Vectores y construcciones de liberación de antígenos de virus de la gripe.

Una construcción de vector fluorocarbonado-antígeno de estructura CmFN--CyHx-(Sp)-R,

donde m = 3 a 30, n <= 2m + 1, y = 0 a 15, x <= 2y, (m + y) = 3-30, Sp es un resto espaciador químico opcional y R es un péptido del virus de la gripe inmunogénico seleccionado de:

DQVRESRNPGNAEIEDLIFLARSALILRGSVAHKS (SEQ ID NO: 32)

DLEALMEWLKTRPILSPLTKGILGFVFTLTVPSER (SEQ ID NO: 35)

VAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQG (SEQ ID NO: 4)

YITRNQPEWFRNVLSIAPIMFSNKMARLGKGYMFE (SEQ ID NO: 17)

APIMFSNKMARLGKGYMFESKRMKLRTQIPAEMLA (SEQ ID NO: 18)

SPGMMMGMFNMLSTVLGVSILNLGQKKYTKTTY (SEQ ID NO: 19)

KKKSYINKTGTFEFTSFFYRYGFVANFSMELPSFG (SEQ ID NO: 20)

y homólogos de los mismos que tiene al menos 90 % de identidad con las SEQ ID NO: 32, 35, 4, 17, 18, 19 o 20.

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E14160760.

Solicitante: ALTIMMUNE UK LIMITED.

Inventor/es: BONNET, DOMINIQUE, GEORGES,BERTRAND, BROWN,CARLTON B, SIZER,PHILIP J.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • A61K39/145 SECCION A — NECESIDADES CORRIENTES DE LA VIDA.A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D). › A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53). › Orthomyxoviridae, p. ej. virus de la influenza.
  • A61K39/21 A61K 39/00 […] › Retroviridae, p. ej. virus de la anemia infecciosa equina.
  • A61K39/385 A61K 39/00 […] › Haptenos o antígenos, unidos a soportes.
  • A61K47/48 A61K […] › A61K 47/00 Preparaciones medicinales caracterizadas por los ingredientes no activos utilizados, p. ej. portadores, aditivos inertes. › estando el ingrediente no activo químicamente unido al ingrediente activo, p. ej. conjugados polímero-medicamento.
  • C07K14/16 SECCION C — QUIMICA; METALURGIA.C07 QUIMICA ORGANICA.C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00). › C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados. › VIH-1.

PDF original: ES-2741729_T3.pdf

 

Patentes similares o relacionadas:

Composiciones y métodos para la liberación dirigida de fármacos in vitro e in vivo a células de mamíferos mediante minicélulas intactas derivadas de bacterias, del 23 de Octubre de 2019, de ENGENEIC MOLECULAR DELIVERY PTY LTD: Una composición que comprende: (a) una pluralidad de minicélulas intactas derivadas de bacterias que tienen paredes celulares intactas, en donde la pluralidad […]

Moléculas con semividas prolongadas, composiciones y usos de las mismas, del 16 de Octubre de 2019, de MEDIMMUNE, LLC: Una molécula modificada que comprende una proteína o agente no de proteína y un dominio constante de IgG, en la que el dominio constante de IgG comprende un dominio CH3 humano […]

Método para la preparación de oligo etilenglicol monodisperso, del 19 de Junio de 2019, de NEKTAR THERAPEUTICS: Un método para preparar un oligo (etilenglicol) monodisperso, comprendiendo dicho método: (i) hacer reaccionar un oligo (etilenglicol) terminado […]

Construcciones de moléculas MHC y sus usos para el diagnóstico y terapia, del 29 de Mayo de 2019, de DAKO DENMARK A/S: Una construcción de moléculas MHC en forma soluble en un medio de solubilización o inmovilizada en un soporte sólido o semi-sólido, comprendiendo dicha construcción de moléculas […]

Usos terapéuticos de anticuerpos monoclonales frente al receptor de la angiotensina II tipo 1, del 17 de Mayo de 2019, de QUEEN MARY AND WESTFIELD COLLEGE: Un anticuerpo monoclonal o un fragmento del mismo que se une al péptido que consiste en la secuencia EDGIKRIQDD para su uso en el tratamiento de la proliferación […]

Profármaco polimérico con un enlazador autoinmolador, del 15 de Mayo de 2019, de Ascendis Pharma GmbH: Un profármaco polimérico en cascada que comprende: - una amina que contiene una unidad estructural biológicamente activa; - un grupo de enmascaramiento […]

Derivados poliméricos, del 8 de Mayo de 2019, de AMBRX, INC: El uso o utilización de un compuesto soluble en agua que comprende un polímero y al menos una fracción de acetileno para la modificación selectiva de […]

CONJUGADOS DE ANTIGENO-NANOPARTÍCULA DE CARBOHDRATOS Y USOS DE LOS MISMOS COMO AGENTES ANTIMETASTÁSICOS EN EL TRATAMIENTO DE CÁNCER, del 24 de Febrero de 2012, de THE GOVERNMENT OF THE UNITED STATES OF AMERICA, AS REPRESENTED BY THE SECRETARY, DEPARTMENT OF HEAL THE RESEARCH FOUNDATION OF STATE UNIVERSITY OF NEW YORK: Un procedimiento de preparación de conjugados antígeno-nanopartícula, que comprende: proporcionar una nanopartícula; y conjugar varios antígenos de carbohidrato […]

Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .