13 patentes, modelos y diseños de CELTRIX PHARMACEUTICALS, INC.

  1. 1.-

    VARIANTES DE LA PROTEINA 3 DE UNION DE FACTOR DE CRECIMIENTO SIMILAR A LA INSULINA.

    (02/2006)

    La invención se refiere a variantes de la IGFBP-3 que están estabilizadas contra la hidrólisis no enzimática. Los inventores han descubierto que la IGFBP-3 es susceptible a la hidrólisis no enzimática en un sitio de Asp-Pro de la proteína. Asimismo y de forma sorprendente, los inventores han descubierto que un segundo sitio de la proteína es susceptible a la hidrólisis no enzimática. Los inventores han creado variantes de IGFBP-3 resistentes a la hidrólisis no enzimática en estos puntos. Las variantes de IGFBP-3 resistentes a la hidrólisis preferibles incluyen variantes de la proteína madura en la que...

  2. 2.-

    TRATAMIENTO DE TRASTORNOS INMUNOLOGICOS Y HEMATOLOGICOS CON IGFBP SOLO O ASOCIADO CON IGF.

    (11/2005)
    Ver ilustración. Inventor/es: CARLINO, JOSEPH A., HIGLEY, HOWARD R, MAACK, CHRISTOPHER A. Clasificación: A61K38/17, A61P37/00, A61K38/30.

    Utilización de la proteína 3 de fijación al factor de crecimiento semejante a insulina (IGFBP-3), sin formar complejo con IGF-I, en la fabricación de un medicamento para tratar una patología linfoproliferativa inducida por IGF.

  3. 3.-

    METODOS PARA EL TRATAMIENTO DE LA DIABETES.

    (02/2005)
    Inventor/es: SOMMER, ANDREAS. Clasificación: A61P3/10, A61K38/30.

    Utilización de un complejo que incluye IGF-I e IGFBP-3 para la elaboración de un medicamento para el tratamiento o el alivio de la diabetes mellitus en un individuo que padezca los síntomas o complicaciones relacionados con la diabetes mellitus.

  4. 4.-

    FORMULACIONES FARMACEUTICAS ESTABLES PARA IGF/IGFBP.

    (12/2004)
    Inventor/es: DANKO, STEPHEN, PASSMORE, DAVID, OGAWA, YASUSHI. Clasificación: A61K38/17, A61K47/26, A61K38/30.

    Formulación farmacéutica para el complejo de factor de crecimiento insulinoide (IGF) y la proteína de fijación del factor de crecimiento insulinoide (IGFBP), que comprende: complejo IGF/IGFBP; un agente de aumento de la masa; y sales tampón del pH, caracterizada porque la formulación contiene menos de 12, 5 mM de sales osmolíticas.

  5. 5.-

    METODO DE PRODUCCION DE IGF-I E IGFBP-3 CON PLEGAMIENTO CORRECTO Y ENLACE DISULFURO.

    (02/2003)
    Inventor/es: SOMMER, ANDREAS, OGAWA, YASUSHI, TAO, PEGGY. Clasificación: C12N15/12, C07K14/435, C07K14/65, C07K1/14.

    LA PRESENTE INVENCION PROPORCIONA UN NUEVO METODO DE REPLEGADO DEL FACTOR DE CRECIMIENTO DE TIPO INSULINA I (IGF DEL FACTOR DE CRECIMIENTO DE TIPO INSULINA QUE SE UNE A LA PROTEINA 3 (IGFBP E IGFBP SIDERABLEMENTE SUPERIORES DE PROTEINA CORRECTAMENTE PLEGADA PARA AMBAS MOLECULAS Y ALTERA LA CINETICA DEL REPLEGAMIENTO. DICHO METODO INCLUYE LA PRODUCCION DE IGF OMPLEJO IGF - I/IGFBP - 3, CORRECTAMENTE PLEGADOS.

  6. 6.-

    METODO PARA EL TRATAMIENTO SISTEMICO DE ESTADOS CATABOLICOS Y LESIONES SISTEMICAS DE TEJIDOS.

    (11/2002)
    Inventor/es: MAACK, CHRISTOPHER A, SOMMER, ANDREAS. Clasificación: A61K38/43, C07K7/00, A61K38/30.

    SE PRESENTA UN METODO PARA TRATAMIENTO DE PACIENTES CON ESTADOS CATABOLICOS, QUEMADURAS, TRAUMAS Y ULCERAS PEPTICAS Y PACIENTES QUE VAN A SER, ESTAN O ACABAN DE SER SOMETIDOS A INTERVENCION QUIRURGICA. EL METODO INCLUYE LA ADMINISTRACION DE UNA COMPOSICION QUE CONTIENE UN COMPLEJO DE FACTOR DE CRECIMIENTO SIMILAR A LA INSULINA (IGF) Y PROTEINA-3 DE LIGAMIENTO DEL FACTOR DE CRECIMIENTO PARECIDO A INSULINA (IGFBP-3). LA FORMA PREFERIDA ES IGF-I/IGFBP-3.

  7. 7.-

    FRAGMENTO DEL RECEPTOR DE FIJACION A TGF-BETA TIPOII COMO AGENTE TERAPEUTICO.

    (11/2002)
    Inventor/es: SEGARINI, PATRICIA, R., DASCH, JAMES, R., OLSEN, DAVID, R., CARRILLO, PEDRO, A. Clasificación: A61K38/04, A61K38/00.

    SE DESCRIBE UN METODO DE TRATAMIENTO DEL EXCESO DE TGF BETA. EL TRATAMIENTO ES PARENTERAL, ORAL O POR MEDIO DE ADMINISTRACION TOPICA DE FRAGMENTOS DE RECEPTOR DE TGF - BETA. PARTICULARMENTE EFECTIVO ES UN FRAGMENTO SOLUBLE QUE PARECE LA PARTE EXTRACELULAR DE LA PROTEINA II DE ENLACE DEL TGF - BETA.

  8. 8.-

    FACTOR TRANSFORMANTE DEL CRECIMIENTO TIPO BETA.

    (11/2000)
    Inventor/es: OGAWA, YASUSHI, SCHMIDT, DAVID, DASCH, JAMES. Clasificación: C07K1/16, A61K38/27, C12N15/18, C07K14/495, C07K1/18.

    SE DESCRIBE UNA NUEVA FORMA HETERODIMERICA DEL TGF-(BETA). ESTA MOLECULA KD 25 ES ACTIVA EN ENSAYOS IN VITRO EN LA INHIBICION DEL CRECIMIENTO DE LAS CELULAS EPITELIALES. LA PROTEINA PUEDE AISLARSE A PARTIR DEL HUESO. CUANDO SE REDUCE, LA PROTEINA SE LEVIGA EN DOS PICOS MEDIANTE RP-HPLC. LA PROTEINA REDUCIDA A PARTIR DEL PICO DE LEVIGACION MAS TEMPRANO REACCIONA PREDOMINANTEMENTE CON LOS ANTICUERPOS DIRIGIDOS CONTRA EL TGF-(BETA)3, MIENTRAS QUE LA PROTEINA REDUCIDA A PARTIR DEL PICO DE LEVIGACION POSTERIOR REACCIONA PREDOMINANTEMENTE CON LOS ANTICUERPOS DIRIGIDOS CONTRA EL TGF-(BETA)2. LA SECUENCIA DE AMINOACIDO DE TERMINAL N Y LA INMUNOREACTIVIDAD DE LA PROTEINA NATIVA SON CONSISTENTES CON UN HETERODIMERO DEL TGF-(BETA)2 Y DEL TGF-(BETA)3.

  9. 9.-

    PEPTIDOS DE TGF-BETA 1 Y TGF-BETA 2 BIOLOGICAMENTE ACTIVOS.

    (08/2000)
    Inventor/es: OGAWA, YASUSHI, SCHMIDT, DAVID. Clasificación: A61K38/18, C07K14/495.

    LA INVENCION SE REFIERE A PEPTIDOS CORRESPONDIENTES A REGIONES DE LA SECUENCIA AMINOACIDA DE TGF-{BE}1 Y TGF-{BE}2, QUE CONSERVAN, BIEN EN FORMAS MONOMERICAS O POLIMERICAS, AL MENOS ALGO DE LA ACTIVIDAD BIOLOGICA DEL TGF-{BE} RESPECTIVO DE LONGITUD COMPLETA. LA FORMA MONOMERICA DEL PEPTIDO DERIVADO DE TFG-{BE}1, COMPRENDE LA SIGUIENTE SECUENCIA AMINOACIDA: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP. LA FORMA MONOMERICA DEL PEPTIDO DERIVADO DE TGF-{BE}2, COMPRENDE LA SIGUIENTE SECUENCIA AMINOACIDA: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA. LOS DIMEROS PUEDEN FORMARSE POR MEDIO DE ENLACES DISULFURO ENTRE LOS RESIDUOS DE CISTEINA AMINO-TERMINALES, LOS RESIDUOS DE CISTEINA CARBOXITERMINALES, O RESIDUOS DE CISTEINA AMINO- Y CARBOXI-TERMINALES DE LAS SUBUNIDADES MONOMERICAS.

