CIP 2015 : C07K 14/415 : de vegetales.

CIP2015CC07C07KC07K 14/00C07K 14/415[1] › de vegetales.

Notas[t] desde C01 hasta C14: QUIMICA

C SECCION C — QUIMICA; METALURGIA.

C07 QUIMICA ORGANICA.

C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.

C07K 14/415 · de vegetales.

CIP2015: Invenciones publicadas en esta sección.

Proteasas aspárticas.

(25/09/2019). Solicitante/s: Biocant - Associação De Transferência De Tecnologia. Inventor/es: ALMEIDA,CARLA SOFIA GOMES MALAQUIAS DE, SIMÕES,ISAURA ISABEL GONÇALVES, FARO,CARLOS JOSÉ FIALHO COSTA.

Una cardosina B recombinante, en donde, en comparación con la cardosina B de tipo silvestre, el dominio de inserto específico vegetal (PSI) se elimina por completo o en donde el dominio de PSI se reemplaza completamente con un péptido conector de 1, 2, 3, 4, 5, 6, 7, 8, 9 o 10 aminoácidos.

PDF original: ES-2763650_T3.pdf

Receptor de reconocimiento de patrones de plantas y quimeras del mismo para su uso contra infecciones bacterianas.

(11/09/2019). Solicitante/s: EBERHARD-KARLS-UNIVERSITAT TUBINGEN. Inventor/es: JEHLE,ANNA KRISTINA, LIPSCHIS,MARTIN, ALBERT,MARKUS, FELIX,GEORG.

Un receptor de reconocimiento de patrones quiméricos (PRR) para reconocer patrones moleculares asociados a patógenos de plantas, que comprende al menos un ectodominio que tiene una secuencia que es al menos 80 % idéntica al ectodominio de la proteína mostrada en la SEQ ID No. 1, un dominio yuxtamembrana, un dominio transmembrana y un dominio citoplasmático, caracterizado porque el ectodominio y al menos uno de los otros dominios se derivan de PRR diferentes.

PDF original: ES-2773916_T3.pdf

Planta Brassica que comprende un alelo indehiscente mutante.

(11/09/2019) Un alelo mutante defectivo parcial de un gen IND, en el que el gen IND comprende una molécula de ácido nucleico seleccionada del grupo que consiste en: (a) una molécula de ácido nucleico que comprende al menos un 90 % de identidad de secuencia con la SEQ ID NO: 1, la SEQ ID NO: 3 desde el nucleótido en la posición 46 hasta el nucleótido en la posición 633, la SEQ ID NO: 3, la SEQ ID NO: 5 o la SEQ ID NO: 7; (b) una molécula de ácido nucleico que codifica una secuencia de aminoácidos que comprende al menos un 90 % de identidad de secuencia con la SEQ ID NO: 2, la SEQ ID NO: 4 desde el aminoácido en la posición 16 hasta el aminoácido en la posición 210, o la SEQ ID NO: 4, en el que dicho alelo mutante defectivo parcial comprende…

Anticuerpos anti-EpCAM y métodos de uso.

(24/07/2019). Solicitante/s: Viventia Bio Inc. Inventor/es: MACDONALD,GLEN, CIZEAU,JEANNICK, ENTWISTLE,JOYCELYN, PREMSUKH,ARJUNE, CHOONIEDASS,SHILPA.

Un anticuerpo que se une a la molécula de adhesión de células epiteliales (EpCAM) que comprende: (i) una cadena pesada que tiene una secuencia de aminoácidos como se muestra en SEQ ID NO: 1 y una cadena ligera que tiene una secuencia de aminoácidos como se muestra en SEQ ID NO: 2; o (ii) una cadena pesada que tiene una secuencia de aminoácidos como se muestra en SEQ ID NO: 11 y una cadena ligera que tiene una secuencia de aminoácidos como se muestra en SEQ ID NO: 12.

