Asociados de unión del factor de crecimiento placentario, en particular hacia el anticuerpo dirigido hacia el factor de crecimiento placentario, su producción y uso.

Péptido inmunológicamente activo que posee la información de secuencia de una isoforma primaria de P/GF que consiste en una de las siguientes secuencias de aminoácidos:

IAN: 4 TFSQHVRCEC RPLREKMKPE RCGDAVPRR

o una parte del péptido IAN 4

, donde la parte exhibe la secuencia de aminoácidos EKMKPERCGDAVP y/o MKPERCGDAVPRR.

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E11002653.

Solicitante: SIEMENS HEALTHCARE DIAGNOSTICS PRODUCTS GMBH.

Nacionalidad solicitante: Alemania.

Dirección: EMIL-VON-BEHRING-STRASSE 76 35041 MARBURG ALEMANIA.

Inventor/es: ALTHAUS, HARALD, TEIGELKAMP,STEFAN,DR, VITZTHUM,FRANK,DR, TEIGELKAMP,SABINE DR.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > C07K7/00 (Péptidos con 5 a 20 aminoácidos en una secuencia totalmente determinada; Sus derivados)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/22 (contra factores de crecimiento)

PDF original: ES-2529106_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Asociados de unión del factor de crecimiento placentario, en particular hacia el anticuerpo dirigido hacia el factor de crecimiento placentario, su producción y uso.

La invención se refiere a asociados de unión del factor de crecimiento placentario (Placental Growth Factor o 5 Placenta Growth Factor, P/GF) en particular hacia el anticuerpo dirigido hacia el factor de crecimiento placentario, su producción y uso.

El P/GF está involucrado de manera decisiva en procesos fisiológicos y patológicos, en particular en la angiogénesis. Juega un papel importante en la progresión de tumores, en enfermedades renales que son provocadas en particular por diabetes mellitus, por psoriasis, desórdenes inflamatorios, en particular artritis 10 reumatoide, por enfermedades cardiovasculares, entre otras, [lyer, S.; Leónidas, D. D.; Swaminathan, G. J.; Maglione, D.; Battlsti, M.; Tucci, M.; Pérsico, M. G.; Acharya, K. R. J Biol Chem 2001, 276, (15), 12153-61. / lyer, S.; Acharya, K. R. Trends Cardiovasc Med 2002, 12, (3), 128-34. / Heeschen, C.; Dimmeler, S.; Fichtlscherer, S.; Hamm, C. W.; Berger, J.; Slmoons, M. L.; Zeiher, A. M. JAMA 2004, 291, (4), 435-41. / Yang, W.; Ahn, H.; Hlnrlchs, M.; Torry, R. J.; Torry, D. S. J Reprod Immunol 2003, 60, (1), 53-60.].

El P/GF se expresa predominantemente en la placenta y pertenece a la familia de proteínas del "nudo de cisterna". El P/GF está presente en diferentes formas. Son diferentes formas de P/GF (I) ¡soformas primarias e (II) isoformas secundarias. (III) además, puede diferenciarse entre P/GF (fP/GF) libre y P/GF (gP/GF) unido.

(11 Isoformas primarias de P/GF

Las isoformas primarias de P/GF son determinadas por la secuencia primaria, es decir el arreglo de los aminoácidos 20 en la proteína. El empalme alternativo así como modificaciones post-traslacionales, como adiciones de glúcido, introducciones de fosfato, degradación (productos de degradación, fragmentos, etc.), introducciones de acetilo, etc., conducen a diferentes isoformas primarias de P/GF. Hasta ahora se habían descrito cuatro diferentes isoformas primarias del P/GF humano, P/GF-1 (P/GF-131), P/GF-2 (P/GF152), P/GF-3 (P/GF-203) y P/GF-4.

