1,775 Patentes de diciembre de 2009 (pag. 43)

  1. 1345.-

    METODO DE FABRICACION DE UNA PLANCHA DE IMPRESION LITOGRAFICA

    (12/2009)

    Un método de hacer una plancha de impresión litográfica incluyendo los pasos de: a) proporcionar un precursor de plancha de impresión litográfica incluyendo (i) un soporte que tiene una superficie hidrófila o que está provisto de una capa hidrófila, (ii) un recubrimiento en dicho soporte, incluyendo una capa de formación de imagen, y, opcionalmente, una capa intermedia entre la capa de formación de imagen y el soporte, donde dicha capa de formación de imagen incluye un polímero conmutable que es un polímero que tiene un grupo hidrófobo o hidrófilo pendiente capaz de ser cambiado a un grupo hidrófilo respectivamente hidrófobo por una reacción química a la exposición, b) exponer en forma de imagen dicho recubrimiento, por lo...

  2. 1346.-

    CIRCUITO DE REFRIGERACION DE DOS TEMPERATURAS

    (12/2009)

    Circuito de refrigeración combinado de temperatura media y baja para hacer circular un refrigerante en una dirección de flujo predeterminada, que comprende en la dirección de flujo (a) un intercambiador de calor que rechaza el calor ; (b) un consumidor de refrigeración de temperatura media ; (c) un separador de vapor de presión media con una parte de vapor y una parte líquida , estando conectado el separador de vapor de presión media al consumidor de refrigeración de temperatura media ; (d) un consumidor de refrigeración de temperatura baja ; y (e) una unidad compresora con una entrada conectada a la parte de vapor del separador de vapor de presión media y al consumidor de refrigeración de temperatura baja ,...

  3. 1347.-

    SOPORTE PARA UN COMPONENTE Y MONTAJE DEL SOPORTE

    (12/2009)

    Soporte (H) para una visera parasol (S) y en particular para un vehículo, que incluye un elemento de cubrimiento (C) con un medio de retención (C4) y un cuerpo de base (B) dispuestos a lo largo de un elemento de eje (A), presentando el elemento de eje (A) un medio de posicionamiento (A3) para desplazar el medio de retención (C4) de una posición de montaje (MP) a una posición instalada (EP) y quedando enclavado el soporte (H) en la posición instalada (EP) en el techo interior (D) a través del medio de retención (C4), caracterizado porque el cuerpo de base (B) presenta un medio de sujeción (B5) que está dispuesto como mínimo parcialmente en un alojamiento (C5) del elemento de cubrimiento (C), presentando el elemento de cubrimiento (C) una...

  4. 1348.-

    VENTOSA ADAPTABLE PARA FIJAR UN CARRIL SOBRE LA SUPERFICIE DE UNA PIEZA DE FORMA NO PERMANENTE

    (12/2009)
    Ver ilustración. Solicitante/s: THE BOEING COMPANY. Inventor/es: BOYL-DAVIS,THEODORE,M, BUTTRICK,JAMES,N.,JR, JONES,DARRELL,D. Clasificación: B25B11/00C1, B25B11/00.

    Una ventosa para conexión extraíble entre un carril conformable de soporte de herramienta y una superficie de lado de carril de una pieza , incluyendo: una superficie interior de la ventosa; una superficie exterior de la ventosa; una pluralidad de soportes elásticos incluyendo material elástico y unidos a un conjunto contiguo, donde la zona entre cada soporte elástico y la superficie de lado de carril de la pieza define una zona; una pluralidad de elementos de refuerzo , donde al menos uno de dicha pluralidad de elementos de refuerzo está incrustado al menos parcialmente dentro de cada soporte respectivo de dichos soportes elásticos , y donde dichos elementos de refuerzo se pueden montar en el carril ; y una junta estanca periférica elástica, unida a dichos soportes elásticos y rodeando la periferia de todas las zonas entre dichos soportes elásticos y la superficie de lado de carril de la pieza.

  5. 1349.-

    JERINGUILLA DE LAVADO QUE TIENE CARACTERISTICAS ANTIRREFLUJO

    (12/2009)

    Un conjunto de jeringuilla de lavado I.V. (intravenoso), que comprende: un cilindro que incluye una pared lateral cilíndrica, que tiene una superficie interior que define una cámara para retener fluido, un extremo proximal abierto y un extremo distal incluyendo una pared distal con una punta alargada que se extiende distalmente, teniendo un conducto de paso a su través en comunicación fluida con la mencionada cámara ; un pistón que incluye una porción de un cuerpo alargado que tiene un extremo proximal , un extremo distal y un tapón posicionado en forma deslizable en acoplamiento estanco contra los fluidos con la mencionada superficie interior del mencionado cilindro para extraer fluido dentro y haciendo...

  6. 1350.-

    ADN QUE CODIFICA LA D-ERITRONATO-4-FOSFATO-DESHIDROGENASA DEPENDIENTE DEL DINUCLEOTIDO FLAVINA-ADENINA,PDXR, Y PRODUCCION MICROBIANA DE LA VITAMINA B6

    (12/2009)

    Un procedimiento para la producción biológica de la vitamina B 6, el cual comprende el cultivo de una célula anfitriona transformada o transfectada mediante un ADN aislado o mediante un vector o plásmido que comprende el ADN aislado bajo la condición que conduce a la producción de la vitamina B6, y recuperando la vitamina B6 del cultivo, en donde el ADN aislado comprende una secuencia de nucleótidos que codifican el PdxR, el cual es una D-eritronato 4-fosfato deshidrogenasa dependiente del dinucleótido flavina-adenina, seleccionada del grupo formado por: (a) una secuencia de ADN identificada por SEQ ID NO: 1 ó la cadena complementaria de la misma; (b) una secuencia de ADN la cual hibrida bajo condiciones estándar con la secuencia...

  7. 1351.-

    DISPOSITIVO MEDICO IMPLANTABLE PARA LA LIBERACION CONTROLADA DE UNA SUSTANCIA

    (12/2009)

    Un dispositivo médico para la liberación controlada de una o más sustancias dentro de una cavidad corporal, que comprende: (a) una fuente de alimentación que tiene terminales primero y segundo; (b) una pluralidad de vesículas en forma de ampolla montada en una primera superficie del dispositivo , teniendo cada vesícula al menos una porción metálica formada de un primer metal; estando llenado un lumen de cada ampolla con una o más sustancias y, (c) un cátodo formado de un segundo metal fijado al segundo terminal de la fuente de alimentación; (d) para cada vesícula , una conexión eléctrica entre la porción metálica de la vesícula y el primer terminal de la fuente de alimentación,...

  8. 1352.-

    FORMULACION DE UNA MEZCLA DE FLAVANOS Y FLAVONOIDES DE ANILLO B LIBRE COMO UN AGENTE TERAPEUTICO

    (12/2009)
    Ver ilustración. Solicitante/s: UNIGEN PHARMACEUTICALS, INC. Inventor/es: JIA,QI. Clasificación: A61K36/185, A61K31/35, A61K36/15, A61K36/48, A61K36/484, A61K36/47, A61K36/54, A61K36/28, A61K36/53, A61K36/9062, A61K36/60, A61K36/539, A61K36/486, A61K36/11, A61K36/906, A61K11/04.

    Composición que comprende una mezcla de baicalina y catequina, en la que la baicalina se aísla de una planta o plantas del género de plantas Scutellaria y la catequina se aísla de una planta o plantas del género de plantas Acacia.

  9. 1353.-

    DERIVADO DE 3-FENOXI-4-PIRIDAZINOL Y COMPOSICION HERBICIDA QUE LO CONTIENE

    (12/2009)

    Un compuesto representado por la fórmula: **(Ver fórmula)** en donde R1 representa un átomo de hidrógeno, un átomo de halógeno, un grupo alquilo C1 a C6, un grupo haloalquilo C1 a C6, un grupo cicloalquilo C3 a C6, un grupo alquenilo C2 a C6, un grupo ciano, un grupo alquilcarbonilo C2 a C7, un grupo di(alquil C1 a C6)carbamoilo, un grupo fenilo que puede estar sustituido (en donde el sustituyente es un sustituyente que se selecciona del siguiente Grupo A sustituyente), un grupo heterocíclico de 5 o 6 miembros (en donde el heterociclo contiene un átomo de nitrógeno, un átomo de oxígeno o un átomo de azufre en el anillo, y puede contener 1 ó 2 átomos de nitrógeno más), un grupo alcoxi C1 a C6, un grupo fenoxi...

  10. 1354.-

    EXPOSITOR DE PANELES DESLIZANTES

    (12/2009)

    1. Expositor de paneles deslizantes, utilizable en la exposición de placas o piezas de material cerámico, del tipo de los que incorporan un bastidor fijo en cuyo seno son desplazables transversalmente una pluralidad de paneles deslizantes que quedan guiados superiormente por medios al respecto existentes en el travesaño superior de dicho bastidor, y que descansan a través de ruedas sobre una plataforma base definida a nivel inferior del bastidor, caracterizado porque dicha plataforma base se materializa en un perfil de cara superior sinuosa y cara inferior sustancialmente plana, de manera que en dicha cara superior se define una pluralidad de "lomos" longitudinales, paralelos...

  11. 1355.-

    VELA RIGIDA DE PERFIL CONFIGURABLE

    (12/2009)
    Ver ilustración. Solicitante/s: BERMUDEZ SANCHEZ,IGNACIO BERMUDEZ MIQUEL,JOSE MIGUEL. Inventor/es: BERMUDEZ MIQUEL,JOSE MIGUEL. Clasificación: B63H9/06B1, F03D9/00, B63H9/06, F03B13/00.

    Vela rígida de perfil configurable. Formada por una estructura rígida de sección ahusada, constituida por dos paredes; rígidas laterales convexas y enfrentadas, que definen un espacio interior . Comprende láminas elásticas de cerramiento, unida a la correspondiente pared en al menos una zona; unos espacios cerrados exteriores de volumen variable, definidos entre cada pared rígida lateral y cada lámina elástica ; múltiples perforaciones , provistas en las paredes rígidas ; medios de generación y alimentación de aire a presión para insuflar aire en los espacios cerrados exteriores a través de dichas perforaciones , con objeto de hinchar dichas láminas elásticas , aumentando el volumen de los espacios cerrados exteriores; y medios de generación y alimentación de vacío, para hacer el vacío en dichos espacios cerrados exteriores a través de dichas perforaciones , a fin de deshinchar dichas láminas elásticas , disminuyendo el volumen de los espacios cerrados exteriores.

  12. 1356.-

    CESTA PARA LA COMPRA

    (12/2009)
    Ver ilustración. Solicitante/s: ARAVEN, S.A.. Inventor/es: GIMENO VERDEJO,ISABEL, PUERTOLAS SALANOVA,JOSE ANTONIO, ANTORAN MARTIN,ANA. Clasificación: A45C3/04, B65D1/38, B65D25/28, B62B1/16.

    Cesta para la compra en autoservicios y/o supermercados, del tipo de las que son susceptibles de apilarse e incorporan medios de rodadura en su base y un asa de tracción para transportarlas de forma inclinada sobre el suelo en donde dicho asa de tracción se sitúa sobre un plano diferente al plano de aplicación de la carga y que cuenta además con sus esquinas reforzadas mediante quiebros los cuales definen un plano sobre el que deslizan las ramas laterales de dicho asa con la ayuda de medios de guiado.

  13. 1357.-

    ACIDOS NUCLEICOS QUE CODIFICAN POLIPEPTIDOS POLIEPITOPE

    (12/2009)
    Solicitante/s: ZYCOS INC. Inventor/es: HEDLEY, MARY, LYNNE, URBAN,ROBERT,C, CHICZ,ROMAN,M. Clasificación: C07K14/025, A61K39/00D6, A61K48/00, A61K39/12, C07H21/04, C12N15/88, C12N15/00.

    Un ácido nucleico que codifica un polipéptido híbrido cuya secuencia comprende una secuencia señal y (i) los siguientes segmentos de la cepa 16 E6 del virus del papiloma humano (HPV): AMFQDPQERPRKLPQLCTEL (SEQ ID Nº: 64), LLRREVYDFAFRDLCIVYRDGNPY (SEQ ID Nº: 65), y KISEYRHYCYSLYGTTLEQQYNK (SEQ ID Nº: 66), (ii) los siguiente segmentos de la cepa 16 H7 de HPV: TLHEYMLDLQPETTDLYSY (SEQ ID Nº: 67), QAEPDRAHYNIVTF (SEQ ID Nº: 68), y LLMGTLGIVCPICSQKP (SEQ ID Nº 69); (iii) los siguiente segmentos de la cepa 18 E6 de HPV: RRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFK (SEQ ID Nº: 152), y SVYGDTLEKLTNTGLYNLLIRCLRCQK (SEQ ID Nº: 153), y (iv) los siguientes segmentos de la cepa 18 E7 de HPV: KATLQDIVLHLEPQNEIPV (SEQ ID Nº: 154), HTMLCMCCKCEARI (SEQ ID Nº: 155), y AFQQLFLNTLSFVCPWC (SEQ ID Nº: 156), Siempre que el polipéptido híbrido no comprenda una secuencia idéntica a la secuencia de bien la proteína E6 entera, intacta o bien E7 entera, intacta de la cepa 16 ó 18 de HPV.

  14. 1358.-

    DISPOSITIVO PARA CALENTAR LIQUIDOS POR MEDIO DE VAPOR

    (12/2009)

    Un dispositivo para calentar un líquido por medio de vapor, comprendiendo el dispositivo un cuerpo que define una cavidad de convergencia interna dentro de la cual desembocan unos conductos (7, 7a, 13, 14, 9, 9a) para admitir un flujo de líquido que va a ser calentado, para admitir un flujo de vapor, y para aspirar un flujo de líquido calentado, respectivamente, siendo la dirección del flujo del líquido calentado aspirado desde la cavidad de convergencia paralela a la dirección del flujo del líquido que va a ser calentado admitido en esa cavidad , comprendiendo así mismo el dispositivo unos medios para provocar que el vapor fluya por dentro de la cavidad en una dirección dispuesta transversalmente con respecto a las direcciones de los flujos...

  15. 1359.-

    DISPOSITIVO DE DISPARO CON UNA PLURALIDAD DE MEDIOS DE REGLAJE DE LOS PARAMETROS DE PROTECCION

    (12/2009)

    Dispositivo de disparo que comprende conmutadores de reglaje destinados a definir primeros parámetros de protección (P1) representativos de una sobrecarga o de un cortocircuito y accesibles para un usuario, medios de visualización , una unidad de tratamiento conectada a sensores de corriente y a los conmutadores de reglaje , comprendiendo la unidad de tratamiento: - primeros medios de tratamiento digital , conectados a los sensores de corriente y a los conmutadores de reglaje , de manera que realizan funciones de protección de base, - segundos medios de tratamiento digital , conectados a los primeros medios de tratamiento y a medios de comunicación que permiten la determinación, por medio de telerreglaje, de segundos parámetros...

  16. 1360.-

    APARATO DE COCCION

    (12/2009)
    Ver ilustración. Solicitante/s: SEB SA. Inventor/es: DAUVERGNE,FRANCOIS, BESSON,JEAN-CHRISTOPHE, SIMOND,THIERRY. Clasificación: A47J37/06D2, A47J37/07B2, A47J37/06.

    Aparato de cocción que comprende una base en la cual se realiza una abertura , una superficie de cocción adaptada para recibir un alimento para cocinar y soportada por la base al nivel superior de la abertura , una subunidad calentadora que comprende una resistencia eléctrica de caldeo dispuesta bajo la superficie de cocción , un reflector térmico que tiene una pared de fondo que se extiende bajo la resistencia eléctrica de caldeo , y una cuba adaptada para contener agua, dispuesta bajo el reflector cuando está en su posición de utilización y adaptada para deslizarse a través de una abertura lateral realizada en al menos una de las paredes laterales de la base , caracterizado porque la cuba es independiente del reflector y esta integralmente situada a nivel inferior del reflector cuando está en su posición de uso.

  17. 1361.-

    PROCEDIMIENTO PARA EL DIAGNOSTICO DE UNA INFECCION POR HELICOBACTER PYLORI Y KIT DE DIAGNOSTICO PARA LLEVAR A CABO DICHO PROCEDIMIENTO

    (12/2009)

    Un procedimiento para diagnosticar una infección por Helicobacter pylori en un paciente tratado con inhibidores de la bomba de protones (IBP) que comprende las etapas de I. a) administrar al paciente una cantidad de un ácido en el intervalo de 5 a 7 g, I. b) recoger una primera muestra de aliento o una primera muestra de sangre o ambas del paciente, I. c) administrar al paciente urea marcada con 13 C, I. d) esperar durante un tiempo de 10 a 60 minutos, I. e) recoger una segunda muestra de aliento o una segunda muestra de sangre o ambas del paciente, I. f) medir el contenido de 13 C en el CO 2 de la primera y la segunda muestra o II. a) recoger una primera muestra de aliento o una primera muestra de sangre o ambas del paciente, II....

