Inventos patentados en España.

Inventos patentados en España.

Inventos patentados en España en los últimos 80 años. Clasificación Internacional de Patentes CIP 2013.

VACUNAS CONTRA EL VHC.

Patente Internacional (Tratado de Cooperación de Patentes). Resumen: Vacuna contra el virus de la hepatitis C (VHC) que comprende al menos los tres péptidos siguientes: a) AYAAQGYKVLVLNPSVAAT o una parte del mismo que contiene al menos un epítopo y b) GEVQVVSTATQSFLATCINGVCWTV o una parte del mismo que contiene al menos un epítopo y c) HMWNFISGIQYLAGLSTLPGNPA o una parte del mismo que contiene al menos un epítopo.

Solicitante: INTERCELL AG.

Nacionalidad solicitante: Austria.

Dirección: CAMPUS VIENNA BIOCENTER 6 1030 VIENNA AUSTRIA.

Inventor/es: ZAUNER, WOLFGANG, BUSCHLE, MICHAEL, KLADE, CHRISTOPH, ZETTLMEISSL, GERD, DR., LINGNAU, KAREN, FRISCH,JURGEN.

Fecha de Publicación de la Concesión: 17 de Marzo de 2011.

Fecha Solicitud PCT: 9 de Julio de 2004.

Clasificación PCT: C07K14/18 (...Togaviridae, p. ej. Flavivirus, virus de la peste, virus de la fiebre amarilla, virus de la hepatitis C, virus de la encefalitis japonesa [6]), A61K39/29 (..Virus de la hepatitis [3]).

Clasificación antigua: C07K14/18 (...Togaviridae, p. ej. Flavivirus, virus de la peste, virus de la fiebre amarilla, virus de la hepatitis C, virus de la encefalitis japonesa [6]), A61K39/29 (..Virus de la hepatitis [3]).

Países PCT: Austria, Bélgica, Suiza, Alemania, Dinamarca, España, Francia, Reino Unido, Grecia, Italia, Liechtensein, Luxemburgo, Países Bajos, Suecia, Mónaco, Portugal, Irlanda, Eslovenia, Finlandia, Rumania, Chipre, Lituania, Letonia, Ex República Yugoslava de Macedonia, Albania.

Volver al resumen de la patente.

VACUNAS CONTRA EL VHC.
Descripción:

La presente invención se refiere a vacunas contra el VHC.

El sistema inmunitario es una compleja red de tipos de células y moléculas interrelacionadas, que se ha desarrollado para proteger organismos multicelulares de microorganismos infecciosos. Se puede dividir en inmunidad innata (o natural) en personas mayores evolutiva e inmunidad adaptativa (o adquirida). El sistema 5 inmunitario innato reconoce patrones, que son normalmente comunes y esenciales para los patógenos. Para este número limitado de estructuras moleculares se han desarrollado receptores codificados de la línea germinal. En comparación, las células del sistema inmunitario adaptativo - linfocitos B y T - pueden reconocer una enorme variedad de estructuras antigénicas. Los receptores, denominados según los tipos de células que los expresan, receptor de linfocitos B (BCR, sus versiones solubles se denominan anticuerpos) y receptor de linfocitos T (TCR, 10 sólo formas asociadas a la celular), 27, son generados por recombinación somática y muestran una distribución clonal. Así, inicialmente sólo hay un número pequeño de células con una cierta especificidad. Cuando el antígeno se encuentra con estas células empieza a dividirse (expansión clonal) para generar una población efectora capaz de hacer frente al antígeno. Después de la eliminación de antígeno una subpoblación especializada de células que reconoce específicamente este antígeno permanece como memoria inmunológica. Tomados juntos el sistema 15 inmunitario adaptativo está retardado (comparado con la inmunidad innata), sin embargo es específico y mejora con la exposición repetida a un patógeno/antígeno dado.

Los linfocitos T presentan un papel central en la inmunidad adaptativa. Sus receptores (los TCR) reconocen “complejo principal de histocompatibilidad” (MHC o HLA): complejos peptídicos en la superficie de las células. Estos péptidos se denominan epítopos de linfocitos T y representan productos de degradación de antígenos. Hay dos 20 clases principales de linfocitos T: los linfocitos T citotóxicos positivos CD8 (CTL) están restringidos al MHC de clase I. Los linfocitos T auxiliares (HTL) positivos CD4 están restringidos al MHC de clase II. Los HTL son esenciales para muchas características de inmunidad adaptativa: activación de las denominadas “células que presentan antígeno profesional” (las APC), conmutación de clase de inmunoglobulina (Ig), la reacción del centro germinal y maduración de la afinidad Ig, activación de CTL, memoria inmunológica, regulación de la respuesta inmunitaria y otras. 25

Las moléculas MHC recogen péptidos dentro de la célula y los presentan en la superficie de las células en los TCR de los linfocitos T. Hay dos clases principales de MHC, la clase I reconocida por CTL positivos CD8 y la clase II reconocida por HTL positivos CD4.

Las moléculas de MHC de clase I constan de una cadena alfa anclada en la membrana de 45 kDa y la b2-inmunoglobulina unida mediante enlaces no covalentes (b2m) de 12 kDa. La resolución de la estructura 30 tridimensional por cristalografía de rayos X (Stern and Wiley 1.994) revela que la cadena alfa posee una hendidura, que está cerrada en ambos extremos y tiene cabida para péptidos de 8 a 11 aminoácidos de longitud. Las moléculas de clase I se expresan de manera ubicua y los péptidos que presentan se originan de proteínas citoplasmáticas. Estas son degradadas por el proteosoma y los péptidos resultantes son transportados de manera activa al retículo endoplasmático (RE). Allí, con la ayuda de diversas carabinas, se forman complejos MHC:péptido y son 35 transportados a la superficie de las células (Heemels 1.995). Así, la clase I MHC se enfrenta al proteoma de una célula en su superficie y permite que los linfocitos T reconozcan patógenos intracelulares o células malignas.

Las moléculas de MHC de clase II constan de dos proteínas ancladas en la membrana (cadena alfa y beta) de 35 kDa y 30 kDa, respectivamente. Estas forman juntas una hendidura, abierta en ambos extremos, que puede tener cabida para péptidos de longitud variable, normalmente de 12 a 25 aminoácidos. A pesar de estas diferencias, las 40 moléculas de clase I y II poseen en común una similitud estructural sorprendente (Stern and Wiley 1.994). Las moléculas de clase II sólo se expresan en células dendríticas (DC) incluyendo APC profesional, linfocitos B y macrófagos/monocitos. Estas células están especializadas en absorber y tratar antígenos en la ruta endosómica. Inmediatamente después de su biosíntesis, las moléculas de clase II se complejan por la denominada cadena invariante (li), que evita la unión de péptidos en el RE. Cuando las vesículas que contienen complejos de clase II:li 45 se fusionan con productos de degradación que contienen endosomas, de antígeno exógeno, se degrada li hasta que la hendidura que une MHC sólo se compleja por el denominado péptido CLIP. Lo último es con ayuda de carabinas como HLA-DM intercambiado por péptidos antigénicos (Villadangos 2.000). Finalmente, los complejos MHC:péptido se presentan de nuevo en la superficie de las APC, que interactúan de numerosas formas con HTL.

Siendo tanto poligénico como extremadamente polimórfico, el sistema MHC es muy complejo. Para la cadena alfa 50 de clase I en seres humanos hay tres locus del gen denominados HLA-A, -B y –C. Igualmente, hay tres locus de cadena alfa de clase II (DRA, DQA, DPA); para los locus de cadena beta de clase II la situación es incluso más compleja ya que hay cuatro cadenas beta DR diferentes (DRB1,2,3,5) más DQB y DPB. Excepto DRA de cadena alfa de DR monomórfico, cada locus de genes está presente en muchos alelos diferentes (docenas a cientos) en la población (Klein 1.986). Los diferentes alelos presentan especificidades de unión en gran parte distintas para 55 péptidos. Los alelos se designan, por ejemplo, HLA-A*0201 o HLA-DRB1*0401 o HLA-DPA*0101/DPB*0401.

Se han identificado epítopos de linfocitos T por una variedad de propuestas (Van den Eynde 1.997). Se han usado por ejemplo líneas de linfocitos T y clones para cribar bibliotecas de expresión de ADNc por ejemplo en el contexto de células COS transinfectadas con la apropiada molécula HLA. Alternativamente, se han perseguido propuestas bioquímicas. Lo último implicaba la elución de ligandos naturales a partir de moléculas de MHC en la superficie de células diana, la separación de estos péptidos por diversas etapas cromatográficas, análisis de su 5 reactividad con linfocitos en ensayos de reconstitución de epítopos y secuenciación por espectrometría de masas (Wölfel et al., 1.994, Cox et al. 1.994).

Recientemente, la llegada de ensayos de detección de citocinas altamente sensibles como el ELIspot de IFN-gamma permitió usar linfocitos directamente ex vivo para el cribado de péptidos sintéticos superpuestos (Maecker 2.001, Kern 2.000, Tobery 2.001). Principalmente, Kern et al. (1.999 y 2.000) usaron series de conjuntos de péptidos 10 9meros superpuestos para mapear epítopos de linfocitos T CD8+ in vitro. Más tarde, Tobery et al. 2.001 modificaron esta propuesta y demostraron que se pueden usar conjuntos que contengan tantos como 64 péptidos 20meros para cribar epítopos de linfocitos T tanto CD8+ como CD4+ en ratones. Estos dos procedimientos estaban basados en el control de la respuesta específica del antígeno por medición de producción de IFN-gamma o por coloración intracelular (Kern et al 2.000) o en ensayo ELIspot (Tobery et al. 2.001). Mediante el uso de mezclas de 15-meros 15 las respuestas de los linfocitos T CD4+ son aproximadamente iguales a las detectadas cuando se usaba proteína soluble completa como antígeno, mientras que - no sorprendentemente - las respuestas de los linfocitos T CD8+ son significativamente mayores que las respuestas con frecuencia insignificantes detectadas con estimulación de proteínas solubles. Además, las respuestas de los linfocitos T CD8+ para una mezcla de péptidos de 15 aminoácidos son similares a las obtenidas con una mezcla de péptidos de 8-12 aminoácidos, seleccionados para 20 representar epítopos mínimos de MHC clase I conocidos. Lo más probablemente las peptidasas asociadas a la membrana celular son responsables de “cortar” los péptidos a la longitud óptima en estas circunstancias (Maecker et al. 2.001).

Una alternativa interesante es cribar bibliotecas combinatorias de péptidos sintéticos con linfocitos específicos. Por ejemplo, una biblioteca de decapéptidos que consta de 200 mezclas dispuestas en un formato de barrido 25 posicional, se ha usado con éxito para la identificación de ligandos peptídicos que estimulen poblaciones clonotípicas de linfocitos T (Wilson, et al., J. Immunol., 1.999, 163: 6.424-6.434).

