2,128 Patentes de julio de 2015 (pag. 49)

  1. 1537.-

    Un aparato médico que comprende una máquina para el tratamiento de fluidos

    (07/2015)

    Un aparato médico que comprende al menos una máquina médica para el tratamiento de fluido, ajustable en una pluralidad de diferentes configuraciones operativas, que presenta: - medios para tratar un fluido que incluyen un número predeterminado de sensores para detectar parámetros de funcionamiento de la máquina médica y un número predeterminado de accionadores para intervenir para modificar parámetros de funcionamiento de la máquina médica ; - una unidad de control al menos para enviar señales de mando...

  2. 1538.-

    Medición de una resistencia de un contacto de conmutación de un interruptor automático eléctrico

    (07/2015)

    Dispositivo de medición para la medición de una resistencia de un contacto de conmutación de un interruptor automático eléctrico , que comprende: - una unidad de generación de gran amperaje , que está diseñada para la generación de una corriente de medición para la medición de la resistencia y se puede acoplar con el interruptor automático para la alimentación de la corriente de medición en el interruptor automático , y - una unidad de medición , que se puede acoplar con el interruptor automático...

  3. 1539.-

    Agujero de ventilación para aparato de aire acondicionado

    (07/2015)

    Un dispositivo de cubierta para un aparato acondicionador integrado alojado dentro de un cuerpo de recipiente instalado empotrado en la pared y adecuado para recibir dicho aparato acondicionador , comprendiendo dicho dispositivo: - una cubierta frontal situada para cerrar una cara abierta de dicho cuerpo de recipiente y provista de al menos dos paneles moviles, a saber, un panel superior de entrada de aire y un panel de salida inferior (16') estando dispuestos de manera giratoria cada uno de dicho panel movil superior...

  4. 1540.-

    Inhibición de la vía alternativa del complemento para el tratamiento de lesión cerebral traumática, lesión de médula espinal y afecciones relacionadas

    (07/2015)

    Un anticuerpo o fragmento de unión al antígeno del mismo para uso en la reducción o prevención de al menos un síntoma de daño fisiológico que resulta de lesión cerebral traumática (LCT) o lesión de médula espinal (LME) en un animal o para mejorar la recuperación de LCT o LME en el animal, en el que el anticuerpo o fragmento de unión al antígeno del mismo se une selectivamente a e inhibe la actividad del factor B, el factor D o properdina.

  5. 1541.-

    Receptor de señales de radiofrecuencia

    (07/2015)

    Un receptor de al menos una señal modulada de radiofrecuencia que procede de una antena externa al receptor, comprendiendo dicho receptor una primera etapa para la amplificación de ruido bajo de la señal modulada de radiofrecuencia y una etapa de demodulación de la señal modulada de radiofrecuencia, caracterizado por comprender un filtro SAW adaptado para actuar como filtro de banda de paso en una frecuencia predeterminada para la señal que procede de la primera etapa, un amplificador logarítmico adaptado...

  6. 1542.-

    Conjunto para dispositivo de estantería, que comprende un soporte para exponer artículos, un dispositivo de iluminación y un elemento de montaje

    (07/2015)

    Conjunto para dispositivo de estantería , que comprende un soporte para exponer artículos, un dispositivo de iluminación y un elemento de montaje que está configurado para soportar dicho dispositivo de iluminación y para ser montado en dicho soporte , en el que dicho elemento de montaje comprende por lo menos un elemento de guiado y dicho dispositivo de iluminación comprende por lo menos un elemento de guiado complementario configurado para poder moverse en rotación con respecto a dicho por lo menos...

  7. 1543.-

    Sistema de cilindro reemplazable

    (07/2015)

    Sistema de cilindro reemplazable para cerraduras que comprende: - una caja de cilindro, - un cilindro de cierre, que se puede insertar en o extraer de la caja de cilindro, que se puede girar en la caja de cilindro entre una posición de apertura y una posición de cierre axialmente respecto al eje longitudinal del cilindro de cierre y de la caja de cilindro, - donde el cilindro de cierre presenta por un extremo un collarín , que sobresale radialmente al eje longitudinal del cilindro de cierre...