  18. 1362.-

    CAJA DE TAPA ARTICULADA PARA CIGARRILLOS O SIMILARES

    (12/2009)
    Ver ilustración. Solicitante/s: FOCKE & CO. (GMBH & CO.). Inventor/es: FOCKE, HEINZ, BUSE, HENRY. Clasificación: B65D5/66E6, B65D85/10, B65D5/66.

    LA INVENCION SE REFIERE A UNA CAJETILLA DE BASCULACION CON UNA PARTE DE CAJA Y UNA TAPA , ASI COMO UN CUELLO , EN PARTICULAR PARA LA RECEPCION DE UN BLOQUE DE CIGARRILLOS. LA PARTE DE CAJA Y LA PARTE SE UNEN UNA CON OTRA EN UNA ZONA DEL LADO POSTERIOR DE LA CAJA A TRAVES DE UNA ARTICULACION DE CHARNELA QUE DISCURRE DE FORMA OBLICUA. PARA ELLO SE HA PREVISTO UNA PARED DELANTERA-CUELLO CON UNA ESCOTADURA DE FORMA TRAPEZOIDAL, "OBLICUA", BAJO FORMACION DE UN CANTO DE CUELLO INCLINADO. DE MANERA CORRESPONDIENTE SE DIRIGE EN DISPOSICION INCLINADA UN CAMPO DE CAJA SUPERIOR.

  19. 1363.-

    PROCEDIMIENTO DE PREPARACION DE UN ANTAGONISTA DE CGRP

    (12/2009)
    Solicitante/s: MERCK SHARP & DOHME CORP. Inventor/es: RIVERA, NELO, BELYK,KEVIN. Clasificación: C07D471/04.

    Un procedimiento de preparación de N-[(3R,6S)-6-(2,3-difluorofenil)-2-oxo-1-(2,2,2-trifluoroetil)azepan-3-il]- 4-(2-oxo-2,3-dihidro-1H-imidazo[4,5-b]piridin-1-il)piperidin-1-carboxamida, comprendiendo dicho procedimiento hacer reaccionar clorhidrato de (3R,6S)-3-amino-6-(2,3-difluorofenil)-1-(2,2,2-trifluoroetil)azepan-2-ona y diclorhidrato de 2-oxo-1-(4-piperidinil)-2,3-dihidro-1H-imidazo[4,5-b]piridina en presencia de 1,1''-carbonildiimidazol.

  20. 1364.-

    SOPORTE DE GUARNICION PARA INSTALACIONES DE FRENO, ESPECIALMENTE TAMBORES DE FRENO, UNIDAD DE SOPORTE Y GUARNICION DE FRICCION Y ELEMENTO DE FIJACION DE SOPORTE DE GUARNICION DE UN DISPOSITIVO DE PRENSA

    (12/2009)
    Ver ilustración. Solicitante/s: TMD FRICTION SERVICES GMBH. Inventor/es: JUNGE,KLAUS. Clasificación: F16D69/04C, F16D69/04.

    Soporte de guarnición de un tambor de freno con una superficie de soporte para la recepción de al menos una guarnición de fricción y al menos un orificio (4, 4'') dispuesto dentro de la superficie de soporte , que está generada a través de transformación, con preferencia flexión, de una sección de material (5, 5'') del soporte de guarnición ,en el que la sección de material (5, 5'') está transformada frente al soporte de guarnición de tal forma que en el caso de un prensado de la guarnición de fricción sobre la superficie de soporte , la sección de material (5, 5'') forma junto con el orificio (4, 4'') una matriz de prensa , caracterizado porque la sección de material (5, 5'') se distancia desde el soporte de guarnición en un ángulo alfa predeterminado en la dirección de prensado.

  21. 1365.-

    PROCEDIMIENTO E INSTALACION DE EXPLOTACION DE CAPA ACUIFERA SUBTERRANEA

    (12/2009)
    Ver ilustración. Solicitante/s: LYONNAISE DES EAUX FRANCE. Inventor/es: HAEFFNER,HUGUES, GRANDGUILLAUME,JEAN-JACQUES. Clasificación: E03B3/12, E03B3/36.

    Procedimiento de explotación de capa acuífera subterránea captado por perforación, que utiliza al menos dos niveles de bombeo sucesivos del agua de la capa antes de su utilización, caracterizado porque comprende un bombeo primario que extrae el agua de la capa en una zona donde la recarga de la capa sea rápida a partir de las aguas de superficie circundantes, y donde la misma se beneficia de una filtración natural en el subsuelo, y de una depuración natural mediante condiciones reductoras, siendo el agua procedente de este primer bombeo enviada a un estanque de realimentación artificial en contacto con el aire ambiente pero sin reactivo orgánico o reductor con el fin de crear localmente condiciones oxidantes, donde la misma se infiltra a la capa experimentando una segunda filtración y un bombeo secundario realizado en la proximidad del estanque de realimentación antes de su utilización.

  22. 1366.-

    PROCEDIMIENTO PARA LA PREPARACION DE COMPUESTOS DE 3,7-DIAZA-BICICLO(3.3.1)NONANO

    (12/2009)

    Procedimiento para la preparación de compuestos de 3,7-diaza-biciclo[3.3.1]nonano de la fórmula 1 **(Ver fórmula)** realizándose que R significa hidrógeno, hidroxilo, alquilo de C1-C4; R1 significa alquilo de C1-C4, arilo de C6-C10, piridinil-alquilo de C1-C4; R2 significa alquilo de C1-C4, arilo de C6-C10; R3 significa alquilo de C1-C4 y X significa C=O ó C(OH)2, (a) por reacción de un éster de ácido dicarboxílico de la fórmula **(Ver fórmula)** con un piridina-aldehído de la fórmula **(Ver fórmula)** así como con una amina de la fórmula R2 - NH2 para formar una piperidona de la fórmula **(Ver fórmula)** y (b) por reacción de las piperidonas de la fórmula , obtenidas de esta manera, con formaldehído y con una...

  23. 1367.-

    APARATO PARA MODULAR EL FLUJO DE FLUIDO

    (12/2009)

    Un aparato para modular un flujo de fluido, que comprende: - una primera trayectoria de flujo y - una segunda trayectoria de flujo transversal a la primera trayectoria de flujo , en el que la segunda trayectoria de flujo se define por un conducto que se extiende a través de la primera trayectoria de flujo , pero que no bloquea totalmente el flujo de fluido a lo largo de la misma, en el que el conducto tiene una entrada de fluido que se abre en la primera trayectoria de flujo , de manera que una porción de fluido que fluye a lo largo de la primera trayectoria de flujo es desviada en la segunda trayectoria de flujo , en el que la posición de la entrada de fluido es ajustable entre la primera y la segunda posición...

  24. 1368.-

    FORMULACION PARA MEJORAR EL METABOLISMO DEL SABOR DE LA LEVADURA EN SISTEMAS DE FERMENTACION DE ESPONJA, DE MASA, DE CERVEZA Y DE MASA MADRE

    (12/2009)
    Solicitante/s: PURATOS NAAMLOZE VENNOOTSCHAP. Inventor/es: TOSSUT, PIERRE PATRICK ALDO, CAPELLE,STEFAN. Clasificación: C12G1/00, A23L1/23, A23L1/227, A21D2/24B, A21D2/26B, A21D2/26D, A21D2/26F, A21D2/26H, C12C12/00B4, C12C12/00B6, A21D2/26, A21D2/24.

    Mezcla de - una composición de aminoácidos que comprende, por lo menos, leucina, valina, isoleucina y fenilalanina. - levadura, - y preferentemente, también una masa madre, en la que la mezcla presente un contenido de materia seca de por lo menos el 90%, preferentemente de por lo menos el 95%, y más preferentemente de por lo menos el 96%.

  25. 1369.-

    VALVULA DE ASIENTO INVERTIDO EN CULATA Y EJE DE DISTRIBUCION INVERTIDO

    (12/2009)
    Ver ilustración. Solicitante/s: MARIN ROMERO, JOSE. Inventor/es: MARIN ROMERO,JOSE. Clasificación: F01L3/20, F01L3/22, F01L1/053B, F01L1/053.

    Válvula de asiento invertido en culata y eje de distribución invertido que comprende, al menos: un asiento en culata invertido , donde la base de apoyo de la válvula se encuentra situada por el interior de las toberas de admisión y escape , una válvula con el asiento invertido en la cara exterior y contraria al vástago , un muelle , estando éste únicamente situado en la válvula de admisión, un cartucho de soporte del sistema , y un eje de distribución con leva invertida, de perfil redondo y sección plana para el accionamiento de las válvulas.

  26. 1370.-

    PROCESO DE TINTADO POR INMERSION DE CHAPA DE MADERA

    (12/2009)
    Ver ilustración. Solicitante/s: PERERA RODRIGUEZ,EDUARD. Inventor/es: PERERA RODRIGUEZ,EDUARD. Clasificación: B27K5/02.

    Proceso de tintado por inmersión de chapa de madera, donde dicha chapa se prepara para la inmersión en una jaula de acero inoxidable pavonado, colocándola entre redes, y sumergiéndola en una cuba en agua descalcificada a 60ºC, y añadiendo agua oxigenada, hidróxido de sodio, un estabilizador de agua oxigenada y un secuestrante. El aclarado se realiza con ácido acético, manteniendo el pH a 7. Se vacía el agua de la cuba y rellenar de nuevo con agua descalcificada, y añadiendo en este momento unos pigmentos, que variarán en porcentaje y color dependiendo del resultado que se desee obtener. Además se añaden hidrosulfito sódico, antiespumante, hidróxido de sodio y un secuestrante. Se vacía de nuevo la cuba y se rellena con agua descalcificada, y se añade agua oxigenada para su oxigenación, jabón y ácido acético para fijar el color, en etapas separadas, dejándola escurrir y pasando por un secadero final.

  27. 1371.-

    ESMALTE CERAMICO CON BRILLO METALICO, PROCEDIMIENTO DE OBTENCION Y APLICACION

    (12/2009)
    Ver ilustración. Solicitante/s: CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS. Inventor/es: MOYA CORRAL,JOSE SERAFIN, PECHARROMAN GARCIA,CARLOS, ESTEBAN CUBILLO,ANTONIO, FERNANDEZ LOZANO,JOSE FCO, PIZA ZAPARDIEL,RAUL, JIMENEZ REINOSA,JULIAN. Clasificación: C03C8/18, C04B41/80, C03C08/18.

    Esmalte cerámico con brillo metálico, procedimiento de obtención y aplicación. La presente invención se refiere a un esmalte cerámico con brillo metálico caracterizado porque está constituido por: - Un polvo de metal de tamaño micro/nanométrico del tipo de Cu, Ni, Cd, Ru, Fe, Pd, Au, Ag, Co, W, Mo, Pt, Rh e Ir, y sus posibles aleaciones con éstos u otros metales, y/o por partículas de distintos óxidos que presenten carácter metálico en el rango óptico (Fe{sub,3}O{sub,4}, Co{sub,3}O{sub,4}, NbO, TaO, Mn{sub,3}O{sub,4}, MoxOy y WxOy) o precursores que permitan obtener los óxidos conductores anteriores. - Una frita y caolín; y - Negro de humo. Así como al procedimiento de obtención de dicho esmalte.

  28. 1372.-

    PROCEDIMIENTO DE CRISTALIZACION A PARTIR DE SOLUCION

    (12/2009)
    Ver ilustración. Solicitante/s: INSTITUTO NACIONAL DE TECNICA AEROESPACIAL "ESTEBAN TERRADAS" CONSEJO SUPERIOR DE INVES. CIENTIFICAS. Inventor/es: OSUAN ESTEBAN,SUSANA, ZORZANO MIER,MA. PAZ, MENOR SALVAN,CESAR, RUIZ BERMEJO,MARTA, VEINTEMILLAS VERDAGUER,SABINO. Clasificación: B01D9/02, C30B7/00, C30B30/08, C07B57/00, C07B55/00.

    Procedimiento de cristalización a partir de solución. La presente invención se refiere a un nuevo procedimiento y a un dispositivo para la obtención de cristales de una sustancia que comprende: (i) preparar una disolución saturada de la sustancia a cristalizar en un disolvente adecuado en un recipiente de reacción; (ii) generar un aerosol en el recipiente de reacción; (iii) cristalización de la sustancia; y (iv) recuperación de los cristales en el fondo del recipiente de reacción. El procedimiento es especialmente adecuado para cristalizar sustancias típicamente difíciles de cristalizar y puede conducir a un resultado de amplificación quiral.

  29. 1373.-

    POLIURETANOS OBTENIDOS A PARTIR DE AMIDAS DE ACIDO GRASO QUE CONTIENEN HIDROXILO

    (12/2009)
    Solicitante/s: DOW GLOBAL TECHNOLOGIES INC.. Inventor/es: SCHROCK, ALAN, K., LYSENKO, ZENON, BRIGGS,JOHN,R, MARTIN,CHARLES,A, SANDERS,AARON,W, BABB,DAVID,ALAN, EARLS,JIM,D, OLSON,KURT,D. Clasificación: C08G18/36, C07C235/08, C08G18/38F5B, C08G18/38, C08J9/04, C07C67/26.

    Un proceso para preparar un poliuretano, que comprende (a) formar una mezcla de reacción mezclando un poliol o mezcla de los mismos con un compuesto de poliisocianato, donde el poliol o mezcla de poliol incluye uno o más compuestos que tienen un grupo amida que tiene al menos un grupo orgánico que contiene hidroxilo unido al átomo de nitrógeno del grupo amida y un grupo hidrocarbonado C 7-23 de cadena lineal o ramificada unido directamente al carbono carbonílico del grupo amida, donde el grupo hidrocarbonado C7-23 se sustituye con al menos un (i) grupo (N-hidroxialquil)-aminoalquilo o (ii) grupo éster que contiene hidroxilo; y (b) someter la mezcla de reacción a condiciones tal que se cure para formar un poliuretano.

  30. 1374.-

    DISPOSITIVO PARA LA ADMINISTRACION DE TRATAMIENTO MEDICO

    (12/2009)

    Dispositivo médico que puede recuperarse para la administración de fluido de tratamiento médico a vasos corporales, que tiene un extremo distal y uno proximal , que comprende un elemento tubular hueco, de autoexpansión y un catéter de administración adecuado para desplegar un elemento tubular de autoexpansión , en el que: - el elemento tubular está configurado para expandirse radialmente para formar una parte central flanqueada por dos salientes anulares - un saliente anular distal y un saliente anular proximal , - el elemento tubular comprende una zona impermeable a los líquidos, definida al menos por la región flanqueada por los salientes anulares , - el elemento tubular comprende dos regiones permeables...

  31. 1375.-

    AGENTES DE LAVADO LIQUIDOS, QUE CONTIENEN AGENTES PARA LA FIJACION DE LOS COLORES

    (12/2009)

    Agentes de lavado y limpieza líquidos, que contienen a) un alquil-benceno-sulfonato y/o un olefina-sulfonato, y/o un alquil-sulfato b) un jabón c) un agente tensioactivo no iónico, así como eventualmente y d) alquil-éster-sulfonatos, alquil-éter-sulfonatos y/o productos de condensación de óxido de etileno con una base hidrófoba, que son formados mediante condensación de óxido de propileno con propilenglicol, productos de condensación de óxido de etileno con un producto de reacción de óxido de propileno y etilendiamina, un producto de condensación de (alquil de C6-C20)-fenoles con óxidos de alquenos e) un agente para la fijación de los colores escogido entre el conjunto formado por los homo- o respectivamente copolímeros...

  32. 1376.-

    DERIVADOS DE LA AZETIDINA COMO ANTAGONISTAS DEL RECEPTOR CCR-3

    (12/2009)

    Un compuesto de fórmula I **(Ver fórmula)** en forma libre o de sal, en donde Ar es un fenil opcionalmente sustituido por un halo, alquilo C1-C8, alcoxi C1-C8, ciano, nitro, -SO2-alquilo C1-C8, -SO2-NH-alquilo C1-C8 o -SO2-N-(alquilo C1-C8)2; X es un enlace o -CO-CH2-NH-; Y es -CO-R1-, -CO-R2-S-, -CO-NH- o -SO2-; T es un grupo cíclico seleccionado de cicloalquilo C1-C8, fenil opcionalmente sustituido por un halo, alquilo C1- C8, alcoxi C1-C8 o ciano, y un grupo heterocíclico que tiene un anillo de 5 a 10 átomos en donde al menos uno de aquellos átomos del anillo es un átomo de nitrógeno, oxígeno o azufre, siendo dicho grupo heterocíclico opcionalmente sustituido por un halo, alquilo C1-C8 opcionalmente sustituido por un R3, alcoxi...

<< · 22 · 32 · 37 · 40 · 41 · < · 43 · > · 46 · 49 · >>