Se han identificado muchos epítopos de linfocitos T por el denominado “Reverse immunological approaches” Rammensee 1.999). En este caso la proteína que da lugar a un epítopo de linfocitos T potencial es conocida y se barren en su principal secuencia restos de unión a HLA. Típicamente, se sintetizan de docenas a cientos de péptidos 30 candidatos o incluso se sintetiza una serie completa de péptidos superpuestos y se ensaya su unión a moléculas HLA. Normalmente, se seleccionan los mejores aglutinantes para caracterización adicional con respecto a su reactividad con linfocitos T. Esto se puede hacer por ejemplo por imprimación de linfocitos T in vitro o in vivo con ayuda de ratones transgénicos HLA.

El Virus de la Hepatitis C (VHC) es un miembro de la familia flaviviridiae, que infecta crónicamente a 35 aproximadamente 170 millones de personas en el mundo. Hay al menos 6 genotipos de VHC y se han descrito más de 50 subtipos. En América, Europa y Japón los genotipos 1, 2 y 3 son los más comunes. La distribución geográfica de los genotipos VHC varía enormemente siendo predominante en USA y partes del Oeste de Europa el genotipo 1a, mientras que el 1b predomina en el Sur y Centro de Europa (Bellentani 2.000).

El VHC se transmite por la ruta parenteral o percutánea y se replica en los hepatocitos. Aproximadamente el 15% 40 de los pacientes padece hepatitis autolimitada aguda asociada a la eliminación y recuperación vírica. Aproximadamente el 80% de las personas infectadas llegan a ser portadores crónicos. La infección persiste asintomáticamente con frecuencia con evolución retardada durante años, sin embargo por último el VHC es una causa principal de cirrosis, enfermedad hepática terminal y cáncer de hígado (Liang, 2.000). La concentración y la calidad de las respuestas tanto de HTL como CTL determinan si los pacientes se recuperan (espontáneamente o 45 como consecuencia de tratamiento) o desarrollan infección crónica (Liang, 2.000).

El tratamiento habitual del VHC comprende una asociación de interferón-alfa pegilado y la ribavirina antivírica. Las respuestas virológicas se consiguen, dependiendo del genotipo, en aproximadamente 50% de pacientes de VHC. La baja tolerabilidad y los considerables efectos secundarios de este tratamiento requieren claramente nueva intervención terapéutica incluyendo vacunas terapéuticas (Comberg 2.002). Sin embargo, en el momento presente 50 no se dispone del entendimiento detallado de qué epítopos en qué combinación de MHC conducen a respuestas inmunitarias exitosas (Ward 2.002). Por lo tanto, se requiere un análisis extenso de la respuesta de los linfocitos T contra VHC completo para el desarrollo de vacunas basadas en epítopos terapéuticas.

El virión del VHC contiene un genoma de ARN de una sola cadena de sentido positivo de 9,5 kilobase que codifica una poliproteína única grande de aproximadamente 3.000 aminoácidos. La última se trata con al menos 10 55 proteínas por actividades tanto de huésped como proteolíticas codificadas de VHC (Liang, 2.000). En gran medida,

la polimerasa de ARN dependiente de ARN de VHC tiende a error dando lugar al desarrollo de cuasiespecies víricas y contribuyendo a variantes de inmunoescape (Farci 2.000).

El documento WO 01/21189A desvela mecanismos por los que un antígeno es reconocido por los linfocitos T para identificar y preparar epítopos VHC para desarrollar vacunas basadas en epítopos dirigidas hacia VHC. El documento US 5.683.864 A desvela combinaciones de antígenos de VHC que constan de un antígeno del dominio C 5 de poliproteína de VHC y al menos un antígeno adicional de cualquiera de, el dominio NS3, el dominio NS4, el dominio S o el dominio NS5.

Aunque se han hecho muchas propuestas en la técnica en los últimos 15 años y se han propuesto muchos candidatos a antígeno prometedores durante este tiempo, aún no hay vacuna contra el VHC en el mercado (no un tratamiento terapéutico satisfactorio; el único tratamiento disponible, como se mencionó anteriormente una 10 combinación de alfa interferón y ribavirina, sólo es eficaz en una minoría de pacientes). Al principio después de la publicación de las secuencias de VHC, se sugirió una miríada de epítopos y antígenos como medios eficaces para combatir enfermedad por VHC (por ejemplo, Koziel et al., J. Virol. 67 (12), 7.522-7.532; Shirai et al., J. Virol. 68 (5) (1.994), 3.334-3.342; Leroux-Roels et al., Hepatology 23 (1) (1.996), 8-16; Hoffmann et al., Hepatology 21 (3) (1.995), 632-638; Sarobe et al., J. Clin. Invest. 102 (6) (1.998), 1.239-1.248; Battegay et al., J. Virol. 69 (4) (1.995), 15 2.462-2.470; Wentworth et al., Int. Imunol, 8 (5) (1.996), 651-659; Rehermann et al., J. Virol. 70 (10) (1.996), 7.092-7.102; Diepolder et al., J. Virol. 71 (8) (1.997), 6.011-6.019; Lamonaca et al., Hepatology 30 (4) (1.999), 1.088-1.098; documento WO 00/11186, documento WO 95/12766, documento WO 95/27733, documento WO 94/20127, documento WO 95/25122, documento WO 95/22317, documento WO 94/25601, documento WO 92/03458 y documento WO 93/00365. Adicionalmente, se han emprendido importantes estudios de neutralización ex vivo 20 pruebas de principio con chimpancés, la otra especie distinta de homo sapiens que es susceptible de infección por VHC crónica. Por supuesto, el estudio de respuestas inmunitarias indujo en individuos y chimpancés infecciones resueltas agudas frente a crónicas, ha revelado sólo hasta el momento una imagen emergente de respuestas inmunitarias protectoras potenciales siguiendo al establecimiento de infección vírica activa. Sin embargo, se espera que la correlación de protección con vacuna profiláctica después de inmunización parenteral sea en gran parte extra-25 hepática previamente a la exposición a VHC. Sólo se ha realizado un número limitado de estudios de eficacia de vacunas con chimpancés y estos estudios mostraron – a lo sumo - una protección de 5 de cada 7 animales de infección después de una estimulación homóloga con dosis baja usándose exactamente el mismo clon para inmunización y estimulación. Además, el VHC presenta un alto grado de variabilidad que proporciona VHC con la capacidad para librarse de respuestas inmunitarias inducidas por vacunas o por infección. En consideración de este 30 problema, también se ha sugerido una combinación de diferentes fragmentos de proteínas grandes como vacuna de ADN como estrategia de vacunación alternativa (Rollier et al., J. Virol. 78 (1) (2.004), 187-196; Dunas-Carrera et al., Biotech. Appl. Biochem. Imm. Publ. (29 de septiembre de 2.003; BA20030112)).

A pesar de todo el progreso que se ha realizado en los últimos 15, especialmente en los últimos 10 años, aún hay una necesidad apremiante de desarrollar nuevos tratamientos y estrategias de vacunación contra VHC (Heile et al., 35 J. Virol. 74 (15) (2.000), 6.885-6.892).

Es un objetivo por lo tanto de la presente invención proporcionar tales tratamientos eficaces y estrategias de vacunación contra VHC.

La presente invención proporciona por lo tanto una vacuna contra el virus de la Hepatitis C (VHC) como se reivindica en la reivindicación 1. Las realizaciones preferidas de esta vacuna contra el VHC se reivindican en las 40 reivindicaciones 2 a 17. La vacuna de la presente invención se puede usar para la preparación de un medicamento para la prevención y el tratamiento de una infección por VHC. Un procedimiento para la preparación de esta vacuna se reivindica en la reivindicación 19.

En la solicitud de patente internacional WO 04/024182, presentada el 27 de agosto de 2.003 (que reivindica una prioridad A 1367/2002 de 13 de septiembre de 2.002), se desvela un nuevo procedimiento para aislar péptidos de 45 VHC útiles en la vacunación, especialmente epítopos de linfocitos T de VHC. En esta solicitud se describió el concepto de “epítopos del punto caliente de VHC” por primera vez: un “punto caliente” de epítopos de linfocitos T se define como una secuencia de péptidos corta que comprende al menos más de un epítopo de linfocitos T. Por ejemplo, se pueden situar dos o más epítopos poco uno después de otro (definiéndose brevemente como menos de 5-10 aminoácidos) o directamente uno después de otro o parcialmente o incluso totalmente superpuestos. Los 50 puntos calientes pueden contener sólo epítopos de clase I o de clase II o una combinación de los dos. Los epítopos en los puntos calientes pueden tener diferentes restricciones de HLA.

Debido a las rutas altamente complejas y selectivas del tratamiento de antígenos de clase I y clase II, referidas en la introducción, no se pueden predecir fácilmente epítopos de linfocitos T en la secuencia de un polipéptido. Aunque ampliamente usados, los algoritmos de ordenador para predicción de epítopos de linfocitos T presentan un alto 55 índice de tanto falsos negativos como falsos positivos.

Así, ya que incluso los epítopos de linfocitos T individuales no son obvios dentro de la secuencia de un polipéptido, lo mismo es incluso más el caso para puntos calientes. Se combinan diversas propuestas experimentales radicalmente diferentes de acuerdo con la presente invención para identificación de epítopos de linfocitos T, incluyendo captura de epítopos, animales transgénicos de HLA y estimulación in vitro de células mononucleares humanas. Las tres propuestas se aplican sistemáticamente en péptidos superpuestos que abarcan 5 el antígeno de interés, permitiendo la identificación extensa de epítopos. En tal análisis extenso, no limitado a un alelo HLA particular sino más bien desenmarañando todos los epítopos posiblemente diana en una población, los puntos calientes de epítopos pueden llegar a ser evidentes. En un antígeno, sólo algunas secuencias, si hay, muestran características de puntos calientes. Así la identificación de un punto caliente es siempre un proceso sorprendente. 10

Los puntos calientes de epítopos de linfocitos T ofrecen importantes ventajas: Los puntos calientes se pueden activar y se pueden reconocer por diferentes clones de linfocitos T de un individuo. Los puntos calientes (cuando comprenden epítopos con diferente restricción HLA) pueden interactuar con linfocitos T de diferentes individuos de correspondencia no HLA.

Las vacunas a base de epítopos, hasta ahora se han dirigido a alelos-HLA frecuentes seleccionados, por ejemplo 15 HLA-A2, que se expresa en aproximadamente la mitad de los Caucasianos. Puesto que son menos frecuentes otros alelos, las vacunas a base de epítopos con amplia extensión de población mundial tendrán que comprender muchos epítopos diferentes. El número de entidades químicas (por ejemplo péptidos) de una vacuna está limitado por restricciones que se originan de la fabricación, formulación y estabilidad del producto.

Los puntos calientes permiten tales vacunas a base de epítopos con amplia extensión de población mundial, ya 20 que proporcionan un número potencialmente alto de epítopos por un número limitado de péptidos. Por supuesto, la técnica anterior (véanse las referencias mencionadas acerca de los epítopos discutidos en la técnica y el hecho de que aún no se ha desarrollado una vacuna contra el VHC) como se encuentra en la actualidad, ha demostrado claramente que el desarrollo de vacunas contra VHC se ha considerado problemático y que ha sido un fracaso general desarrollar vacunas contra VHC y tratamientos a pesar de la abundancia de referencias durante los últimos 25 10 años, que explica la eficacia de los antígenos del VHC en la obtención de respuesta inmunitaria humoral y celular en diversos modelos de infección. El tratamiento y la prevención de infección por VHC implican complejidad y seria imprevisibilidad.

El concepto de la presente invención proporcionando vacunas contra VHC basadas en la caracterización de epítopos de puntos calientes de VHC permite ahora por primera vez un sistema de vacunación para VHC que 30 permite una vacunación profiláctica tanto adecuada como específica y una pauta de tratamiento eficaz para pacientes infectados por VHC, especialmente pacientes infectados crónicamente.

Se podía demostrar por los inventores de la presente solicitud que el uso de uno o dos epítopos específicos sólo en la vacuna contra el VHC no es suficiente para dar resultados satisfactorios en la vacunación. También el concepto de proporcionar una mezcla de proteínas VHC (Core, E1 y E2 como vacuna de ADN; Duenas-Carrera et 35 al. (2.003)) o una mezcla de grandes fragmentos de tales proteínas VHC (Core, E1 y E2 y NS3 como vacunas de ADN; Rollier et al., (2.004)) no llevaron a los resultados deseados.

Las vacunas contra VHC de acuerdo con la presente invención contienen epítopos que contienen polipéptidos cortos de los epítopos de los puntos calientes como se indicó anteriormente. Las presentes vacunas no dependen de los riesgos y las incertidumbres con respecto a las vacunas de ADN (ausencia de respuesta inmunitaria de larga 40 duración; acción en gran parte extrahepática; modo de acción, localización, etc). Por otra parte, la presente invención no se enfrenta tampoco a los diversos problemas de fabricación con la producción de proteínas completas o fragmentos de proteína de cadena larga.

Los epítopos de puntos calientes descritos en la presente memoria se han identificado por ensayos funcionales usando principalmente una reacción de tipo Th1/Tc1 (es decir, interferón gamma) como lectura de salida. Se sabe 45 que los antígenos (completos o al menos fragmentos grandes) no sólo contienen tales epítopos agonistas, sino que también pueden codificar ligandos antagonistas. Tales antagonistas presentes potencialmente en antígenos completos, pero ausentes en puntos calientes pueden impedir la inmunogenicidad y eficacia de la vacuna. Por otra parte, los antígenos completos casi inducirán ciertamente una respuesta inmunitaria humoral. Tal respuesta de los anticuerpos presenta poco efecto per se en el VHC que reside en las células, pero puede comprometer seriamente 50 la respuesta de los linfocitos T deseada. Los epítopos que proceden de puntos calientes de acuerdo con la presente invención, debido a su longitud restringida, presentan una probabilidad mucho menor de inducir respuestas no deseadas de los anticuerpos. Finalmente, sólo se conservan partes relativamente pequeñas de antígenos VHC entre diferentes genotipos. Así, los antígenos completos usados en una vacuna pueden inducir respuestas contra regiones no conservadas o epítopos, irrelevantes para la mayoría de los pacientes. Por el contrario, los puntos calientes 55 descritos en la presente memoria proceden de regiones conservadas >80% entre los principales genotipos 1, 2 y 3

de VHC.

Los tipos super-HLA (como se desvela por ejemplo en el documento WO 01/21189) desvelan el hecho de que en algunos casos un epítopo de linfocitos T de clase I de HLA dado no esté exclusivamente restringido a uno y sólo un alelo-HLA sino que también pueda ser reconocido por linfocitos T en el contexto de otro alelo HLA (ejemplo: un péptido se puede unir a HLA-B*0702 y -B*3501). Tales péptidos por naturaleza presentan una extensión de HLA 5 más amplia en la población y son por lo tanto candidatos interesantes para vacuna.

Por el contrario, un punto caliente de epítopos de linfocitos T de acuerdo con la presente invención difiere significativamente de tal super-tipo HLA, debido a que un punto caliente de acuerdo con la presente invención es una región peptídica en una proteína que muestra un número inusualmente alto de diferentes epítopos adyacentes e incluso superpuestos. El punto caliente suministra un alto número de epítopos en regiones relativamente pequeñas, 10 al mismo tiempo está garantizado el tratamiento apropiado de los epítopos en los puntos calientes.

Por supuesto, los puntos calientes de acuerdo con la presente invención muestran una variación destacablemente baja entre diferentes especies de VHC que los hace incluso más favorables para propuestas de vacuna, debido a que también es posible la estimulación heteróloga incluso aunque sólo se usen polipéptidos pequeños. De preferencia, la longitud de los epítopos de acuerdo con la presente invención es al menos 6, 7, 8, 9, 10, 11 ó 12 15 aminoácidos.

De acuerdo con la presente invención los epítopos para una vacuna dada se pueden seleccionar de las regiones de los puntos calientes como se definió anteriormente. Por supuesto, se puede proporcionar cualquier región de puntos calientes completa en la vacuna o sólo partes de la misma (siempre que la parte contenga al menos un epítopo). Los epítopos que se tienen que usar de acuerdo con la presente invención también pueden ser variantes 20 de secuencias con deleciones (de de preferencia 1, 2, 3, 4, 5, 6 ó 7 aminoácidos) en la secuencia “patrón” de los puntos calientes como se definió anteriormente. De preferencia, las deleciones en el interior de la secuencia de puntos calientes no modifican los epítopos; por supuesto al menos un epítopo en la región de puntos calientes se tiene que conservar a pesar de la deleción.

Los epítopos se pueden proporcionar como polipéptidos sin modificaciones; la modificación de la cadena de 25 polipéptido con ciertos restos químicos o biológicos puede ser apropiada, especialmente con respecto a consideraciones de solubilización o formulación farmacéutica (por ejemplo, como se desvela en el documento WO 01/78767). Los epítopos usados en la presente vacuna contra el VHC pueden comprender o la región de puntos calientes completa o un fragmento contiguo de la misma (que contenga al menos uno de los epítopos contenidos en el punto caliente) o comprende una parte no contigua del punto caliente (sin embargo, conteniendo también al 30 menos uno de los epítopos contenidos en el punto caliente; en tal caso se pueden proporcionar uno o más conectores (por ejemplo, conectores de aminoácidos o péptidos) entre las partes no contiguas de este punto caliente).

De acuerdo con una realización preferida, la vacuna contra el VHC de acuerdo con la presente invención comprende al menos tres, especialmente al menos cuatro epítopos, cada uno de un epítopo de puntos calientes 35 diferente.

Incluso más preferido, la vacuna contra el VHC comprende al menos cinco epítopos, cada uno de un epítopo de puntos calientes diferente. Aunque cuanto mayor sea el número de epítopos en tal vacuna a base de epítopos, mayores son los problemas con respecto a la formulación, un número de 4, 5 ó 6 epítopos es el equilibrio óptimo entre intervalo amplio de capacidades de protección y desventajas de formulación, especialmente con respecto a la 40 producción en una escala industrial.

En ciertos casos por lo tanto también una vacuna contra el VHC que comprende al menos seis epítopos, cada una de un epítopo de puntos calientes diferente puede ser una realización preferida de la presente invención. El número óptimo de epítopos de puntos calientes también depende de la interacción relativa de los epítopos seleccionados entre sí que ha demostrado que es el principal obstáculo para ciertas combinaciones de polipéptidos 45 de longitud corta en una vacuna.

Las vacunas contra el VHC preferidas de acuerdo con la presente invención se caracterizan porque – además de los epítopos a), b) y c) de la reivindicación 1 – los epítopos adicionales se seleccionan de los siguientes grupos:

En general, de un grupo de epítopos sólo se debería seleccionar un epítopo para conseguir buenos resultados. Por supuesto no todos los epítopos de puntos calientes enumerados anteriormente son igualmente potentes y la eficacia puede variar entre diferentes grupos de población. De preferencia, se puede aplicar una estrategia de 5 vacunación individual para cada grupo que se basa principalmente en la extensión para HLA. Por lo tanto, una vacuna contra el VHC preferida de acuerdo con la presente invención se caracteriza porque comprende al menos los siguientes epítopos de puntos calientes:

Como alternativa a los antígenos y epítopos precisos enumerados en la presente memoria, se pueden usar 10 variantes de antígeno/epítopo en las vacunas de acuerdo con la presente invención. Las variantes preferidas se diseñan de acuerdo con epítopos homólogos (que contienen uno o más intercambios presentes en cepas de VHC homólogas) o heteroclícticos. Entre las variantes preferidas están aquellas que varían de una secuencia descrita en la presente memoria por sustituciones de aminoácidos conservadoras. Dichas sustituciones son aquellas que sustituyen un aminoácido dado en un polipéptido por otro aminoácido de características similares. Típicamente, 15 veánse como sustituciones conservadoras las sustituciones una por otra, entre los aminoácidos alifáticos Ala, Val, Leu e Ile; intercambio de los restos hidroxilo Ser y Thr, intercambio de los restos ácidos Asp y Glu, sustitución entre los restos amida Asn y Gln, intercambio de los restos básicos Lys y Arg y sustituciones entre los restos aromáticos Phe y Tyr.

Se prefieren particularmente además con respecto a esto, variantes que tienen la secuencia de aminoácidos de 20 cualquier polipéptido descrito en la presente memoria, en que se sustituyen restos de 1, 2, 3, 4 ó 5 aminoácidos, se eliminan o se añaden, en cualquier combinación. Entre éstos se prefieren sustituciones silenciosas, adiciones y eliminaciones, que no modifiquen las propiedades y actividades del polipéptido de la presente invención. Son

especialmente preferidas con respecto a esto las sustituciones conservadoras. Específicamente, las sustituciones de aminoácidos adecuadas son aquéllas que están contenidas en homólogos para las secuencias descritas en la presente memoria. Una variante de secuencia adecuada de un antígeno o epítopo como se desvela en la presente memoria incluye por lo tanto una o más variaciones que estén presentes en una o más cepas o serotipos de VHC (de preferencia intercambios de 1, 2, 3, 4 ó 5 aminoácidos que estén basados en tales variaciones homólogas). 5 Tales antígenos comprenden secuencias que pueden ser secuencias que se encuentran en la naturaleza o secuencias artificiales creadas recientemente. Estas variantes de antígenos preferidas están basadas en dichas variaciones de secuencias que se encuentran en la naturaleza, por ejemplo formando una “secuencia mixta” para las regiones antigénicas de los polipéptidos de acuerdo con la presente invención. Por ejemplo, una secuencia de VHC dada como se desvela en la presente memoria puede ser modificada incluyendo una o más de tales variaciones, 10 creando de ese modo una variante artificial (es decir, que no se encuentra en la naturaleza) de esta secuencia de antígenos o epítopos (que se encuentra en la naturaleza) dada.

Es evidente que también los epítopos o péptidos procedentes de los presentes epítopos o péptidos por mejora de intercambios de aminoácidos, por conservación o al menos no impidiendo significativamente que la capacidad de activación de linfocitos T de los epítopos esté cubierta por los epítopos o péptidos de acuerdo con la presente 15 invención. Por lo tanto, los presentes epítopos o péptidos también cubren epítopos o péptidos, que no contienen la secuencia original como se deriva de una cepa específica de VHC, sino que desencadena la misma respuesta de los linfocitos T o de preferencia una respuesta mejorada. Estos epítopos se refieren como “heteroclíticos”. Estos incluyen cualquier epítopo que pueda desencadenar las mismos linfocitos T como el epítopo original y tiene de preferencia una capacidad de activación más potente de linfocitos T de preferencia in vivo o también in vitro. 20 También los epítopos homólogos respectivos de otras cepas de VHC están incluidos en la presente invención.

Los epítopos heteroclíticos se pueden obtener por diseño racional, es decir, teniendo en cuenta la contribución de restos individuales a la unión a MCH/HLA como se desvela por ejemplo por Ramensee et al. 1.999 (Immunogenetics 50: 213-219) o Sturniolo et al. 1.999 (Nature Biotechnology 17: 555-562), junto con un intercambio sistemático de restos que interactúan potencialmente con el TCR y ensayando las secuencias resultantes con linfocitos T dirigidas 25 contra el epítopo original. Tal diseño es posible para un experto en la materia sin mucha experimentación.

Otra posibilidad incluye el cribado de bibliotecas de péptidos con linfocitos T contra el epítopo original. Una manera preferida es el barrido posicional de bibliotecas de péptidos sintéticos. Tales propuestas se han descrito con detalle por ejemplo por Blake et al 1.996 () y Hemmer et al. 1.999 () y las referencias dadas en las mismas.

Como alternativa a epítopos representada por la secuencia de aminoácidos procedente de VHC de origen similar 30 o epítopos heteroclíticos, también se pueden aplicar sustancias que imitan a estos epítopos, por ejemplo, “peptidomiméticos” o “retro-inverso-péptidos”.

Se pueden añadir grupos químicos adicionales, especialmente restos de aminoácidos, conectores (y que se unen a portadores), grupos que faciliten el transporte, etc, al N- y/o C-terminal de los epítopos en la vacuna contra el VHC de acuerdo con la presente invención. Se prefieren uniones de aminoácidos como se desvela en el documento WO 35 01/78767.

Otro aspecto del diseño de epítopos de puntos calientes mejorados es su formulación o modificación con sustancias que aumenten su capacidad para estimular linfocitos T. Estas incluyen epítopos de linfocitos T auxiliares, lípidos o liposomas (o las modificaciones preferidas como se desvela en el documento WO 01/78767).

Otra manera de aumentar la capacidad de estimulación de linfocitos T de epítopos es su formulación con 40 sustancias de estimulación inmunitaria por ejemplo anticuerpos, citocinas o quimiocinas como interleucina-2, -7, -12, -18, interferones de tipo I y II (IFN), especialmente IFN-alfa, GM-CSF, TNF-alfa, flt3-ligando y otros.

De acuerdo con un aspecto más, la presente invención se refiere al uso de un epítopo de VHC o péptido de VHC de acuerdo con la presente invención para la preparación de una vacuna restringida de HLA para tratar o prevenir infecciones por el virus de la hepatitis C (VHC). 45

Otra vacuna contra el VHC preferida de acuerdo con la presente invención comprende los siguientes epítopos:

La presente vacuna contra el VHC comprende de preferencia al menos un epítopo A2 y al menos un epítopo DR1.

La presente vacuna contra el VHC comprende de preferencia al menos un epítopo DR7. 50

La siguiente combinación de epítopos se considera como específicamente poderosa (al menos uno de los grupos (1) a (5)):

Se prefiere proporcionar sustancias auxiliares específicamente adecuadas para las presentes vacunas contra VHC. Por lo tanto, ciertos tipos de sustancias inmunoestimulantes han demostrado ser ventajosos para la presente 5 invención.

Por lo tanto, una vacuna contra el VHC preferida contiene además un péptido que comprende una secuencia R1-XZXZNXZX-R2, en la cual N es un número entero entre 3 y 7, de preferencia 5, X es un resto de aminoácido natural y/o no natural cargado positivamente, Z es un resto de aminoácido seleccionado del grupo constituido por L, V, I, F y/o W y R1 y R2 se seleccionan independientemente uno de otro del grupo constituido por -H, -NH2, -COCH3, -COH, 10 un péptido con hasta 20 restos de aminoácido o un grupo reactivo peptídico o un conector peptídico con o sin péptido; X-R2 puede ser una amida, éster o tioéster del resto de aminoácido C-terminal del péptido (“Péptido A”).

Otra realización preferida de la vacuna contra el VHC contiene además una molécula de ácido oligodesoxinucleico (ODN) inmunoestimuladora con la estructura de acuerdo con la fórmula (I).

15

en la que:

R1 se selecciona de hipoxantina y uracilo, cualquier X es O o S,

cualquier NMP es un monofosfato o monotiofosfato de 2' desoxinucleósido, seleccionado del grupo constituido por monofosfato o monotiofosfato monofosfato o monotiofosfato de desoxiadenosina, desoxiguanosina, desoxiinosina, desoxicitosina, desoxiuridina, desoxitimidina, 2-metil-desoxiinosina, 5-metil-desoxicitosina, 20 desoxipseudouridina, desoxiribosapurina, 2-amino-desoxiribosapurina, 6-S-desoxiguanina, 2-dimetil-desoxiguanosina o N-isopentenil-desoxiadenosina, NUC es un 2' desoxinucleósido, seleccionado del grupo constituido por desoxiadenosina, desoxiguanosina, desoxiinosina, desoxicitosina, desoxiinosina, desoxitimidina, 2-metil-desoxiuridina, 5-metil-desoxicitosina, desoxipseudouridina, desoxiribosapurina, 2-amino-desoxiribosapurina, 6-

S-desoxiguanina, 2-dimetil-desoxiguanosina o N-isopentenil-desoxiadenosina,

a y b son números enteros de 0 a 100 con la condición de que a + b esté entre 4 y 150 y

B y E sean grupos comunes para los extremos 5' o 3' de moléculas de ácidos nucleicos (“I-/U-ODN”).

Una composición de vacuna contra el VHC de acuerdo con la presente invención puede comprender además un compuesto policatiónico, de preferencia un polímero policatiónico, más de preferencia un péptido policatiónico, 5 especialmente poliarginina, polilisina o un péptido antimicrobiano.

El compuesto o los compuestos policatiónicos que se tienen que usar de acuerdo con la presente invención pueden ser cualquier compuesto policatiónico que muestre en el efecto característico de acuerdo con la el documento WO 97/30721. Los compuestos policatiónicos preferidos se seleccionan de polipéptidos básicos, policationes orgánicos, poliaminoácidos básicos o mezclas de los mismos. Estos poliaminoácidos deberían tener 10 una longitud de cadena de al menos 4 restos aminoácido. Especialmente preferidas son las sustancias que contienen enlaces peptídicos como polilisina, poliarginina y polipéptidos que contienen más de 20%, especialmente más de 50% de aminoácidos básicos en un intervalo mayor que 8, especialmente mayor que 20, restos de aminoácido o mezclas de los mismos. Otros policationes preferidos y sus composiciones farmacéuticas se desvelan en el documento WO 97/30721 (por ejemplo, polietilenimina) y el documento WO 99/38528. De preferencia, estos 15 polipéptidos contienen entre 20 y 500 restos aminoácido, especialmente entre 30 y 200 restos. Estos compuestos policatiónicos pueden producirse químicamente o recombinantemente o pueden proceder de fuentes naturales.

Los (poli)péptidos catiónicos también pueden ser péptidos microbianos antibacterianos policatiónicos. Estos (poli)péptidos pueden ser de origen procariótico o animal o vegetal o se pueden producir químicamente o recombinantemente. Los péptidos también pueden pertenecer a la clase de defensinas. Tales péptidos de defensa 20 del huésped o defensinas son también una forma preferida del polimero policatiónico de acuerdo con la presente invención. En general, se usa un compuesto que permita como un producto final la activación (o regulación por disminución) del sistema inmunitario adaptativo, de preferencia mediada por las APC (incluyendo células dendríticas), como polímero policatiónico.

Las sustancias policatiónicas usadas en el procedimiento de acuerdo con la presente invención son péptidos 25 antimicrobianos procedentes de catelicidina o derivados de la misma (documento WO 02/13857 A), especialmente péptidos antimicrobianos procedentes de catelicidinas de mamífero, de preferencia de ser humano, bóvido o ratón o compuestos neuroactivos tales como hormona de crecimiento (humana) (como se desvela por ejemplo en el documento WO 01/24822).

Los compuestos policatiónicos procedentes de fuentes naturales incluyen HIV-REV o HIV-TAT (péptidos 30 catiónicos derivados, péptidos de antenapedia, quitosán u otros derivados de quitina) u otros péptidos derivados de estos péptidos o proteínas por producción bioquímica o recombinante. Otros compuestos policatiónicos preferidos son catelina o sustancias relacionadas o derivadas de catelina, especialmente ratón, bóvido o catelinas y/o catelicidinas especialmente humanas. Las sustancias de catelina relacionadas o derivadas contienen el total o partes de la secuencia de catelina con al menos restos de 15-20 aminoácidos. Las derivaciones pueden incluir la 35 sustitución o modificación de los aminoácidos naturales por aminoácidos que no estén entre los 20 aminoácidos clásicos. Por otra parte, se pueden introducir restos catiónicos adicionales en dichas moléculas de catelina. Se prefiere que se combinen estas moléculas de catelina con la composición de péptidos de VHC de acuerdo con la presente invención. Sin embargo, estas moléculas de catelina han resultado ser sorprendentemente también eficaces como adyuvante para un antígeno sin la adición de más adyuvantes. Es posible por lo tanto usar dichas 40 moléculas de catelina como adyuvantes eficaces en formulaciones de vacunas con o sin más sustancias inmunoactivantes. De preferencia, la presente vacuna contra el VHC contiene además un adyuvante de Al(OH)3 y/o un péptido policatiónico.

De acuerdo con una realización específicamente preferida, el Péptido A mencionado anteriormente es KLKL5KLK y/o el I-/U-ODN mencionado anteriormente es oligo d(IC)13. 45

En ciertas realizaciones, se puede preferir que la vacuna contra el VHC contenga además un oligodesoxinucleótido que contenga un motivo CpG.

De preferencia, la vacuna contra el VHC de acuerdo con la presente invención se liofiliza en una forma que es reconstituible en 15 min a 37ºC. Dependiendo de los epítopos individuales en la vacuna contra el VHC, esto puede ser una tarea difícil. Por lo tanto, la presente invención también proporciona medios eficaces para formular tal 50 vacuna contra el VHC.

La vacuna contra el VHC de acuerdo con la presente invención contiene de preferencia entre 10 g y 10 mg de cada epítopo (por dosis).

Dependiendo de la aplicación, el número de los péptidos individuales y especialmente su concentración en la mezcla varía. En una realización preferida de la presente invención la concentración de los péptidos individuales en la vacuna contra el VHC que se tiene que suministrar al paciente oscila de 5 g/ml a 5 mg/ml, de preferencia de 50 g/ml a 4 mg/ml, más de preferencia de 100 g/ml a 3 mg/ml.

La vacuna contra el VHC liofilizada de acuerdo con la presente invención contiene de preferencia trazas de ácido 5 acético debido al proceso de liofilización de acuerdo con la presente invención.

De acuerdo con otro aspecto, la presente invención también se refiere al uso de la presente vacuna contra el VHC para la preparación de un medicamento para la prevención y el tratamiento de una infección por VHC, es decir, administrando una dosis inmunizante eficaz de una vacuna contra el VHC de acuerdo con la presente invención a un individuo, especialmente a un paciente con VHC o un individuo con riesgo de adquirir una infección por VHC (por 10 ejemplo, personal hospitalario, personal de investigación clínica, personal de donación de sangre, etc.).

Solubilizar mezclas de péptidos tales como las vacunas contra el VHC de acuerdo con la presente invención puede ser difícil. Es un objeto por lo tanto de la presente invención proporcionar procedimientos para la solubilización de las mezclas peptídicas de VHC de acuerdo con la presente invención, es decir, mezclas de péptidos que están compuestas por dos o más péptidos, especialmente las que consisten en péptidos hidrófilos así 15 como hidrófobos. Otro objeto es hacer disponible un procedimiento para la fabricación de formulaciones farmacéuticas estériles y opcionalmente liofilizadas que contienen mezclas peptídicas.

Por lo tanto, la presente invención proporciona de acuerdo con otro aspecto, un procedimiento para preparar una preparación farmacéutica que comprende la solubilización de una mezcla de péptidos de VHC de acuerdo con la presente invención, caracterizada porque la mezcla de péptidos se solubiliza por una disolución acuosa que 20 contenga al menos un ácido orgánico seleccionado del grupo constituido por ácido fórmico, ácido acético, ácido propiónico, ácido butírico y formas halogenadas o hidroxiladas de los mismos. Para alargar el tiempo de durabilidad se puede esterilizar además la mezcla de péptidos solubilizada (por filtración, irradiación, tratamiento con calor, esterilización química u otros procedimientos) y liofilizar.

En una realización preferida, la mezcla de péptidos contiene péptidos hidrófilos así como hidrófobos. Por 25 supuesto, el presente procedimiento también se puede usar para mezclas de péptidos que contengan un sólo tipo de péptidos (específicamente para mezclas que contengan por ejemplo dos o más péptidos hidrófilos).

En otra realización preferida, los péptidos que se disuelven por una disolución acuosa de acuerdo con la presente invención contienen al menos 6, de preferencia al menos 8, más de preferencia al menos 10, especialmente al menos 12 aminoácidos. Los péptidos así como polipéptidos que contienen un número máximo de 30, 40 ó 50 30 aminoácidos (o incluso hasta 100, aunque son menos preferidos epítopos largos debido a las desventajas de fragmentos de antígenos más largos) se pueden disolver de acuerdo con la presente invención.

Para este aspecto de la presente invención los péptidos se caracterizan por su solubilidad. Los péptidos que son solubles en una disolución acuosa menor que 100 g/ml se consideran hidrófobos. Por otra parte, los péptidos hidrófilos se disuelven en una disolución acuosa tamponada en concentración mayor que 100 g/ml. Los péptidos 35 hidrófilos se pueden dividir además en péptidos catiónicos (>20% de aminoácidos básicos incluyendo lisina, arginina, histidina), aniónicos (>20% de aminoácidos ácidos incluyendo ácido aspártico, ácido glutámico) y ricos en hidroxilo (>30% de aminoácidos que contienen –OH como serina, treonina, tirosina).

De acuerdo con otro aspecto, la presente invención se refiere por lo tanto a un procedimiento para la preparación de la presente vacuna contra el VHC que se caracteriza por las siguientes etapas: 40

- sintetizar químicamente al menos dos epítopos como están definidos anteriormente,

- solubilizar estos epítopos mediante una disolución acuosa que contenga al menos un ácido orgánico seleccionado del grupo constituido por ácido fórmico, ácido acético, ácido propiónico, ácido butírico y formas halogenadas o hidroxiladas de los mismos,

- mezclar los epítopos solubilizados y 45

- liofilizar opcionalmente los epítopos mezclados.

La mezcla de péptidos de VHC se puede ultracongelar (si no se realiza etapa de liofilización) por razones de almacenamiento.

Los péptidos de la mezcla de péptidos de acuerdo con la presente invención se sintetizan por procedimientos químicos clásicos (por ejemplo, síntesis en fase sólida de acuerdo con Merrifield). Por supuesto los péptidos se 50

pueden obtener también por fragmentación química o enzimática de proteínas producidas de manera recombinante o aisladas naturales. En otra realización, los péptidos de VHC se aíslan directamente de células eucariotas y procariotas. En los tres casos, se requirirá en algunos casos purificación adicional del péptido o polipéptido de interés antes de que se liofilice y se mezclen juntos.

Es un requerimiento básico para este procedimiento especifico que los ácidos orgánicos usados en disoluciones 5 acuosas para la solubilización de péptidos son farmacéuticamente aceptables. En una realización preferida de la presente invención, los ácidos orgánicos son ácido acético y/o ácido fórmico que contienen opcionalmente acetonitrilo.

Los experimentos revelaron, dependiendo de la composición de la mezcla de péptidos, que la concentración del ácido orgánico en la disolución acuosa tiene que ser al menos 10%, de preferencia al menos 20%, de preferencia al 10 menos 30%, de preferencia al menos 40%, de preferencia al menos 50%, de preferencia al menos 60%.

En algunos casos, la adición de derivados de ácidos orgánicos (por ejemplo acetonitrilo) a la disolución acuosa puede ser útil para solubilizar mezclas de péptidos que contengan una cantidad mayor de péptidos hidrófobos. También los disolventes orgánicos tales como DMSO y DMF contribuyen a una disolución mejorada de mezclas de péptidos que contengan una concentración aumentada de péptidos hidrófobos. Sin embargo, las mezclas acuosas 15 de péptidos que contienen DMSO y/o DMF no se pueden liofilizar.

En una realización preferida, se añaden agentes volumétricos a la mezcla de péptidos cuando se desea que el producto se liofilice. Especialmente a concentraciones bajas de péptidos la formación de una buena torta de masa filtrante de liofilización no está garantizada. Por lo tanto, se añaden agentes de hinchamiento a bajas cantidades de péptidos. Los agentes de hinchamiento preferidos son sorbitol, manitol, polivinilpirrolidona (PVP) y mezclas de los 20 mismos.

En otra realización preferida la mezcla de péptidos solubilizada se esteriliza por filtración. Para conseguir una recuperación mejorada del producto y permitir la filtración de grandes cantidades de la mezcla de péptidos, los péptidos que contiene tienen que ser solubilizados completamente y no se puede formar gel.

La mezcla de péptidos solubilizada y opcionalmente esterilizada se puede liofilizar directamente o después de 25 llenar viales. La liofilización es un procedimiento útil y eficaz para prolongar el tiempo de durabilidad de mezclas de péptidos, como se describió anteriormente. Con los péptidos solubilizados se puede obtener una preparación liofilizada de una mezcla de péptidos, que contenga un máximo de 5% de disolvente residual (agua en sistemas acuosos) y trazas del ácido orgánico, que sea reconstituible en una disolución acuosa tamponada que contenga NaCl y/o sorbitol en 10 minutos de >95%, de preferencia del 98%, especialmente de 99%, dando como resultado 30 una suspensión turbia o una disolución clara (dependiendo de la composición de la mezcla de péptidos). Dicha reconstitución rápida es específicamente necesaria en casos de emergencia, en el caso de que tenga que estar presente una disolución lista para uso en unos minutos con una resolvatación casi completa de la dosis total de un vial liofilizado.

La invención se describirá con más detalle por los siguientes ejemplos y figuras, pero la invención no está limitada 35 por supuesto a los mismos.

La figura 1 muestra que KLK/O-d(IC)13 induce respuestas inmunitarias celulares de tipo 1 especificas de péptidos VHC;

EJEMPLOS

Ejemplo I. Unión de péptidos procedentes de VHC a moléculas de clase II de HLA. 40

De acuerdo con el documento WO 04/024182, se sintetizaron varias secuencias que incorporan nuevos péptidos de péptidos de VHC reactivos superpuestos o que evitan restos críticos como cisteína. En éstas se volvieron a ensayar sus afinidades para moléculas de HLA solubles de clase II y se compararon los resultados con los obtenidos con el original (Tabla 1).

Tabla 1. Unión de péptidos procedentes de VHC seleccionados y sus contrapartes 15-meros para moléculas de clase II de HLA solubles (“+++” afinidad fuerte, “++” afinidad intermedia, “+” afinidad débil, “-“ sin afinidad, “nh” no hecho; los restos de unión a núcleo están subrayados).

Las afinidades suprimidas para moléculas DRB1*0101 y DRB1*0401 en el caso de péptido 1.798 en comparación con sus contrapartidas más cortas (B84-B96) se deben probablemente a la larga secuencia (26 aminoácidos) que puede tener una estructura secundaria que evite la unión. Se tiene que esperar que el péptido 1.798 en la escisión proteolítica, in vivo, dé lugar a dos epítopos de clase II más cortos. Los restos de cisteína (C) eliminados en los péptidos 1.827 y 1.829 (derivados de los péptidos C114 y 1.604, respectivamente) parecen cruciales para la unión a 5 moléculas de DRB1*0401 pero no cambian esencialmente las afinidades para otros subtipos DR ensayados.

Ejemplo II. Identificación y Caracterización de puntos calientes de epítopos de VHC

Como se indicó en líneas generales, se define un punto caliente de epítopos de linfocitos T (un “punto caliente”) como una secuencia de péptidos cortos al menos que comprende más de un epítopo de linfocitos T. Por ejemplo, dos o más epítopos se pueden situar uno poco después de otro (definiéndose brevemente como menos de 5-10 10 aminoácidos) o directamente uno después de otro o parcialmente o incluso completamente superpuestos. Los puntos calientes pueden contener sólo epítopos de clase I o clase II o una combinación de ambos. Los epítopos en puntos calientes pueden tener diferentes restricciones de HLA.

Debido a las rutas altamente complejas y selectivas de tratamiento de antígenos de clase I y clase II, referidas en la introducción, los epítopos de linfocitos T no se pueden predecir fácilmente en la secuencia de un polipéptido. 15 Aunque extensamente usados, los algoritmos de ordenador para predicción de epítopos de linfocitos T tienen un alto índice tanto de falsos negativos como falsos positivos.

Así, como incluso los epítopos de linfocitos T individuales no son obvios en la secuencia de un polipéptido, lo mismo es incluso más el caso para los puntos calientes. Se combinan varias propuestas experimentales radicalmente diferentes de acuerdo con la presente invención para identificación de epítopos de linfocitos T, 20 incluyendo captura de epítopos, animales transgénicos de HLA y estimulación in vitro de células mononucleares humanas. Las tres propuestas se aplican sistemáticamente sobre péptidos superpuestos que se extienden sobre el antígeno de interés, permitiendo la identificación extensa de epítopos. En dicho análisis extenso, no limitado a un alelo de HLA particular, sino más bien desenmarañando todos los epítopos posiblemente diana en una población, pueden llegar a ser evidentes los puntos calientes de los epítopos. En un antígeno, sólo algunas secuencias, si hay, 25 muestran características de puntos calientes. Así la identificación de un punto caliente es siempre un hecho sorprendente.

Los puntos calientes de los epítopos de linfocitos T ofrecen importantes ventajas: Los puntos calientes pueden activar y se pueden reconocer por diferentes clones de linfocitos T de un individuo. Los puntos calientes (cuando comprenden epítopos con diferente restricción de HLA) pueden interactuar con linfocitos T de diferentes individuos 30 no correspondientes con HLA.

Las vacunas basadas en epítopos, han sido objeto hasta ahora en alelos de HLA frecuentes seleccionados, por ejemplo HLA-A2, que se expresa en aproximadamente la mitad de caucasianos. Puesto que son menos frecuentes otros alelos, las vacunas a base de epítopos con amplia extensión de población mundial tendrán que comprender muchos epítopos diferentes. El número de entidades químicas (por ejemplo péptidos) de una vacuna está limitado 35 por restricciones que se originan de la fabricación, formulación y estabilidad del producto.

Los puntos calientes permiten tales vacunas a base de epítopos con amplia extensión de población mundial, ya que proporcionan un número potencialmente alto de epítopos por un número limitado de péptidos.

Tabla 2. Puntos calientes de epítopos de linfocitos T en regiones conservadas de VHC.

Los puntos calientes (incl. algunas variaciones) se muestran en negrita, los epítopos contenidos en los puntos 40 calientes en fuente normal. Se da el número de péptidos y la secuencia, así como la extensión de clase I y clase II de HLA. Los datos de la fuente se refieren a las referencias de la bibliografía, si no se proporciona por el documento WO 04/024182.

Ejemplo III. Punto caliente Ipep 1.426 de epítopos de VHC contiene al menos HLA-A*0201 y diversos epítopos de linfocitos T de clase II promiscuos.

El principal objetivo de este experimento fue comparar la inmunogenicidad del “punto caliente” Ipep 1.426, que contiene al menos un epítopo de HLA-A*0201 (Ipep 1.334) y 2 epítopos de clase II promiscuos (Ipeps 1.006 y 1.425) 5 para los epítopos individuales. Con este propósito, se estimularon células mononucleares de sangre periférica (PBMC) de diversos donantes de sangre de tipo HLA sanos in vitro o con una mezcla de 1.426 o una mezcla de 1.334, 1.006, 1.425. estas vueltas de estimulación se realizaron dando como resultado líneas de linfocitos T oligoclonales. Entonces, las respuestas contra los cuatro péptidos se evaluaron por análisis ELIspot de interferón-gamma (IFN-). 10

El péptido 1.426 induce respuestas de los linfocitos T similarmente bien como epítopos individuales comprendidos en su secuencia. En particular, se generaron con éxito linfocitos T positivas CD8 dirigidas contra el epítopo 1.334 restringido de HLA-A*0201.

Tabla 3: secreción de IFN- inducida por péptidos de líneas de linfocitos T oligoclonales. Se generaron líneas de dos individuos sanos de tipo HLA por 3 vueltas de imprimación in vitro o con péptido 1.426 o una mezcla de 15 péptidos 1.006+1.425*1.334. La reactividad de linfocitos T positivas CD4 y CD8 en estas líneas se valoró por ELIspot IFN- (“+++” muy fuerte, “++” fuerte, “+” significativa, “-“ sin secreción de IFN-gamma).

(continúa)

Ejemplo IV. Las respuestas celulares de tipo 1 específicas de VHC potentes son inducidas por la inyección combinada de cinco péptidos procedentes de VHC diferentes, el péptido antimicrobiano KLK y el oligodesoxinucleótido sintético o-d (IC)13. 5

Ratones transgénicos de HLA-A*0201 de ratones (HHD1)

Péptidos

Los péptidos p83, p84, p87, p89, p1.426 se usaron para vacunación.

p83: péptido procedente de VHC, (KPFGGGQIVGGVYLLPRRGPRL)

p84: péptido procedente de VHC,

(GYKVLVLNPSVAAT)

p87: péptido procedente de VHC, (DLMGYIPAV)

p89: péptido procedente de VHC, (CINGVCWTV)

p1.426: péptido procedente de VHC, (HMWNFISGIQYLAGLSTLPGNPA)

(p1.274 usado para reestimulación como péptido frecuente (YMDGTMSQV: HLA-A*0201 restringido)

Todos los péptidos se sintetizaron por síntesis F-moc en fase sólida clásica, purificado por HPLC y analizado por espectroscopía de masas para pureza.

dosis: 20 g por péptido/ratón

KLK KLKLLLLLKLK-COOH

se sintetizó por MPS (Sistema de Péptidos Múltiple, USA)

dosis: 10 nmoles/ratón

oligo-d(IC)13 (=ODN1a) ODN

5'ICI CIC ICI CIC ICI CIC ICI CIC IC3' se sintetizó por Tecnología de Ácidos Nucleicos Purimex, Göttingen

Formulación

Tris 10 nM/ NaCl 135nM; pH  7

Montaje experimental (5 ratones/grupo):

1. péptidos de VHC

2. péptidos de VHC +KLK + o-d(IC)13 10

Los días 0, 14 y 28 se inyectó s.c., a ratones HHD.1 en las dos patas traseras un volumen total de 100 l/pata) conteniendo los compuestos enumerados anteriormente. El día 35 se aislaron (7 dias después de la última vacunación) linfocitos T CD4+ así como CD8+ por separación magnética (MACS, Miltenyi) de suspensiones de una sola célula de células de bazo. Se incubaron linfocitos T con medio (control de fondo) o se reestimularon con células de bazo irradiadas de ratones HHD.1 naturales como APC en presencia de o los péptidos diferentes usados para 15 vacunación o el péptido frecuente p1.274. después de incubación durante la noche, se analizó la producción de IFN- usando un ensayo ELIspot.

La figura 1 muestra que en la inyección conjunta de los cinco péptidos procedentes de HVC con KLK/o-d(IC)13 se

indujeron altas cantidades de IFN- producido por linfocitos T CD4+ contra p84, p87, p89, p1.426. Además, fue detectable una fuerte producción de IFN- por linfocitos T CD8+ contra p87, p89.

Ejemplo V: Solubilización de mezclas de péptidos (Péptidos de VHC más poli-L-arginina):

La mezcla de péptidos contiene los péptidos 83, 84, 87, 89, 1.426 y pR como inmunizante (véase la tabla 4), en la que los péptidos 83 y 84 son solubles en agua y DMSO, los péptidos 87 y 89 son poco solubles en agua pero se 5 disuelven fácilmente en DMSO y el péptido 1.426 sólo es soluble en DMSO. Para la fabricación de una formulación de suspensión es necesario primero disolver los péptidos 83 y 84 en una disolución acuosa de tampón y los péptidos 87, 89 y 1.426 en DMSO. Después de filtración estéril se pueden combinar las disoluciones para formar la suspensión final.

Las mezclas de agua/acetonitrilo así como DMSO y DMF no funcionaron como disolventes y dieron como 10 resultado suspensiones que no se podían filtrar estériles debido a bloqueo del filtro. Sorprendentemente, se encontró que una mezcla de ácido acético/agua al 50% disolvía todos los componentes. La disolución de péptidos obtenida que contenía los péptidos mencionados anteriormente se pudo filtrar estéril fácilmente sin bloqueo del filtro.

Tabla 4 Mezcla de péptidos I

Péptido ID

Secuencia de péptidos

83

KFPGGGQIVGGVYLLPRRGPRL

84

GYKVLVLNPSVAAT

87

DLMGYIPAV

89

CINGVCWTV

1.426

HMWNFISGIQYLAGLSTLPGNPA

15

Los siguientes ejemplos (ejemplos V.1 a V.12, tablas 5 a 16) ilustran que las mezclas de péptidos que contienen al menos dos péptidos con longitud variable y composición de aminoácidos son adecuadas para solubilizarse de acuerdo con la presente invención. Además las tablas muestran las afinidades conocidas de los péptidos para moléculas de clase I y clase II de HLA.

Ejemplo V.1: 20

Ejemplo V.2:

Ejemplo V.3:

Ejemplo V.4: 5

Ejemplo V.5:

Ejemplo V.6:

Ejemplo V.7:

Ejemplo V.8: 5

Ejemplo V.9:

Ejemplo V.10:

Ejemplo V.11:

5

Ejemplo V.12:

Ejemplo VI. Fundamento en diseño de variantes de vacuna contra el VHC adicionales de acuerdo con la presente invención

La combinación preferida de puntos calientes I consta de 12 péptidos procedentes de regiones conservadas (>80% en genotipos 1,2,3) de 5 diferentes antígenos de VHC. En total se extienden al menos 8 alelos de clase I de HLA importantes (1-8 veces, cada una), proporcionando una extensión de población de 83-91% en Europa, 89-91% en EE.UU. en Caucasianos y 87-89% en gente japonesa (estimado sobre números de estudios de frecuencia HLA en Gjertson y Terasaki, eds., HLA 1.998; American Society of Histocompatibility and Immunogenetics, Lenexa, 5 kasas, USA). Similarmente, se extienden los diversos alelos de clase II importantes, la mayoría por denominados péptidos promiscuos (unión a más de un alelo de clase II de HLA). Los alelos frecuentes en particular individuales (DR1, 4, 7, 11) se extienden independientemente 6-8 veces. En gran medida, DR11 se extiende 7 veces. La presencia de este alelo se ha unido ala recuperación espontánea de infección por VHC (Thursz et al., 1.999 Lancet: 354 (9.196): 2.19-24). El alto número de epítopos contenidos en esta combinación de puntos calientes asegura no 10 sólo una amplia extensión de población y por lo tanto aplicabilidad de la vacuna, sino también una amplia respuesta inmunitaria en individuos tratados con dicha combinación. Este es un requisito previo para eficacia puesto que la recuperación espontánea de infección por VHC se ha unido a una amplia respuesta inmunitaria dirigida típicamente contra 10 o más epítopos (Dav et al., 2.002 J. Virol. 76 (24): 12.584-95).

Una respuesta de los linfocitos T contra múltiples epítopos también reduce el riesgo de desarrollo de variantes de 15 escape de epítopo de VHC (virus de VHC, que no contienen el epítopo diana por la respuesta inmunitaria) debido a que cuando más epítopos diana haya al mismo tiempo más difícil para el virus cambiarlos simultáneamente. Los experimentos en chimpancés han establecido que dichas variantes de escape de VHC son un mecanismo importante para mantener la infección crónica (Weiner et al., 1.995 Proc Natl Acad Sci USA:92(7): 2.755-9).

Finalmente, fijar como objetivo la mayoría de los antígenos de VHC (Core, E2, NS3, 4,5) en vez de por ejemplo 20 sólo uno proporciona también ventajas significativas: diferentes antígenos s e pueden reconocer de manera diferente por linfocitos T, por ejemplo debido a diferencias en el tratamiento del antígeno o dictadas por el haplotipo HLA particular de la persona). También, diferentes antígenos presentan diferente importancia funcional durante el ciclo de vida de VHC.

La combinación de puntos calientes I contiene también epítopos individuales procedentes de puntos calientes 25 (Ipep87 procedentes de Ipep87EX e Ipep89 procedente de Ipep89EX). Esto presenta la ventaja de un enfoque deliberado de la respuesta deseada en un epítopo particular. Usar por ejemplo Ipep89 garantiza que se genere una respuesta de CTL restringida de HLA-A2 mientras que usar 89EX puede conducir a una respuesta de CTL restringida de HLA-A2, que se puede ver comprometida por una respuesta auxiliar T restringida de DR4 o DR7 concomitante. 30

Usar combinaciones de puntos calientes presenta una serie de ventajas sobre usar antígenos de longitud completa, bien en forma de proteínas recombinantes o como vacunas de ADN. Como se detalla en el párrafo precedente en ciertos casos usar epítopos individuales puede ser ventajoso sobre usar el punto caliente del antígeno completo. Segundo, los puntos calientes descritos en la presente memoria se han identificado por ensayos funcionales usando principalmente una reacción de tipo Th1/Tc1 (es decir, interferón gamma) como lectura de 35 salida. Se sabe que los antígenos no sólo contienen dichos epítopos agonistas, pero también pueden codificar ligandos antagonistas. Dichos antagonistas presentes potencialmente en antígenos completos, pero ausentes en puntos calientes pueden impedir la inmunogenicidad y eficacia de la vacuna. A continuación, los antígenos completos inducirán casi ciertamente una respuesta inmunitaria humoral. Dicha respuesta de los anticuerpos tiene poco efecto per se en el VHC que reside en las células, pero puede comprometer seriamente la deseada respuesta 40 de los linfocitos T. Los puntos calientes debido a su longitud restringida, presentan una probabilidad mucho menor a inducir respuestas de anticuerpos no deseadas. Finalmente, sólo partes relativamente pequeñas de antígenos de VHC se conservan entre diferentes genotipos. Así, los antígenos completos usados en una vacuna pueden inducir respuestas contra regiones no conservadas o epítopos, no frecuentes para la mayoría de los pacientes. Por el contrario, los puntos calientes descritos en la presente memoria proceden de regiones conservadas >80% entre los 45 principales genotipos 1, 2 y 3 de VHC.

La combinación preferida de puntos calientes II consta de 7 péptidos procedentes de regiones conservadas (>80% en genotipos 1, 2, 3) de 5 antígenos de VHC diferentes. En total al menos se extienden 7 alelos de clase I de HLA importantes (1-5 veces), proporcionando una extensión de población de 81-90% en Europa, 89-91% en 5 caucasianos de EE.UU. y 85-88% en gente japonesa (estimado en números de estudios de frecuencia de HLA en Gjertson y Terasaki eds., HLA 1.998. American Society of Histocompatibility and Immunogenetics,Lenexa, Kansas, USA). Similarmente, se extienden diversos alelos de clase II de HLA importantes, la mayoría por péptidos denominados promiscuos (unión a más de un alelo de clase II de HLA). Se extienden independientemente alelos particularmente frecuentes individuales (DR1, 4, 7, 11) 5-6 veces. En gran parte, se extiende DR11 5 veces. La 10 presencia de este alelo se ha unido a la recuperación espontánea de infección por VHC (Thursz et al., 1.999 Lancet: 354 (9.196): 2.119-24).

Por comparación con la combinación I, la combinación II presenta un número menor distinto de péptidos (7 frente a 12), que presenta ventajas potenciales en la fabricación, formulación y producción competitiva de dicho producto. Lo más importante, sólo queda un péptido con una cadena lateral de cisteína (1.846). Por lo tanto, sólo se podrían 15 formar homodímeros de 1.846, pero no heterodímeros u oligómeros en esta combinación.

Al mismo tiempo, la combinación II extiende los mismos 5 antígenos de VHC y un número similar de alelos de tanto clase I de HLA como II como combinación I. Por lo tanto, los argumentos discutidos en la sección previa se mantienen también verdaderos para la combinación II.

Desde un punto de vista de desarrollo de formulación, la combinación II presenta diversas ventajas sobre la 20 combinación I (sólo 7 en vez de 12 componentes). Lo más importantemente, sólo un péptido (1846) soporta una cadena lateral de cisteína libre. Así, sólo se podrían formar homodímeros de 1846, pero no hetero- u oligómeros.

Ejemplo VII: resultados de inmunogenicidad de linfocitos T a partir de prueba de optimización de 102 dosis de vacuna contra el VHC

Durante el transcurso de un estudio clínico una serie de mezclas de péptido/poliarginina se aplicó como vacuna a voluntarios sanos. Cada grupo consistió en 12individuos, positivos para HLA-A2. los individuos recibieron 4 vacunaciones en intervalos mensuales (en 3 a 6 visitas). La sangre para análisis inmunológico se extrajo en 1 a 6 visitas un mes después de la última vacunación (visita 7) y 3 meses después de la última vacunación (visita 8). Para controlar los estudios clínicos, Intercell ha establecido ensayos de linfocitos T del estado de la técnica para 5 determinar criterios inmunológicos bajo adhesión al tratamiento GLP/GCP: Ensayo ELIspot de Interferón-gamma Ensayo de Proliferación de linfocitos T, ensayo de tetrámero HLA/FACS. Estos ensayos permiten mediciones fiables de respuestas de linfocitos T específicas del epítopo inducidas por la vacuna contra el VHC terapéutica. Las respuestas inmunitarias de linfocitos T inducidas por la vacuna sirven como parámetros de sustitución de la eficacia (Keilholz et al., J Immunother, marzo-abril de 2.002;25 (2): 97-138). 10

Como criterio primario se determinó la inmunogenicidad de linfocitos T por un ensayo de proliferación de linfocitos T:

El ensayo de proliferación permite la detección de linfocitos T específicas de los péptidos en muestras biológicas como sangre humana. La base del ensayo es que en la estimulación con un péptido específicamente reconocido por su receptor de linfocitos T reacciona por secreción de citocinas y proliferación posterior. La proliferación de células 15 se puede medir por una variedad de medios; entre las propuestas más sensibles se clasifica la incorporación de timidina marcada radiactivamente en ADN sintetizado previamente ala división celular. Esta reacción se puede realizar en una placa de 96 pozos. Cada pozo contiene un número fijado de células, que son cultivadas en presencia de antígeno/péptido durante un par de días. Para las últimas 16-20 horas se añade la timidina marcada con tritio (3H-timidina). Se recogen después las células en una placa de filtro: se elimina por lavado el medio que contiene 20 radioactividad libre mientras que el ADN se pega al filtro. La radiactividad incorporada se puede cuantificar por medio de contador de centelleo beta. La salida normal se da como cuentas por minuto (cpm).

Como criterios principales secundarios se determinó la inmunogenicidad de linfocitos T por ELIspot de interferón gamma

ELIspot permite la cuantificación de linfocitos T funcionales (es decir, secreción de citocinas), específicas del 25 péptido en muestras biológicas como sangre humana. La base del ensayo es que los linfocitos T en la estimulación con un péptido específicamente reconocido por el receptor de linfocitos T reacciona por secreción de citocinas como IFN-gamma. Esta reacción se puede realizar en una placa de 96 pozos. Los pozos de filtro de esa placa se recubren con un Mab específico para IFN-gama. Como consecuencia, cada célula que segrega IFN- gamma deja una mancha de IFN-gamma que se puede visualizar con una reacción de color posterior. Las manchas se pueden contar usando 30 lectores de placas automatizados. Los números obtenidos son una medida de la frecuencia de linfocitos T que segregan IFN-gama, específicas de los péptidos en la muestra.

Como criterio principal secundario adicional se realizó análisis de tetrámero HLA/FACS.

Los tetrámeros de clase I de HLA, formas recombinantes solubles de un complejo de molécula de HLA y péptido antigénico, se unen a receptor de linfocitos T específico de antígeno usado para reconocimiento de linfocitos T. 35 Mediante el uso de citometría de flujo con tetrámeros fluorescentes se pueden enumerar y caracterizar con fiabilidad linfocitos T CD8+ específicos del antígeno. El ensayo usa tetrámeros iTag hechos personalizadamente de HLA-A*0201 producidos por Beckman Coulter Immunomics complejados con epítopos de clase I de vacuna contra el VHC.

Los individuos se clasificaron como respondedores si mostraban respuestas de linfocitos T significativas en 40 cualquiera de las visitas 4 a 8 y no presentaban respuesta previa al tratamiento.

Se consiguieron Índices Respondedores Máximos (contra cualquier péptido, en cualquiera de las visitas 4 a 8, en cualquiera de los tres ensayos de linfocitos T de hasta 92% frente al 25% en un grupo de control de 25 individuos que recibieron disolución salina.

Índices Respondedores por péptidos Ipep89, Ipep84 e Ipep1426: 45

Como ejemplo se muestran aquí las respuestas frente a péptidos de sitios calientes de epítopos de linfocitos T Ipep89 (epítopo de linfocitos T de clase I), Ipep84 e Ipep1426. estas respuestas se obtuvieron después de un ciclo de 4 vacunaciones mensuales. Para el grupo B la vacuna contenía poli-L-Arginina sólo. Para el Grupo C la vacuna contenía una mezcla de 5 péptidos, incluyendo Ipep89, Ipep84 e Ipep1426. Para el Grupo G la vacuna contenía una mezcla de 5 péptidos como en el Grupo C más poli-L-Arginina como adyuvante de linfocitos T completamente 50 sintético. La Tabla 19 muestra que en el grupo de control B no se observan respondedores en los análisis ELIspot y tetrámero-HLA/FACS y 3 respondedores con, en total, sólo 3 visitas positivas. Lo último se puede interpretar como el índice de respondedores falsos positivos obtenidos en el ensayo de proliferación.

En el Grupo C que contiene péptidos sólo pero no poli-L-Arginina, se observó 1 respondedor frente a Ipep84 en ELIspot, 5 y 4 respondedores frente a Ipep84 e Ipep1426, respectivamente, en la proliferación y 4 respondedores frente a Ipep89 en análisis tetrámero-HLA/FACS. Finalmente el grupo G (mismos péptidos como en C más poli-L-arginina) mostró respondedores en los tres ensayos. En gran medida, las respuestas de ELIspot especialmente consistentes (los tres péptidos) y prolongadas (véase el número de visitas positivas totales) que dan una indicación 5 de linfocitos T funcionales fueron dependientes de poli-L-arginina como adyuvante de linfocitos T sintético.

**(Ver fórmula)**

5

10

15

20

25

30

Ejemplo de un tratamiento individual (ELIspot): individuo 5 del grupo C

La Tabla 20 muestra los resultados de ELIspot de interferón-gamma obtenidos de una serie de extracciones de sangre de un individuo particular del grupo G (5 péptidos+poli-L-arginina). En la visita 5, un mes después de la segunda vacunación ya mostraban respuestas los epítopos Ipep84, Ipep1426 de clase II. Después de la tercera 5 vacunación se alcanzó un máximo en todas las respuestas y también el epítopo Ipep89 de clase I mostró una respuesta. Por otra parte, Ipep1426 mostró una respuesta prolongada incluso 3 meses después de la última vacunación en la visita 8.

Tabla 20: valores de ELIspot de individuo 5 del grupo G) para Ipep89, 84, 1426 con el tiempo

(manchas por 1 millón PBMC, fondo sustraído; los valores no significativos se fijaron a cero))

Visita 1

Visita 3

Visita 4

Visita 5

Visita 6

Visita 7

Visita 8

Ipep89

0

0

0

0

22

0

0

Ipep84

0

0

0

18

45

0

0

Ipep1426

0

0

0

22

92

16

16

10

Referencias:

Aichinger G et al., 1.997, J. Biol.. Chem. 272: 29.127-29.136,

Ausubel FM et al., (autores), 2.001. Current Protocols in Molecular Biology, Volúmenes 1-4, John Wiley and Sons (editorial).

Bellentani S et al., Microbes Infect. Noviembre de 2.000; 2 (14) 1.757-63. 15

Bonifacino JS et al., (autores), 2.001. Current Protocols in Cell Biology, Volúmenes 1-2, John Wiley and Sons (editorial).

Cxomberg M et al., Curr Gastroenterol Rep. Febrero de 2.002; 4 (1): 23-30. Cox AL et al., 1.994. Science 264: 716-719

Coligan JE et al., (autores), 2.001. Current Protocols in Immunology, Volúmenes 1-4, John Wiley and sons 20 (editorial).

Farci P et al., Semin Liver Dis. 2.000; 20 (1): 103-26 Gavin MA et al., 1.993. J. Immunol. 151: 3.971-80

Gorga, JC et al., 1.987. J. Biol.. Chem. 262: 16.087-16.094. Heemels, MT et al., 1.995. Annu. Rev. Biochem. 64: 463-491 Kern F et al., 2.000. Eur. J Immun 30: 1.676-1.682

Kern F et al., 1.999. J. Virol. 73 (10): 8.179-8.184 25

Klein, J. 1.986. Natural History of the MHC, John Wiley and Sons (editorial).

Kronenberg M et al., 1.999. Immunol. Today 20: 515-21.

Kwok WW et al., 2.001. Trends Immunol. 22 (11): 583-588.

Lalvani A et al., 1.997. J. Exp. Med. 186 (6): 859-865.

Liang TJ et al., Ann Intern Med. 15 de Febrero de 2.000; 132 (4): 296-305. 30

Maecker HT et al., 2.001. J Immunol Methods 255: 27-40

Nijman HW et al., 1.993. Eur. J. Immunol., 6, 1.215-9

Novak N et al., 2.001. J. Immunol. 166: 6.665-6.670.

Parker, KC et al., 1.994. J. Immunol. 152: 163.

Rammensee, HG et al., 1.999. Immunogenetics 50: 213-219

Stern LJ et al., 1.994. Structure 2: 245-251

Sturniolo T et al., 1.999. Nature Biotechnology 17: 555-562.

Tobery WT et al., 2.001 J. Immunol. Methods 254: 59-66. 5

Valli A et al., 1.993, J. Clin. Invest. 91: 616-628

Van der Erynde BJ, et al., 1.997. Curr Opin Immunol. 5: 684-93

Villadangos JA et al., 2.000. Immunity 12: 233-239

Ward S et al., Clin Exp Immunol. Mayo de 2.002; 128 (2): 195-203.

Wilson DB et al., 1.999. J. Immunol. 163: 6.424-6.434. 10




Reivindicaciones:

1. Vacuna contra el virus de la hepatitis C (VHC) que comprende al menos los tres péptidos siguientes:

a) AYAAQGYKVLVLNPSVAAT o una parte del mismo que contiene al menos un epítopo y

b) GEVQVVSTATQSFLATCINGVCWTV o una parte del mismo que contiene al menos un epítopo y

c) HMWNFISGIQYLAGLSTLPGNPA o una parte del mismo que contiene al menos un epítopo. 5

2. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende los siguientes péptidos:

GYKVLVLNPSVAAT,

DLMGYIPAV,

CINGVCWTV y

HMWNFISGIQYLAGLSTLPGNPA 10

3. Vacuna contra el VHC según la reivindicación 1 ó 2, caracterizada porque comprende el péptido KFPGGGQIVGGVYLLPRRGPRLGVRATRK.

4. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido DLMGYIPAV.

5. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido CINGVCWTV como un epítopo que contiene parte de GEVQVVSTATQSFLATCINGVCWTV. 15

6. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido HMWNFISGIQYLAGLSTLPGNPA.

7. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido GYKVLVLNPSVAAT como un epítopo que contiene parte de AYAAQGYKVLVLNPSVAAT.

8. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 7, caracterizada porque contiene 20 además un péptido inmunoestimulador que comprende una secuencia R1-XZXZNXZX-R2, en la cual N es un número entero entre 3 y 7, de preferencia 5, X es un resto de aminoácido natural y/o no natural cargado positivamente, Z es un resto de aminoácido seleccionado del grupo constituido por L, V, I, F y/o W y R1 y R2 se seleccionan independientemente uno de otro del grupo constituido por -H, -NH2, -COCH3, -COH, un péptido con hasta 20 restos de aminoácido o un grupo reactivo peptídico o un conector peptídico con o sin péptido; X-R2 puede ser una amida, 25 éster o tioéster del resto de aminoácido C-terminal del péptido (“Péptido A”).

9. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 8, caracterizada porque contiene además una molécula de ácido oligodesoxinucleico (ODN) inmunoestimuladora con la estructura de acuerdo con la fórmula (I).

30

en la que:

R1 se selecciona de hipoxantina y uracilo,

cualquier X es O o S,

cualquier NMP es un monofosfato o monotiofosfato de 2' desoxinucleósido, seleccionado del grupo constituido por monofosfato o monotiofosfato de desoxiadenosina, desoxiguanosina, desoxiinosina, desoxicitosina, desoxiuridina, desoxitimidina, 2-metil-desoxiinosina, 5-metil-desoxicitosina, desoxipseudouridina, desoxiribosapurina, 5 2-amino-desoxiribosapurina, 6-S-desoxiguanina, 2-dimetil-desoxiguanosina o N-isopentenil-desoxiadenosina,

NUC es un 2' desoxinucleósido, seleccionado del grupo constituido por desoxiadenosina, desoxiguanosina, desoxiinosina, desoxicitosina, desoxiinosina, desoxitimidina, 2-metil-desoxiuridina, 5-metil-desoxicitosina, desoxipseudouridina, desoxiribosapurina, 2-amino-desoxiribosapurina, 6-S-desoxiguanina, 2-dimetil-desoxiguanosina o N-isopentenil-desoxiadenosina, 10

a y b son números enteros de 0 a 100 con la condición de que a + b esté entre 4 y 150 y

B y E sean grupos comunes para los extremos 5' o 3' de moléculas de ácidos nucleicos (“I-/U-ODN”).

10. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 9, caracterizada porque contiene además un adyuvante de Al(OH)3.

11. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 10, caracterizada porque contiene 15 además un péptido policatiónico inmunoestimulador.

12. Vacuna contra el VHC según una cualquiera de las reivindicaciones 8 a 11, caracterizada porque dicho Péptido A es KLKL5KLK.

13. Vacuna contra el VHC según una cualquiera de las reivindicaciones 9 a 12, caracterizada porque dicho I-/U-ODN es oligo d(IC)13. 20

14. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 13, caracterizada porque contiene además un oligodesoxinucleótido inmunoestimulador que contiene un motivo CpG.

15. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 14, caracterizada porque está liofilizada en una forma que es reconstituible en 15 min a 37ºC.

16. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 15, caracterizada porque contiene 25 entre 20 g y 10 mg de cada péptido.

17. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 16, caracterizada porque está liofilizada y contiene trazas de ácido acético.

18. Uso de una vacuna según una cualquiera de las reivindicaciones 1 a 17, para la preparación de un medicamento para la prevención y el tratamiento de una infección por VHC. 30

19. Procedimiento para la preparación de una vacuna según una cualquiera de las reivindicaciones 1 a 17, caracterizado por las siguientes etapas:

- sintetizar químicamente los al menos tres péptidos como están definidos en las reivindicaciones 1 a 17,

- solubilizar estos péptidos mediante una disolución acuosa que contenga al menos un ácido orgánico seleccionado del grupo constituido por ácido fórmico, ácido acético, ácido propiónico, ácido butírico y formas 35 halogenadas o hidroxiladas de los mismos,

- mezclar los péptidos solubilizados y

- liofilizar opcionalmente los péptidos mezclados.






Acerca de · Contacto · Patentados.com desde 2007 hasta 2014 // Última actualización: 22/09/2014.