  10. 10.-

    METODO PARA EL TRATAMIENTO DE DISFUNCIONES EN LA REPRODUCCION.

    (06/2000)
    Inventor/es: MAACK, CHRISTOPHER A. Clasificación: C07K14/00, C07K7/00, A61K38/30.

    ESTE ES UN METODO PARA EL TRATAMIENTO DE LOS TRASTORNOS ASOCIADOS A LA REPRODUCCION EN LOS QUE SE PRODUCE UNA INSUFICIENCIA DE LA MADURACION DE LOS GAMETOS EN LOS SUJETOS, MEDIANTE LA ADMINISTRACION DE UN COMPUESTO QUE CONTIENE UN COMPLEJO CON UN FACTOR DE CRECIMIENTO SIMILAR AL DE LA INSULINA (IGF) Y UNA PROTEINA DE UNION 3 DEL FACTOR DE CRECIMIENTO SIMILAR AL DE LA INSULINA (IGFBP-3).

  11. 11.-

    MOLECULAS DE ADN RECOMBINANTE, HUESPEDES, PROCEDIMIENTOS Y POLIPEPTIDOS SIMILARES A PROTEINAS PORTADORAS DE SOMATOMEDINA HUMANA.

    (12/1997)

    ESTA INVENCION SE REFIERE A POLIPEPTIDOS QUE SON SUBUNIDADES DE PROTEINA QUE TRANSPORTAN SOMATOMEDINA HUMANA, Y A PROCESOS PARA PRODUCIRLOS. LAS SUBMIDADES DE PROTEINA TRANSPORTADORA SE UNEN A POLIPEPTIDOS EN FORMA DE PROTEINA HUMANA, TAMBIEN CONOCIDOS COMO FACTORES DE CRECIMIENTO DE TIPO DE INSULINA. EL PROCESO INCLUYE LA PREPARACION A PARTIR DE UNA FRACCION DE SUERO HUMANO, COHN+V-1, POR UNA MOLECULA DE VARIOS PASOS CROMATOGRAFICOS. ESTA INVENCION TAMBIEN SE REFIERE A MOLECULAS DE ADN QUE CODIFICAN POLIPEPTIDOS...

  12. 12.-

    LIBERACION OBJETIVADA DE FACTORES DEL CRECIMIENTO DEL HUESO.

    (10/1997)
    Inventor/es: BENTZ, HANNE, ROSEN, DAVID. Clasificación: A61K47/48.

    SE PRESENTAN METODOS Y COMPUESTOS PARA USAR CONJUGADOS DE FACTORES DEL CRECIMIENTO DEL HUESO Y OBJETIVAR MOLECULAS EN LA REPARACION Y AUMENTO DEL HUESO.

  13. 13.-

    Subunidades de proteina portadoras de somatomedina humana y proceso para producirlas.

    (11/1994)
    Inventor/es: SPENCER,EMERALD M. Clasificación: C07K15/00.

    Un método que comprende la producción de un polipéptido que es un fragmento, una parte o un componente del complejo de glucoproteina humana que regula la actividad biológica de las somatomedinas mediante un proceso que implica el enlace de las somatomedinas, que depende de la hormona de crecimiento, y que presenta un peso molecular de aproximadamente 125000 a 160000 daltons, en condiciones de pH fisiológico, cuando forma complejo con las somatomedinas; en el que el polipéptido es capaz de unirse con las somatomedinas y con los polipéptidos similares a las somatomedinas y que tiene una secuencia de aminoácidos N-terminal de fórmula Gly-Ala-Ser-Ser-Ala-Gly-Leu-Gly-Pro-Val Val-Arg-R-Glu-Pro-R-Asp-Ala-Arg-Ala Leu-Alaen la que R es cisteina o semicisteina; la 5-Ala puede ser Gly; y el 14-Glu puede ser Phe.