La secuencia del precursor de P/GF-1 (número de secuencia (SN) 1V) se lee como sigue:

SN 1V:

1 tfPVMRLFPCF LüLLAGLALP AVFPQQWALS AGWGSSEVEV VPFQEVWGRS YCRALEIRLVD

61 WSEYPSEVE KMFSP&CVSL LRCTGOCGDE NLKCVPVETA NVTMQLLKIR SGDRPSWEL

121 TFSQHVRCEC RPLftEKMKPE RCGDAVPRR

Por regla general, el P/GF-1 segregado no posee la secuencia líder del precursor de P/GF-1 (precursor P/GF), y por ello comienza de manera terminal en N con alanina (A) (indicado como A en la secuencia del precursor de P/GF-1, ver arriba). Por regla general esto aplica también para las otras isoformas primarias de P/GF.

Con ello, la secuencia de las isoformas primarias de P/GF-1 se lee como sigue:

SN 1:

1 ALFAVPPÜQM ALSAGNGSSE VEWPFGEVW GRSYCRALER LVDWSEYPS EVEHtIFSPSC

61 VSLLRCTGCC GDENLHCVPV ETANVTrtQLL KIRSGDRPSY VELTFSQHVR CECRPLREKM

121 KPERCGDAVP RR

Esta secuencia primaria permite reconocer posiciones posibles para modificaciones post-translacionales y con ello también la disponibilidad de isoformas primarias modificadas de modo post-translacional. Por ejemplo, en general 35 está presente in vivo la isoforma primaria de P/GF modificada por vía post-translacional, del P/GF-1 con adición de glúcido en la posición 84 (asparigina, N).

Como primer aminoácido terminal en N de la isoforma primaria de P/GF-1, en lugar de alanina se indica frecuentemente metionina (M). Esto se refiere en general a P/GF-1 (rP/GF-1) recombinante, por ejemplo expresado en Escherichia coli (E. coli), en particular al rP/GF-1 humano (rhP/GF-1). Aquí emplea AUG como codón de inicio, el 40 cual codifica para metionina. Un P/GF tal, expresado en E. coli, no posee modificaciones por vía post-translacional, en particular tampoco adiciones de glúcido.

La secuencia de la isoforma primaria P/GF-I humana recombinante, es indicada en general de la manera siguiente: SN 1RH:

1 MLPAVPPQQW ALSAGNGSSE VEWPFÜEVW GRSYCRALER LVpfWSEYPS EVEHKFSPSC

61 VSLLRCTGCC GDENLHCVRV ETANVTHQLL KIRSGDRPSY VELTFSQHVR CECRPLREKM

121 KPERCGDAVP RR

Mediante empalme alternativo, en la isoforma P/GF-2 en lugar de la arginina (R) 124 se localiza la secuencia RRR- PKGRGKRRREKQRPTDCHL. De allí que la secuencia de la isoforma primaria P/GF-2 se lee:

SN 2:

1 ALPAVPPQQW ALSAGNGSSE VEWPFQEVW GRSYCRALER LVDWSEYPS EVEHMFSP5C

61 VSLLRCTGCC GDENLHCVPV ETANVTMGLL KIRSGDRPSY VELTFSQHVR CECRPLREKM

121 KPEflWWG» GKRRREKQRP 7HCWLCGDAV PRR

Una inserción incorporada mediante empalme alternativo de 72 aminoácidos (HSPGRQSPDMPGDFRADAPSF LPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEI PRMHPGRNGKKQQRK) conduce a la secuencia de la isoforma primaria P/GF-3:

SN 3:

1 ALPAVPPQÜW ALSAGI4G55E VEWPFQEVW GRSYCRALER LVDWSEYPS EVEHMFSP5C

61 VSLLRCTGCC GDEMLHCVPV ETANVTMQLL KIRSGDRPSY VELTFSQHVR CECRHSPGRD

121 5PDHPGDFRA DAP5FLPFRR 5LPMLFRHEW GCALTGSQSA VWFSSPVPEE IPftHHFGRNG

101 KKOQRKFLRE KKKPERCGDA VPRR

La isoforma primaria P/GF-4 contiene tanto secuencias de la isoforma P/GF-2 (cursiva) como también de la isoforma P/GF-3 (subrayado):

SN 4:

1 ALPAVPPQQW ALSAGNGSSE VEWPFQEW GRSYCRALER LVDWSEYPS EVEHMFSPSC

61 VSLLRCTGCC GDEMLHCVPV ETANVTMQLL KIRSGDRPSY VELTFSQHVR CECRHSP6RQ

121 ^PDMPGDFRA DAPSFLPPRR SLPMLFRKEM GCALTGSQSA VWPSSPVPEE IPRHHPGRNG

1S1 KKQQRKPLRE KftKPERRRPK GRGKRRREKQ PPTPCffLCGÜ AVPRR

(II) Isoformas secundarias de P/GF

Las isoformas secundarias de P/GF surgen de la combinación de isoformas primarias de P/GF o de otras moléculas, en particular moléculas que son homologas a P/GF. Las isoformas primarias de P/GF o bien otras moléculas representan subunidades de las isoformas secundarias de P/GF. En general, las isoformas secundarias de P/GF consisten en dos subunidades. Con ello, por regla general P/GF está presente como dímero, es decir como homodímero o heterodímero. Los homodímeros consisten en dos isoformas primarias de P/GF iguales (subunidades) como P/GF-1 x P/GF-1, P/GF-2 x P/GF-2, P/GF-3 x P/GF-3 y P/GF-4 x P/GF-4. Los heterodímeros consisten en dos isoformas primarias P/GF diferentes o una isoforma primaria P/GF y otra molécula, en particular un homólogo de P/GF como el factor de crecimiento vascular endotelial (VEGF) y sus isoformas primarias. Son ejemplos posibles de heterodímeros P/GF-1 x P/GF-2, P/GF-3 x P/GF-4, P/GF-1 x VEGF, etc.

(III) P/GF (fP/GF) libre y P/GF (qP/GF) unido

Puesto que P/GF forma complejos con asociados de unión, aparte de las isoformas son de considerar también las formas de P/GF que forman complejos o bien están unidas. En principio se diferencian las isoformas primarias libres, en particular sin embargo las isoformas secundarias de P/GF libres (P/GF, fP/GF libres), de las formas que forman complejos o bien están unidas (P/GF, gP/GF unidos). Por ejemplo GP/GF es homodímero de P/GF-1, el cual está presente en forma de complejo. Para esto puede ser un complejo sencillo, es decir un homodímero de P/GF-1 es un receptor, por ejemplo unido al receptor-1 (mFlt-1) de tirosina-quinasa similar a fms unido a la membrana. Otros

ejemplos son complejos con el Flt-1 (sFlt-1) soluble, con neuroflllnas (NP; en particular NP-1 y NP-2), con el receptor que contiene dominio de quinasa/receptor de quinasa de hígado fetal (KDR/Flk-1, VEGFR-2), con proteoglicanos de sulfato de heparlna (FISPG) así como sus isoformas, homólogos, fragmentos y productos de degradación. Asimismo, pueden concebirse complejos compuestos de varias capas de vahas y, dado el caso, diferentes ¡soformas de P/GF y 5 varios, y dado el caso, diferentes... [Seguir leyendo]

 


Reivindicaciones:

1. Péptido ¡nmunológicamente activo que posee la información de secuencia de una isoforma primaria de P/GF que consiste en una de las siguientes secuencias de aminoácidos:

IAN: 4 TFSQHVRCEC RPLREKMKPE RCGDAVPRR

o una parte del péptido IAN 4, donde la parte exhibe la secuencia de aminoácidos EKMKPERCGDAVP y/o MKPERCGDAVPRR.

2. Anticuerpo que es específico para P/GF libre y que se une de manera específica a un péptido según la reivindicación 1.

3. Anticuerpo específico según la reivindicación 2, el cual se une a un epítope, formado de aminoácidos presentes 10 en la siguiente secuencia de aminoácidos:

EKMKPERCGDAVP y/o MKPERCGDAVPRR.

4. Inmunoensayo para la detección de P/GF en una muestra, caracterizado porque se pone en contacto un anticuerpo específico según una o varias de las reivindicaciones 2-3 con la muestra y se determina de modo cualitativo o cuantitativo la formación de un inmunocomplejo con participación del P/GF.

5. Kit de prueba para la ejecución de un inmunoensayo según la reivindicación 4, que contiene un anticuerpo

específico según una o varias de las reivindicaciones 2-3.