PDF original: ES-2747273_T3.pdf

Mutantes de algas que tienen un fenotipo aclimatado a alta luz bloqueado.

(10/07/2019) Un mutante de algas desregulado en la aclimatación a baja luz, en donde el mutante de algas exhibe al menos una reducción del 20% en clorofila en condiciones de baja luz con respecto a un alga de tipo salvaje de la misma cepa y, además, en donde el mutante de algas: exhibe una mayor extinción fotoquímica (qP) en todas las irradiancias fisiológicamente relevantes por encima de 400 μE·m-2·s-1 con respecto a un alga de tipo salvaje de la misma cepa; exhibe el inicio de la extinción no fotoquímica (NPQ) a una intensidad de luz más alta que la intensidad de la luz a la que ocurre el inicio de la NPQ en un alga de tipo salvaje de la misma cepa; y exhibe una NPQ más baja en todas las irradiancias…

Aumento de los niveles de alcaloides nicotínicos.

(03/07/2019). Solicitante/s: 22nd Century Limited, LLC. Inventor/es: HASHIMOTO,TAKASHI, KAJIKAWA,M.

Procedimiento para incrementar la nicotina en una planta de Nicotiana, que comprende sobreexpresar el gen de A622 y el gen de NBB1 en relación con una planta de control de Nicotiana no transformada, en el que el gen de A622 comprende la secuencia de ácidos nucleicos de SEQ ID NO: 3, o codifica la secuencia de aminoácidos de SEQ ID NO: 4; y el gen de NBB1 comprende la secuencia de ácidos nucleicos de SEQ ID NO: 1 o codifica la secuencia de aminoácidos de SEQ ID NO: 2.

PDF original: ES-2748823_T3.pdf

Un polipéptido de Mormodica Charantia para su uso en la regulación de genes relacionados con la inflamación y el metabolismo de lípidos y de glucosa.

(26/06/2019). Ver ilustración. Solicitante/s: China Medical University. Inventor/es: HO,TIN-YUN, HSIANG,CHIEN-YUN.

Un polipéptido para su uso en una composición farmacéutica para tratar a un sujeto que tiene al menos una enfermedad seleccionada de un grupo que comprende inflamación y reacciones inflamatorias, síndrome metabólico y obesidad, en donde la composición farmacéutica comprende una cantidad efectiva del polipéptido, en donde dicho polipéptido comprende la secuencia de aminoácidos de la SEQ ID No. 1 o una secuencia de aminoácidos homóloga modificada por sustitución, deleción o inserción de uno o varios aminoácidos, en donde dicho polipéptido homólogo comprende una secuencia de aminoácidos que incluye más del 90 % de identidad con la secuencia de la SEQ ID No. 1.

PDF original: ES-2745294_T3.pdf

Expresión modificada de prolil-4-hidroxilasa en physcoitrella patens.

(19/06/2019). Solicitante/s: Albert-Ludwigs-Universität Freiburg. Inventor/es: ALTMANN, FRIEDRICH, RESKI, RALF, PARSONS,JULIANA, GRAF,MANUELA, DECKER,EVA, STADLMANN,JOHANNES.

Un procedimiento de fabricación de una proteína recombinante que comprende los pasos de - proporcionar células de Physcomitrella patens que comprende una ablación de la expresión del gen prolil- 4-hidroxilasa 1 endógeno de la planta de acuerdo con la SEQ ID NO: 1 o que comprende una regulación negativa de la expresión por amiARN u oligonucleótidos antisentido del gen prolil-4-hidroxilasa 1 endógeno de la planta de acuerdo con la SEQ ID NO: 1, - administrar un gen que codifica para la proteína recombinante en dichas células, y - cultivar dichas células para la expresión del gen que codifica para la proteína recombinante.

PDF original: ES-2744993_T3.pdf

Plantas resistentes al glifosato y métodos asociados.

