación de la matriz extracelular. La serina proteasa parte el bucle reactivo de una serpina y la serina proteasa es inactivada por interrupción del sitio catalítico.

La alfa 1 -antitripsina es una glicoproteína de 52 kDa que está constituida por 394 aminoácidos y es sintetizada por hepatocitos, macrófagos y células epiteliales bronquiales. Las estructuras de los cristales muestran que la alfa 1- antitripsina consta de cinco láminas beta, nueve hélices alfa y un bucle reactivo desprotegido que comprende 14 restos y presenta una secuencia peptídica en forma de pseudosubstrato de la proteasa diana. La división del enlace reactivo escindióle, indicada como P1-P1, produce un cambio conformacional irreversible según el cual el resto N- terminal del bucle queda totalmente incorporado en medio de las láminas beta de alfa 1-antitripsina como hebra 4a (Schechter, I. y Berger, A., Biochem. Biophys. Res. Commun. 27 (1967) 157-162; Loebermann, H. y otros, J. Mol. Biol. 177 (1984) 531-557; Baumann, U. y otros, J. Mol. Biol. 218 (1991) 595-66; Baumann, U. y otros, J. Mol. Biol. 226 (1992) 127-1218; Mourey, L. y otros, Biochim. 72 (199) 599-68; Mourey, L. y otros, J. Mol. Biol. 232 (1993) 223-241).

Tras la división proteolítica por su proteasa diana se separa P1 Met y P1 Ser y el bucle inactivo del sitio reactivo se inserta como hebra 4a en la lámina beta antiparalela A. Un péptido con la secuencia de aminoácidos de la hebra 4a, restos 345-358 de alfa 1-antitripsina humana Thr-Glu-Ala-Ala-Gly-Ala-Met-Phe-Leu-Glu-Ala-lle-Val-Met, se junta con alfa 1-antitripsina intacta y forma un complejo estequ¡ométrico con propiedades similares a la alfa 1-antitripsina dividida (Schulze, A.J. y otros, Eur. J. Biochem. 194 (199) 51-56).

En la patente WO 97/24453 se presentan polipéptidos quiméricos de superficie viral, específicos del receptor, para la incorporación e internalización de virus y partículas en células diana. En la patente EP 147 761 se presenta un complejo de enlace covalente del inhibidor de proteasa alfa 1-antitripsina con un polímero soluble en agua. En la patente US 26/4867 se presentan inhibidores de la actividad de serina proteasa y su empleo en métodos y composiciones para el tratamiento de infecciones bacterianas.

Schulze, A.J. y otros reseñan la transición estructural de la alfa 1-antitripsina mediante un péptido de secuencia similar a la hebra S4A (Eur. J. Biochem. 194 (199) 51-56). En Anti-infective agents in medicinal chemistry [Agentes antiinfecciosos en química médica], Bentham Science publishers, Hilversum (NL), 7 (28) 126-133, Congote, L.F. presenta agentes anti-VIH multifuncionales basados en secuencias de aminoácidos existentes en péptidos C- terminales de serpina. Qi, Z. y otros (J. Biol. Chem. 283 (28) 3376-3384) revelan péptidos anti-VIH diseñados racionalmente, que contienen dominios multifuncionales como sondas moleculares para el estudio del mecanismo de acción de la primera y segunda generaciones de inhibidores de fusión de VIH. En la patente WO 1/51673 se informa de métodos y composiciones para la inhibición de incidencias relacionadas con la fusión de membrana, incluyendo la transmisión de VIH. En la patente WO 2/6317 se revelan quimeras de fijación de integrinas. En la patente EP 355 95 se revelan fragmentos y fracciones de heparina con acción anti-VIH. En las patentes WO /5234 y US 6,849,65 se presentan inhibidores de la actividad de serina proteasa y métodos y composiciones para el tratamiento de infecciones víricas.

Resumen de la presente invención

Se ha encontrado que un polipéptido serpina-dedo debe tener un mínimo número de restos de aminoácidos para permitir una asociación suficientemente rápida con una serpina. Además se ha comprobado que es ventajoso que el resto de aminoácido en posición 2 de los aminoácidos del polipéptido serpina-dedo (contando a partir del N terminal del polipéptido serpina-dedo) sea de ácido glutámico.

Aquí se presenta un polipéptido de fusión serpina-dedo que comprende

- un polipéptido serpina-dedo y

- otro polipéptido,

de manera que el polipéptido adicional puede ser cualquier polipéptido que ejerza una acción biológica tal como inhibición, activación, fijación o mareaje.

En una forma de ejecución el polipéptido de fusión serpina-dedo comprende adicionalmente al menos uno de los siguientes componentes

- un polipéptido conectar de péptidos,

- un sitio de división por proteasa,

- un marcador.

La secuencia de aminoácidos del polipéptido serpina-dedo se puede elegir entre AGAMFLEAIVM (SEQ ID N°: 1), AAGAMFLEAIVM (SEQ ID N°: 2), TEAAGAMFLEAIVM (SEQ ID N°: 3), AGAMFLEAIVM (SEQ ID N°: 4), TEAAGAMFFEAIPM (SEQ ID N°: 5), TAVVIA (SEQ ID N°: 6), SEAAASTAVVIA (SEQ ID N°: 7), TEAAGATAVVIA (SEQ ID N°: 8), T D AAGAT AVV IA (SEQ ID N°: 9), SDAAGAMFLEAI (SEQ ID N°: 1) y SEAAASMFLEAI (SEQ ID N°: 11). En una forma de ejecución la secuencia de aminoácidos del polipéptido serpina-dedo se elige entre SEAAASTAVVIA (SEQ ID N°: 7) y SEAAASMFLEAI (SEQ ID N°: 11).

En una forma de ejecución la secuencia de aminoácidos del polipéptido conector de péptidos es GGSGG (SEQ ID N°: 12) o SGGGGSGGGGSGGGGT (SEQ ID N°: 52) o STT (SEQ ID N°: 75).

En una forma de ejecución el resto de aminoácido en posición 2 de los aminoácidos del polipéptido serpina-dedo (contando a partir del N terminal del polipéptido serpina-dedo) es de ácido glutámico.

En una forma de ejecución el polipéptido serpina-dedo consta de 8 a 14 restos de aminoácidos, en una forma de ejecución de 1 a 14 restos de aminoácidos y en una forma de ejecución de 11 a 13 restos de aminoácidos.

En una forma de ejecución el polipéptido adicional se elige entre inmunoglobullnas, fragmentos de ¡nmunoglobulinas, hormonas, citocinas, factores de crecimiento, ligandos de receptores, agonistas de receptores, antagonistas de receptores, ligandos de enzimas, agonistas de enzimas, antagonistas de enzimas, agentes citotóxicos, agentes antivíricos, agentes de contraste y moduladores de la actividad enzimática.

Aquí se presenta, en un aspecto, un polipéptido de fusión que comprende en dirección N- hacia C-terminal un polipéptido serpina-dedo fusionado con un polipéptido biológicamente activo, opcionalmente con un polipéptido conector de péptidos intercalado.

En una forma de ejecución el polipéptido biológicamente activo es un agente antivírico.

En una forma de ejecución el agente antivírico es un polipéptido inhibidor de la fusión de VIH. En una forma de ejecución la secuencia de aminoácidos del polipéptido inhibidor de la fusión de VIH es MTWMEWDREINNYTSLIHS- LIEESQNQQEKNEQELLELDKWASLWNWF.

Otro aspecto presentado aquí es un complejo proteico de un polipéptido de fusión serpina-dedo como el descrito en esta exposición y una serpina o un fragmento de la misma, con el polipéptido de fusión incorporado como hebra 4a en medio de la lámina beta A de la serpina.

Aquí se presenta una composición farmacéutica que contiene el polipéptido de fusión serpina-dedo descrito en esta exposición o el complejo proteico aquí revelado y opcionalmente un vehículo farmacéuticamente aceptable.

Otro aspecto presentado aquí es el polipéptido de fusión serpina-dedo descrito en esta exposición o el complejo... [Seguir leyendo]

 


Reivindicaciones:

1. Polipéptido de fusión que comprende en dirección N-terminal hacia C-terminal el polipéptido serpina-dedo SEAAASTAVVIA (SEQ ID N°: 7) o SEAAASMFLEAI (SEQ ID N°: 11) fusionado con una ¡nmunoglobulina u hormona o citocina o factor de crecimiento o ligando de receptores o agonista o antagonista o agente citotóxico o agente antivírico o agente de contraste o inhibidor de enzimas o activador de enzimas o modulador de la actividad enzimática, con un polipéptido conectar de péptidos intercalado.

2. Polipéptido de fusión según la reivindicación 1, caracterizado porque el polipéptido biológicamente activo es un polipéptido inhibidor de la fusión de VIH.

3. Polipéptido de fusión según la reivindicación 1, caracterizado porque el polipéptido biológicamente activo es una ¡nmunoglobulina o un conjugado de ¡nmunoglobulina.

4. Polipéptido de fusión según cualquiera de las reivindicaciones anteriores, caracterizado porque comprende un polipéptido conectar de péptidos entre el polipéptido serpina-dedo y el polipéptido biológicamente activo, con la secuencia de aminoácidos GGSGG (SEQ ID N°: 12).

5. Polipéptido de fusión según cualquiera de las reivindicaciones 2 y 4, caracterizado porque la secuencia de aminoácidos del polipéptido inhibidor de la fusión de VIH es MTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE- LDKWASLWNWF.

6. Complejo proteico de un polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5 con alfa 1- antitripsina.

7. Polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5 o complejo proteico según la reivindicación 6, para usarlo como medicamento.

8. Polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5 o complejo proteico según la reivindicación 6, para usarlo en el tratamiento de una Infección vírica.

9. Polipéptido de fusión según cualquiera de las reivindicaciones 2 hasta 5 o complejo proteico según la reivindicación 6, para usarlo en el tratamiento de una infección por VIH.

1. Uso de alfa 1-antitripsina o antitrombina para elaborar un complejo proteico con un polipéptido de fusión según cualquiera de las reivindicaciones 1 hasta 5.