  8. 1544.-

    Compuestos de ariloazol-2-il cianoetilamino, procedimiento de fabricación y procedimiento de utilización de los mismos

    (07/2015)

    Compuesto de arilo-azol-2-il-cianoetilamino de la fórmula (I):**Fórmula** P es C-R1 o N; Q es C-R2 o N; V es C-R8 o N; W es C-R9 o N; X es C-R10 o N; Y es C-R11 o N; R1, R2, R8, R9, R10 y R11, ya sea juntos o independientemente uno de otro, son hidrógeno, amino, amido, ciano, nitro, halógeno, alquilo, alquenilo, alquinilo, cicloalquilo, hidroxialquilo, haloalquilo, alquiltio, haloalquiltio, ariltio, alcoxi, fenoxi, alcoxialcoxi, cicloalquiloxi, haloalcoxi, alquilcarbonilo, haloalquilcarbonilo,...

  9. 1545.-

    Activación de un freno de ascensor en una situación de emergencia

    (07/2015)

    Procedimiento en una situación de emergencia para disparar un freno de ascensor de una instalación de ascensor que comprende como mínimo una cabina de ascensor que puede desplazarse verticalmente, donde, en el freno de ascensor, una pieza móvil (BT) queda retenida en una posición inicial mediante una fuerza electromagnética de al menos una bobina (S) conectada a como mínimo una fuente de tensión (SQ, SQ1, SQ2) y donde, para disparar el freno, se suprime la alimentación de tensión de la bobina (S) y, mediante...

  10. 1546.-

    Conjunto de rodamiento

    (07/2015)

    Conjunto de rodamiento para una conexión giratoria, con dos anillos dispuestos concéntricos entre sí así como dispuestos uno dentro del otro, al menos por secciones, que comprende, respectivamente, una superficie de conexión para la conexión respectiva en una pieza de vehículo, de máquina o de instalación o cimiento así como, respectivamente, elementos de conexión en forma de taladros de fijación o taladros ciegos , además con un intersticio entre estos anillos , de manera que son giratorios...

  11. 1547.-

    Placenta post-parto de mamífero, su uso y células madre placentarias de la misma

    (07/2015)

    Células madre placentarias aisladas en una cantidad terapéuticamente eficaz para uso en un método de tratamiento de un individuo que tiene una enfermedad o trastorno, en donde dichas células madre placentarias son fibroblastoides y se adhieren a plástico de un cultivo de tejidos, en donde dichas células madre placentarias se pueden obtener por perfusión de una placenta humana con una solución de perfusión, en donde dicha placenta ha sido exanguinada y perfundida para eliminar la sangre residual; y en donde...

  12. 1548.-

    Vehículo del tipo de montar a horcajadas

    (07/2015)

    Vehículo del tipo de montar a horcajadas incluyendo: una porción de asiento configurada para movimiento entre una primera posición y una segunda posición, siendo la primera posición una posición de conducción; una porción de tapa situada hacia atrás de la porción de asiento y configurada para movimiento entre una primera posición y una segunda posición; una primera porción de contacto (2a) formada en una superficie superior de la porción de asiento ; una segunda porción de contacto (3a) formada en una superficie inferior de la porción de tapa ; y un componente de vehículo dispuesto debajo de la porción de tapa ; donde la primera porción de contacto (2a) está dispuesta para contacto con la segunda porción de...

  13. 1549.-

    Dispositivo de iluminación y vehículo de motor de dos ruedas

    (07/2015)

    Equipo de iluminación para una motocicleta, incluyendo: una bombilla que tiene una porción de base (52a) y una porción de emisión de luz (52b) dispuesta delante de la porción de base (52a); y una lente lateral dispuesta a un lado de la bombilla ; un reflector que tiene una porción de soporte de bombilla (68a) que soporta la porción de base (52a), una porción de superficie de reflexión (68b) que se extiende hacia delante de la porción de soporte de bombilla (68a), una porción anular inferior (68c) que se extiende radialmente hacia fuera de la porción de soporte de bombilla (68a) y una muesca (68d) formada en la porción de superficie de reflexión (68b); para suministrar parte de la luz procedente de la porción de emisión de luz...

  14. 1550.-

    Método y aparato para enviar un índice de matriz de precodificación y la realización de la precodificación

    (07/2015)

    Un método para transmitir un índice de matriz de precodificación, PMI, comprendiendo dicho método: adquirir , por un equipo de usuario, UE, una capacidad de un canal de transmisión para transmitir dicho PMI, en donde el canal de transmisión es un canal que transmite dicho PMI y en donde la capacidad del canal de transmisión para transmitir dicho PMI se refiere a un número máximo de bits para transmitir dicho PMI en el canal de transmisión; formar , por el equipo UE, un segundo conjunto de libro de códigos como un subconjunto de un primer conjunto de libro de códigos en función de la capacidad de dicho canal de transmisión para transmitir dicho PMI, estando el primer conjunto de libro de códigos memorizado localmente en el equipo...

  15. 1551.-

    Tratamiento de patata

    (07/2015)

    Un procedimiento para el tratamiento de patatas, que comprende las etapas de: - aplicar un campo eléctrico en forma de un campo eléctrico pulsado a las patatas, de modo que se crean poros en las membranas celulares de las patatas, aumentando la tasa de transferencia de masa de azúcares reductores de dichas patatas, manteniendo en el interior de las células moléculas grandes tales como almidón, mientras que las moléculas más pequeñas tales como azúcares reductores, se difunden a través de los poros agrandados y se pueden eliminar fácilmente mediante lavado en una etapa de lavado posterior , en donde los pulsos aplicados están en el intervalo de 0,2 a 10 kV/cm y el número de pulsos aplicados es de 1 - 500, y la duración de...

  16. 1552.-

    Soporte de colector de gas para una barbacoa de gas

    (07/2015)

    Un soporte de montaje para un colector de distribución de gas para una barbacoa de gas , la barbacoa que incluye una cámara de combustión y un bastidor de soporte , caracterizado por que el soporte comprende: un primer extremo adaptado para soportar un colector de distribución de gas ; un segundo extremo adaptado para ser unido a una pared de la cámara de combustión ; y una parte intermedia adaptada para ser asegurada a dicho bastidor de soporte .

  17. 1553.-

    Péptidos de cambio de marco (FSP) específicos de MSI para prevención y tratamiento del cáncer

    (07/2015)

    Una vacuna que contiene una combinación de péptidos de cambio de marco (FSP) específicos de MSI que comprende las secuencias de aminoácidos siguientes: NTQIKALNRGLKKKTILKKAGIGMCVKVSSIFFINKQKP (TAF1B ); EIFLPKGRSNSKKKGRRNRIPAVLRTEGEPLHTPSVGMRETTGLGC (HT001 ); y HSTIKVIKAKKKHREVKRTNSSQLV (AIM2 ).

  18. 1554.-

    Fármaco, material dental, y método de cribado

    (07/2015)

    Medicamentos para su utilización en el tratamiento de la pulpitis y/o el aumento de la dentinogénesis, que comprenden: por lo menos una de una proteína metaloproteasa 3 matricial o proteína precursora de metaloproteasa 3 matricial como un principio activo.

  19. 1555.-

    Sistema para vigilancia de una zona dentro de la que se mueven personas

    (07/2015)

    Un sistema para vigilancia de una zona delimitada dentro de la que se mueven personas, caracterizado por incluir una pluralidad de fibras ópticas huecas (10', 10") que se extienden en dicha zona según una estructura de rejilla, - estando provista cada fibra óptica hueca en toda su longitud de una pluralidad de agujeros que crean un canal interno de la fibra en comunicación con el exterior de la fibra; - medios transportadores diseñados para proporcionar un flujo de aire forzado a lo largo de dicho canal interno de la fibra óptica hueca; - fuentes ópticas configuradas para suministrar dicha señal óptica a un primer extremo (10a) de dicha fibra óptica hueca ; - sensores ópticos diseñados para detectar...

  20. 1556.-

    Grupos protectores fotolábiles que contiene un esqueleto de diarilsulfuro

    (07/2015)

    Un compuesto con la fórmula**Fórmula** en el que A se selecciona entre el grupo que consiste en -CH2-, -CH2-CH2-, -CH(CH3)-, -CH(CH3)-CH2-, y R1 es un grupo heteroarilo o arilo sustituido o no sustituido, y R3 es H, un grupo metilo o un grupo etilo, y**Fórmula** en el que R2 es**Fórmula** o en el que R2 es**Fórmula** en el que R4 es H, forma una fosforamidita, H fosfonato o triéster de fosfato y en el que R5 es H, OH, un halógeno o XR6, en el que X es O o S y R6 es H, un grupo alquilo, grupo arilo, o OR6 forma una porción fosforamidita, fosfodiéster, fosfotriéster, H-fosfonato o un acetal o porción de silicona y en el que B se selecciona entre el grupo que consiste en adenina, citosina, guanina, timina,...

  21. 1557.-

    Composición de vacuna

    (07/2015)

    Un vector de adenovirus que comprende un polinucleótido o polinucleótidos que codifican al menos los antígenos de VIH RT, Nef y Gag o fragmentos inmunógenos de los mismos, dispuestos de forma que son transcritos en el orden Gag, RT, Nef, de modo que la porción Gag se encuentre en el extremo N terminal de la proteína de fusión resultante, caracterizado porque el virus es un adenovirus de primate no humano y el virus es un adenovirus de chimpancé seleccionado de Pan 5, Pan 6 y Pan 7.

  22. 1558.-

    Panel de separación modular

    (07/2015)

    Panel de separación modular para un sistema de separadores para delimitar áreas en exteriores, comprendiendo un elemento de base diseñado para mantener al panel separador en posición erecta y un elemento superior diseñado para ser subido y bajado con respecto al elemento de base , caracterizado porque el elemento de base consiste en un armazón dotado de dos lados verticales y dos travesaños que encierran un panel , y dicho elemento superior consiste en un armazón dotado de dos lados verticales y dos travesaños que encierran un panel , consistiendo cada uno de los lados verticales del elemento superior en un tramo de barra , y consistiendo cada uno de dichos...

  23. 1559.-

    Procedimiento de preparación de poliésteres alifáticos

    (07/2015)

    Procedimiento de preparación de un poliéster o copoliéster, en el que a) se mezclan al menos un ácido dicarboxílico alifático con 2 a 12 átomos de carbono y/o anhídridos de ácido derivados del mismo y al menos un alcohol alifático con 2 a 12 átomos de carbono y al menos dos funcionalidades hidroxilo y mediante un aumento de la temperatura adecuado se disuelve el ácido dicarboxílico en el dialcohol, produciéndose la solución a temperaturas de 100 °C a 250 °C, b) la solución obtenida en la etapa a) se añade a un producto de esterificación que contiene al menos un diéster y/o al menos un oligoéster, que se ha obtenido a partir de al menos un ácido dicarboxílico alifático con...

  24. 1560.-

    Derivados de quinoxalinona como estimuladores de la secreción de insulina, métodos para su obtención y su uso para el tratamiento de la diabetes

    (07/2015)

    Un compuesto seleccionado entre los siguientes compuestos: 3-(4-clorofenil)-1-(2,2-difluoroetil)quinoxalin-2(1H)-ona 3-(4-clorofenil)-1-ciclopropil-quinoxalin-2(1H)-ona 1-butil-3-(4-fluorofenil)quinoxalin-2(1H)-ona 3-(4-fluorofenil)-1-(2,2,2-trifluoroetil)quinoxalin-2(1H)-ona 1-etil-6,7-difluoro-3-(4-fluorofenil)quinoxalin-2(1H)-ona 1-etil-6,7-difluoro-3-(4-clororofenil)quinoxalin-2(1H)-ona 1-ciclopropil-3-fenilquinoxalin-2(1H)-ona 1-etil-3-furan-2-il-quinoxalin-2(1H)-ona 1-etil-5-fluoro-3-(4-fluorofenil)quinoxalin-2(1H)-ona 1-ciclopropil-3-(4-fluorofenil)quinoxalin-2(1H)-ona 1-butil-3-(4-clorofenil)quinoxalin-2(1H)-ona 3-(4-clorobencil)-1-etil-quinoxalin-2(1H)-ona 3-(4-clorofenil)-1-(2,2,2-trifluoroetil)quinoxalin-2(1H)-ona 1-(2,2,2-trifluoroetil)-3-(4-trifluorometilfenil)quinoxalin-2(1H)-ona 1-(2,2-difluoroetil)-3-(4-fluorofenil)quinoxalin-2(1H)-ona 3-(4-clorofenil)-1-etil-5-fluoroquinoxalin-2(1H)-ona 3-(4-clorofenil)-1-etil-quinoxalin-2(1H)-ona 3-(2-clorofenil)-1-etil-quinoxalin-2(1H)-ona 1-etil-3-(4-fluorofenil)quinoxalin-2(1H)-ona 1-etil-3-(4-metilfenil)quinoxalin-2(1H)-ona 1-etil-3-(4-fluoro-2-metilfenil)quinoxalin-2(1H)-ona 1-etil-3-(4-cloro-2-metilfenil)quinoxalin-2(1H)-ona 1-etil-3-(4-trifluorometilfenil)quinoxalin-2(1H)-ona 1-etil-3-(4-metanosulfonil-fenil)quinoxalin-2(1H)-ona 3-(2,4-dimetoxi-pirimidin-5-il)-1-etil-quinoxalin-2(1H)-ona 1-etil-3-(4-etilfenil)quinoxalin-2(1H)-ona 1-etil-3-furan-3-il-quinoxalin-2(1H)-ona 3-(3,4-dimetoxifenil)-1-etil-quinoxalin-2(1H)-ona ácido...

  25. 1561.-

    Procedimiento para la fabricación de productos impresos compuestos individualmente

    (07/2015)

    Procedimiento para la fabricación de productos impresos compuestos individualmente, consistentes en como mínimo un producto envolvente y como mínimo un suplemento que se inserta en aquel integrándose uno con otro en un dispositivo de reagrupamiento para obtener un producto impreso, suministrando una primera línea de producción como mínimo un producto envolvente con un signo de identificación individual perceptible visualmente, suministrando otras líneas de producción suplementos de carácter regional y/o específicos para grupos diana , haciéndose funcionar un primer dispositivo de reagrupamiento de manera intermedia entre la primera línea de producción y la segunda...

  26. 1562.-

    Método de diagnóstico para detectar la lesión renal aguda a través del uso de la proteína de choque térmico de 72 como un biomarcador sensible

    (07/2015)

    La presente invención se refiere a un método de diagnóstico, no invasivo, confiable y de fácil realización para detectar insuficiencia renal aguda temprana a través de medir Ia concentración de un biomarcador en muestras de orina, seleccionado a las proteínas de choque térmico de Ia familia 70 KDa, más específicamente se refiere a Ia identificación de Ia proteína de choque térmico 72 y Ia identificación de este biomarcador es detectado mediante ELISA y Western blot o bien el nivel de RNAm mediante RT-PCR en tiempo real. Esta invención contribuye a solucionar el problema que existe actualmente en Ia clínica de no poder detectar desde etapas tempranas a Ia Insuficiencia...

  27. 1563.-

    Unidad de conducción de aire

    (07/2015)

    Unidad de conducción de aire para el montaje en un receso de una pared de armario de distribución con una carcasa de conducción de aire y con un módulo de ventilador que se puede conectar de forma desprendible con él, en la que la carcasa de conducción de aire presenta uno o varios apéndices de bloqueo y el módulo de ventilador presenta unos alojamientos de cierre con una sección de bloqueo , en la que se puede pivotar hacia dentro el apéndice de bloqueo , en la que en la posición de montaje del módulo de ventilador , una pieza de amarre desprendible fija de forma no desplazable el módulo del ventilador , en la que el módulo de ventilador...

  28. 1564.-

    Método para el tratamiento de la enfermedad de Alzheimer utilizando chaperonas farmacológicas para aumentar la actividad de gangliosidasas

    (07/2015)

    Una chaperona farmacológica para uso en el tratamiento de la enfermedad de Alzheimer, en donde la chaperona farmacológica se une selectivamente a y estabiliza una gangliosidasa seleccionada del grupo que consiste en ß- hexosaminidasa A, ß-hexosaminidasa B y ß-hexosaminidasa S; y en donde la chaperona farmacológica se selecciona de: N-butil-desoxigalactonojirimicina (NB-DGJ) N-acetil-glucosamina-tiazolina (NGT) 2-acetamido-1,2-didesoxinojirimicina (AdDNJ) 2-acetamido-2-desoxinojirimicina (ADNJ) 6-acetamido-6-desoxicastanospermina Pirimetamina 2-acetamido-1,4-imino-1,2,4-tridesoxi-L-arabinitol (LABNAc) N-bencil 2-acetamido-1,4-imino-1,2,4-tridesoxi-L-arabinitol...

  29. 1565.-

    Cinta y método para indicar impactos contundentes

    (07/2015)

    Cinta para indicar impactos contundentes, que comprende: una tira de cinta; una pluralidad de microesferas con fluido que pueden romperse portadas por dicha tira de cinta; un fluido indicador con color en cada una de dicha pluralidad de microesferas con fluido; una capa adhesiva sobre una primera superficie (2a) de dicha tira de cinta; y un refuerzo adhesivo sobre una segunda superficie (2b) de dicha tira de cinta; en la que la pluralidad de microesferas con fluido que pueden romperse se portan por dicha capa adhesiva sobre dicha tira de cinta, de modo que las microesferas están adheridas a la capa adhesiva.

  30. 1566.-

    Controlador reseteado de deslizamiento de ruedas para sistemas de frenado

    (07/2015)

    La presente invención se refiere a un controlador reseteado de deslizamiento para sistemas de frenado de vehículos que proporciona una serial (u) que es transmitida a través de la red de comunicaciones a un actuador local que proporciona una señal (u), a partir de; una señal que es elaborada por un módulo supervisor y una señal que es elaborada por un módulo estimador de deslizamiento, y donde un módulo estimador de deslizamiento elabora una señal a partir de una señal que es proporcionada por un módulo de información sensorial y una señal que es elaborada por un módulo de estimación de velocidad, a partir de medidas sensoriales...

  31. 1567.-

    Tanque de flujo continuo

    (07/2015)

    La presente invención se enmarca dentro del campo de los dispositivos empleados en la acuicultura y en la depuración de aguas residuales, como los reactores biológicos. El objeto de la presente invención es un tanque de flujo continuo para el cultivo de microalgas, peces, moluscos, crustáceos o bacterias que está dotado de un álabe o álabes directrices que permiten conseguir un mayor rendimiento en comparación con los tanques actualmente utilizados.

  32. 1568.-

    Estructura elastomérica con propiedades esponjosas, cuadro auto-extractor de miel, colmena para movilizar los cuadros y extraer la miel sin abrirla y su procedimiento

    (07/2015)

    Estructura elastomérica con propiedades esponjosas, cuadro auto-extractor de miel, colmena para movilizar los cuadros y extraer la miel sin abrirla y su procedimiento. Estructura elastomérica caracterizada por; una serie de capas superpuestas conformadas por multiplicidad de prismas adosados entre sí, en cuyas capas externas los tienen abiertos formando cavidades y al menos una capa intermedia con canales en su interior. Principales usos; higiene, cuidado personal y panal artificial. El cuadro auto-extractor de miel, se caracteriza por; la estructura elastomérica anterior, capas externas adaptadas a la geometría de un panal...

<< · 25 · 37 · 43 · 46 · 47 · < · 49 · > · 51 · 53 · 58 · >>