(12/06/2019) Una molécula de ácido nucleico aislada que comprende un polinucleótido que codifica una 5-enolpiruvilshikimato- 3-fosfatasa sintasa (EPSPS) que confiere tolerancia al glifosato a una planta, en donde la EPSPS es al menos el 90% idéntica a la secuencia de aminoácidos de la SEC ID NO: 1 y cuando se alinea con la SEC ID NO: 1 comprende una alanina en la posición correspondiente a la posición 84 de la SEC ID NO: 1, en donde el polinucleótido es una secuencia sintética que ha sido diseñada para la expresión en una planta seleccionada entre el grupo que consiste en: un polinucleótido que comprende una secuencia de nucleótidos que tiene al menos un 80% de identidad de secuencia con la secuencia de nucleótidos SEC ID NO: 2 o SEC ID NO: 3; y un polinucleótido que comprende…

Ácidos nucleicos y polipéptidos de la metiltransferasa.

(12/06/2019). Solicitante/s: Sun Pharmaceutical Industries (Australia) Pty Limited. Inventor/es: GRAHAM, IAN ALEXANDER, WALKER,TRACY CAROL, WINZER,THILO HANS.

Un polipéptido aislado seleccionado de entre el grupo que consiste en: i) un polipéptido de metiltransferasa que comprende o que consiste en una secuencia de aminoácidos como se representa en la figura 4a, 4b o 4c; o ii) un polipéptido modificado que comprende o que consiste en una secuencia de aminoácidos que es al menos un 95 % idéntica a la secuencia de aminoácidos de longitud completa en la figura 4a que ha retenido la actividad de metiltransferasa; o iii) un polipéptido modificado que comprende o que consiste en una secuencia de aminoácidos que es al menos un 95 % idéntica a la secuencia de aminoácidos de longitud completa en la figura 4b que ha retenido la actividad de metiltransferasa; o iv) un polipéptido modificado que comprende o que consiste en una secuencia de aminoácidos que es al menos un 95 % idéntica a la secuencia de aminoácidos de longitud completa en la figura 4c que ha retenido la actividad de metiltransferasa.

PDF original: ES-2742755_T3.pdf

Secuencia de nucleótidos aislada de Solanum lycopersicum para una resistencia mejorada al virus del bronceado del tomate, TSWV.

(15/05/2019). Solicitante/s: Isi Sementi S.p.A. Inventor/es: BELFANTI,ENRICO, MALATRASI,MARINA, ORSI,ILARIA, BONI,ANNA GIULIA.

Secuencia de nucleótidos aislada que comprende la SEC ID nº: 1, o que comprende secuencias complementarias de la misma.

PDF original: ES-2738850_T3.pdf

Proteínas que tienen actividad nucleasa, proteínas de fusión y usos de estas.

(15/04/2019) Una molécula de ácido nucleico que codifica (I) un polipéptido que tiene la actividad de una endonucleasa, que es (a) una molécula de ácido nucleico que codifica un polipéptido que consiste en la secuencia de aminoácidos de la sec. con núm. de ident.:1; (b) una molécula de ácido nucleico que consiste en la secuencia de nucleótidos de la sec. con núm. de ident.: 2; (c) una molécula de ácido nucleico que codifica una endonucleasa, cuya secuencia de aminoácidos es al menos 70 % idéntica a la secuencia de aminoácidos de la sec. con núm. de ident.:1; (d) una molécula de ácido nucleico que consiste en una secuencia de nucleótidos que es al menos 50 % idéntica a la secuencia de nucleótidos de la sec. con núm. de ident.: 2; (e) una molécula de ácido nucleico que es degenerada con respecto a la molécula de ácido nucleico…

Tratamiento enzimático de alimentos para celíacos.

(01/04/2019). Solicitante/s: THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIOR UNIVERSITY. Inventor/es: KHOSLA, CHAITAN, HAUSCH,Felix, GRAY,Gary, SHAN,Lu.

Una preparación que comprende una prolil endopeptidasa (PEP) que es capaz de atenuar la toxicidad del gluten, para usar en un método para mejorar la digestión del gluten y reducir los efectos nocivos de un péptido largo del gluten, incluido el oligopéptido establecido en la SEQ ID NO: 12 en un sujeto que no sabe que tiene celiaquía mediante la administración de dicha preparación a dicho sujeto.

PDF original: ES-2706911_T3.pdf

Métodos de modulación del tamaño de la semilla y de los órganos de plantas.

(29/03/2019). Solicitante/s: Institute Of Genetics And Developmental Biology. Inventor/es: XIA,TIAN, LI,YUNHAI, LI,NA, DUMENIL,JACK, BEVAN,MICHAEL.

Un método de incremento de la masa de semillas por unidad de área, crecimiento y/o biomasa de una planta, que comprende; reducir la expresión o la actividad de un polipéptido DA2 dentro de las células de dicha planta, en donde el polipéptido DA2 comprende un dominio RING de SEQ ID NO: 2 y la planta tiene DA1 reducida o expresión o actividad de DA1 y EOD2 reducidas, en donde la expresión o la actividad del polipéptido DA2 se reduce (a) introduciendo una mutación en la secuencia de nucleótidos de la célula vegetal que codifica el polipéptido DA2 o que regula su expresión y regenerando la planta a partir de la célula mutada; o (b) incorporando un ácido nucleico heterólogo que expresa un ácido nucleico supresor que reduce la expresión del polipéptido DA2 en dicha célula vegetal.

PDF original: ES-2706499_T3.pdf

Gen de resistencia frente a rizomanía.

(06/03/2019) Molécula de ácido nucleico, que codifica un polipéptido, que está en disposición de otorgar una resistencia frente a un patógeno en una planta en la que se expresa el polipéptido, caracterizada por que la molécula de ácido nucleico comprende una secuencia de nucleótidos que está seleccionada de a) una secuencia de nucleótidos que codifica un polipéptido con una secuencia de aminoácidos de acuerdo con la SEQ ID NO: 2 o la SEQ ID NO: 3, b) una secuencia de nucleótidos que comprende la secuencia codificante de la secuencia de ADN de acuerdo con la SEQ ID NO: 1, c) una secuencia de nucleótidos que codifica un polipéptido que se deriva por sustitución, deleción y/o adición de un aminoácido de la secuencia de aminoácidos que se codifica por la secuencia de nucleótidos de acuerdo con a) o b), de un polipéptido que se codifica por la secuencia…

Genes que proporcionan resistencia al oídio en Cucumis melo.

(01/03/2019). Solicitante/s: ENZA ZADEN BEHEER B.V. Inventor/es: DIERGAARDE,PAUL JOHAN, PRINS,MARINUS WILLEM, VAN ENCKEVORT,LEONORA JOHANNA GERTRUDA, POSTHUMA,KARIN INGEBORG.

Planta de Cucumis melo que comprende en su genoma un gen alterado que confiere resistencia al oídio, mostrándose la secuencia de aminoácidos codificada por dicho gen que confiere resistencia en la SEQ ID No. 2; donde - dicha alteración es una o más mutaciones en dicho gen que da como resultado la ausencia de un producto de expresión de proteínas; o - dicha alteración es una o más mutaciones en dicho gen que da como resultado un producto de expresión de proteínas no funcional; y en donde dicha alteración proporciona resistencia al oídio y dicha planta de Cucumis melo no se obtiene exclusivamente por un proceso esencialmente biológico.

PDF original: ES-2702562_T3.pdf

Promotores de la soja constitutivos.

(28/02/2019). Solicitante/s: BAYER CROPSCIENCE LP. Inventor/es: ZHANG,SHIRONG.

Un casete de expresión que comprende una molécula de ácido nucleico que comprende una secuencia nucleotídica seleccionada del grupo que consiste en: (a) la secuencia nucleotídica expuesta en la SEQ ID NO: 2; (b) una secuencia nucleotídica que comprende al menos 50 nucleótidos contiguos de la secuencia expuesta en la SEQ ID NO: 2, en la que dicha secuencia inicia la transcripción constitutiva en una célula vegetal; y (c) una secuencia nucleotídica que tiene al menos 95 % de identidad de secuencia con la secuencia expuesta en la SEQ ID NO: 2, en la que dicha secuencia inicia la transcripción constitutiva en una célula vegetal.

PDF original: ES-2702289_T3.pdf

Uso de proteasas aspárticas vegetales para el tratamiento de afecciones de la piel.

(28/02/2019). Solicitante/s: Biocant - Associação De Transferência De Tecnologia. Inventor/es: ALMEIDA,CARLA SOFIA GOMES MALAQUIAS DE, SIMÕES,ISAURA ISABEL GONÇALVES, FARO,CARLOS JOSÉ FIALHO COSTA.

Una proteasa aspartica vegetal para su uso en un metodo para el tratamiento del cuerpo humano o animal por terapia, en donde el metodo implica la induccion de descamacion cutanea, y en donde la proteasa aspartica vegetal es una Cardosina o un mutante de la misma, en donde la proteasa aspartica vegetal tiene al menos un 70 % de identidad de secuencia con la SEQ ID NO: 1 o la SEQ ID NO: 2.

PDF original: ES-2702358_T3.pdf

Nuevo promotor preferente en fibras en algodón.

(21/02/2019). Solicitante/s: BASF Agricultural Solutions Seed US LLC. Inventor/es: MEULEWAETER,FRANK, LLEWELLYN,DANNY J.

Un ácido nucleico que comprende una secuencia nucleotídica seleccionada del grupo de (a) al menos 700 nucleótidos consecutivos de la secuencia nucleotídica indicada como SEQ ID NO: 1; (b) la secuencia nucleotídica de SEQ ID No. 1 desde el nucleótido en la posición 1 hasta el nucleótido en la posición 922; (c) una secuencia nucleotídica que tiene al menos 95% de identidad de secuencia con la secuencia de ácido nucleico de (a) o (b); y en donde el ácido nucleico tiene actividad promotora preferente en fibras en algodón entre 15 y 35 días después de la antesis (dpa) y no se expresa en fibras de 10 dpa, y en donde dicho ácido nucleico que tiene actividad promotora preferente en fibras no tiene más de 959 nucleótidos de longitud.

PDF original: ES-2701243_T3.pdf

Procedimiento para aumentar la biomasa vegetal.

(06/02/2019). Solicitante/s: BioMass Booster, S.L. Inventor/es: MARTINEZ RAMIREZ,Alfredo, ARENAS VIDAL,JORGE CONRADO.

Un procedimiento para aumentar la biomasa de un organismo fotosintético que comprende cultivar dicho organismo fotosintético en presencia de un péptido que comprende: i. la secuencia de aminoácidos que se muestra en la SEQ ID NO: 3; o ii. Una variante funcional del péptido definido en (i), en el que dicha variante es un péptido cuya secuencia de aminoácidos tiene un grado de identidad con respecto a la secuencia de aminoácidos que se muestra en la SEQ ID NO: 3 de al menos el 70 % y mantiene su capacidad para aumentar la biomasa de un organismo fotosintético, y en el que dicha variante comprende la secuencia de aminoácidos Cys-Xaa1-Xaa2-Xaa3-Xaa4-Cys [SEQ ID NO 1] en la que Xaa1, Xaa2, Xaa3 y Xaa4, representan independientemente un aminoácido, y los restos de cisteína de la secuencia de aminoácidos que se muestra en la SEQ ID NO: 1 forman un puente disulfuro entre ellos, en el que dicho péptido está presente en una concentración entre 10-8 M y 10-16 M.

PDF original: ES-2698835_T3.pdf

Aumento de la recombinación meiótica en plantas por la inhibición de la proteína FIDG.

(06/02/2019). Solicitante/s: INSTITUT NATIONAL DE LA RECHERCHE AGRONOMIQUE. Inventor/es: MERCIER,RAPHAEL, GIRARD,CHLOÉ, CRISMANI,WAYNE.

Procedimiento para aumentar la frecuencia de CO meióticos en una planta, caracterizado porque comprende la inhibición en dicha planta de una proteína denominada de aquí en adelante FIDG, teniendo dicha proteína al menos un 45 % de identidad de secuencia, o al menos un 60 % de similitud de secuencia, con la proteína AtFIDG de secuencia SEQ ID NO: 1, estando calculados dichos porcentajes con la ayuda del algoritmo Needle EMBOSS usando parámetros por defecto para el cálculo de identidad y la matriz BLOSUM62 para el cálculo de similitud, y que contiene un dominio AAA-ATPasa y un dominio VSP4, catalogados respectivamente con las referencias PFAM PF00004 y PF09336.

PDF original: ES-2698971_T3.pdf

Transportador de vacuna.

(05/02/2019). Solicitante/s: BIOMAY AG. Inventor/es: VALENTA, RUDOLF, VRTALA, SUSANNE, VALENT, PETER, WESTRITSCHNIG, KERSTIN, LINHART,BIRGIT, SPITZAUER,SUSANNE, SWOBODA,INES, GRONLUND,HANS, FOCKE-TEJKL,MARGARETE, REININGER,RENATE, VAN HAGE,MARIANNE, TINHOFER,JOHANNA, POPOW-KRAUPP,THERESIA.

Una molécula hipoalergénica derivada de PhI p 5 y que consiste en la secuencia de aminoácidos GAASNKAFAEGLSGEPKGAAESSSKAALTSK, ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGK o TVATAPEVKYTVFETALKKAITAMSEAQKAAK.

PDF original: ES-2698525_T3.pdf

Reducción de metales pesados en plantas.

(31/01/2019) Un vector de expresión para inhibir la traducción de ARNm de NtMRP4 cuando se expresa en una planta de tabaco, que comprende un promotor unido operativamente a: (a) un polinucleótido, la secuencia del polinucleótido que consiste de cualquiera de secs. con núms. de ident.: 13- 23 o 53, ubicadas en orientación antisentido con respecto al promotor; o (b) un constructo de polinucleótidos de 15 a 100 nucleótidos de longitud que es al menos 80 % idéntico a una región de sec. con núm. de ident.: 1, ubicado en orientación antisentido con respecto al promotor; o (c) un polinucleótido que codifica un polinucleótido de ARNi capaz de autoaparearse para formar una estructura de horquilla que comprende: una primera secuencia de 15 a 300 nucleótidos que tiene al menos…

Genes que proporcionan resistencia al mildiú pulverulento en Cucumis Sativus.

(30/01/2019). Solicitante/s: ENZA ZADEN BEHEER B.V. Inventor/es: DIERGAARDE,PAUL JOHAN, PRINS,MARINUS WILLEM, VAN ENCKEVORT,LEONORA JOHANNA GERTRUDA, POSTHUMA,KARIN INGEBORG.

Planta de Cucumis sativus que comprende en su genoma un gen que confiere resistencia al mildiú pulverulento deteriorado; la secuencia de aminoácidos codificada por dicho gen que confiere resistencia se muestra en la SEQ ID Nº 2; donde: - dicho deterioro es una o más mutaciones en dicho gen que resulta en la ausencia de un producto de expresión de proteína; o - dicho deterioro es una o más mutaciones en dicho gen que resulta en un producto de expresión de proteínas no funcional; y en el que dicha deficiencia proporciona resistencia al mildiú pulverulento y dicha planta de Cucumis sativus no se obtiene exclusivamente por un proceso esencialmente biológico.

PDF original: ES-2698002_T3.pdf

Plantas tolerantes a la sequía.

(05/12/2018). Solicitante/s: The State of Queensland acting through The Department of Agriculture and Fisheries. Inventor/es: BORRELL,ANDREW KENNNETH, JORDAN,DAVID ROBERT, MULLET,JOHN, KLEIN,PATRICIA.

Un método para generar una planta genéticamente modificada que usa agua de forma más eficaz que una planta no modificada genéticamente de la misma especie, comprendiendo el método la introducción mediante ingeniería genética usando medios recombinantes de material genético que codifica una proteína SbPIN4 para conferir un fenotipo de permanencia verde, cuyo fenotipo incluye un cambio en el uso de agua al período de post-antesis o accesibilidad aumentada de agua durante el crecimiento de la cosecha o eficacia de transpiración aumentada resultando en un índice de cosecha aumentado y rendimiento de grano en condiciones con agua limitada, en donde dicha proteína SbPIN4 está codificada por el ID del Gen de Sorgo Sb03g037350 desde pb 65310051 a pb 65313194.

PDF original: ES-2692857_T3.pdf

Péptidos y composiciones para la prevención de la adhesión celular y métodos de uso de los mismos.

(20/11/2018). Solicitante/s: Tel Hashomer Medical Research, Infrastructure And Services Ltd. Inventor/es: ZLOTKIN,AMIR, KESTENBOIM,HEN.

Una composición que comprende un péptido que comprende una secuencia seleccionada del grupo que consiste en YDYNLY, FDYNFY, FDYNLY, WDYNLY, FDYNWY, YDWNLY y YDWHLY, en donde dicho péptido comprende hasta 50 aminoácidos, y en donde la composición está desprovista de actividad citotóxica y citostática.

PDF original: ES-2690348_T3.pdf

Antígeno de gliadina desamidada recombinante.

(31/10/2018). Solicitante/s: BIO-RAD LABORATORIES, INC.. Inventor/es: SHAN,DAMING, WALKER,ROGER, LU,YABIN, DESAI,URVEE.

Un antígeno para detectar la enfermedad celíaca que comprende una proteína gliadina desamidada recombinante o sintética que comprende un hexámero de péptidos, en el que cada péptido tiene la secuencia de SEQ ID NO: 1.

PDF original: ES-2688268_T3.pdf

Hipoalergénicos.

(09/10/2018). Solicitante/s: Desentum Oy. Inventor/es: LAUKKANEN, MARJA-LEENA, SODERLUND, HANS, TAKKINEN,KRISTIINA, JYLHÄ,SIRPA, NIEMI,MERJA, ROUVINEN,JUHA, HOLKERI,HEIDI, JÄNIS,JANNE.

Un polipéptido Bet v 1 recombinante hipoalergénico del polen de abedul basado en una matriz de secuencia de aminoácidos de tipo silvestre como se representa en la SEQ ID NO: 3 o de cualquier otra isoforma de Bet v 1 de tipo silvestre del mismo seleccionado de entre el grupo que consiste en las SEQ ID NO: 4-38, comprendiendo dicho polipéptido una primera sustitución de aminoácidos en una posición del resto de aminoácido E101, en el que la primera sustitución de aminoácidos es E101K, y una segunda sustitución de aminoácidos en una posición del resto de aminoácido N28, en el que la segunda sustitución de aminoácidos es N28K.

PDF original: ES-2685478_T3.pdf

Método de recuperación de proteínas derivadas de plantas.

(18/09/2018). Solicitante/s: MEDICAGO INC.. Inventor/es: VEZINA, LOUIS-PHILIPPE, COUTURE,MANON, PAQUET,DANY.

Un método de recuperación de partículas pseudovíricas (VLP) o supraestructuras de proteínas de una planta o materia vegetal, que comprende: a. obtener la planta o materia vegetal que comprende VLP localizadas en apoplasto o supraestructuras de proteínas localizadas en apoplasto, teniendo las supraestructuras de proteínas localizadas en apoplasto un peso molecular de 75 a 1500 kDa; b. tratar la planta o materia vegetal con una composición que comprende EDTA o EGTA de 20 a 250 mM, para aflojar la pared celular para producir una planta o materia vegetal que tenga una pared celular aflojada para obtener una mezcla de incubación de planta, y separar la mezcla de incubación de planta para producir una fracción de células vegetales y una fracción apoplásica; y c. recuperar las VLP o las supraestructuras de proteínas de la fracción apoplásica.

PDF original: ES-2682066_T3.pdf

Mutantes de algas que tienen un fenotipo aclimatado a la luz intensa en compartimentos.

(25/07/2018) Un mutante de algas desrregulado en aclimatación a poca luz, en donde el mutante de algas exhibe al menos una reducción del 20% en clorofila en condiciones de poca luz con respecto a un alga de tipo salvaje de la misma cepa y además en el que el mutante de algas: exhibe un mayor inactivación fotoquímica (qP) a todas las irradiancias fisiológicamente relevantes por encima de 400 μE·m-2·s-1 con respecto a un alga de tipo silvestre de la misma cepa; exhibe un inicio de inactivación no fotoquímica (NPQ) a una intensidad de luz más alta que la intensidad de luz a la cual aparece NPQ en un alga de tipo salvaje de la misma cepa y exhibe un NPQ más bajo en todas las irradiancias fisiológicas…

Secuencia de nucleótidos que codifica la proteína homeobox4 relacionada con wuschel (WOX4) de corchorus olitorius y corchorus capsularis y métodos de uso de los mismos.

(16/05/2018). Solicitante/s: Bangladesh Jute Research Institute. Inventor/es: ALAM,MAQSUDUL, HAQUE,MOHAMMED SAMIUL, ISLAM,MOHAMMED SHAHIDUL, ALAM,MOHAMMED MONJURUL, AHMED,BORHAN.

Un polinucleótido aislado que codifica un polipéptido homebox4 relacionado con WUSCHEL derivado de la planta C. olitorius o C. capsularis, que comprende una molécula de ácido nucleico seleccionada del grupo que consiste de: a) una molécula de ácido nucleico que comprende una secuencia de nucleótidos establecida en la SEQ ID NO 2 o SEQ ID NO: 5, o un complemento de la misma; y b) una molécula de ácido nucleico que comprende una secuencia de nucleótidos que tiene por lo menos 95% de identidad de secuencia a la secuencia de nucleótidos establecida en la SEQ ID NO: 2 o SEQ ID NO: 5, o un complemento de la misma.

PDF original: ES-2672349_T3.pdf

Derivados de bouvardina y usos terapéuticos de los mismos.

(11/04/2018). Solicitante/s: The Regents of the University of Colorado, a body corporate. Inventor/es: ZHANG, GAN, SU,TIN TIN, GLADSTONE,MARA N, SAMMAKIA,TAREK.

Un compuesto de fórmula I o una sal farmacéuticamente aceptable del mismo: **(Ver fórmula)** en la que: R1 se selecciona de un grupo que consiste en halógeno, hidroxilo, alquilo C1-C8, haloalquilo C1-C8, heteroalquilo, cicloalquilo C3-C8, amino y ciano; R2, R3, R3a y R3b se seleccionan independientemente del grupo que consiste en hidrógeno, halógeno, hidroxilo, alquilo C1-8, haloalquilo C1-8, heteroalquilo, cicloalquilo C3-8, amino y ciano; R4 es hidrógeno; R5, R6 y R7 son cada uno metilo; R8, R9, R10, R11, R12 y R13 se seleccionan independientemente del grupo que consiste en hidrógeno, alquilo C1-8, heteroalquilo, arilo, heteroarilo, haloalquilo C1-8 y cicloalquilo C3-8.

PDF original: ES-2668044_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · 9 · 10 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .