Vacuna contra el virus de la hepatitis C (VHC) que comprende al menos los tres péptidos siguientes: a) AYAAQGYKVLVLNPSVAAT o una parte del mismo que contiene al menos un epítopo y b) GEVQVVSTATQSFLATCINGVCWTV o una parte del mismo que contiene al menos un epítopo y c) HMWNFISGIQYLAGLSTLPGNPA o una parte del mismo que contiene al menos un epítopo

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2004/007540.

Solicitante: INTERCELL AG.

Nacionalidad solicitante: Austria.


Inventor/es: .

Fecha de Publicación: .

Fecha Solicitud PCT: 9 de Julio de 2004.

Clasificación PCT:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/18 (Togaviridae, p. ej. Flavivirus, virus de la peste, virus de la fiebre amarilla, virus de la hepatitis C, virus de la encefalitis japonesa)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/29 (Virus de la hepatitis)

Clasificación antigua:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/18 (Togaviridae, p. ej. Flavivirus, virus de la peste, virus de la fiebre amarilla, virus de la hepatitis C, virus de la encefalitis japonesa)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/29 (Virus de la hepatitis)

Países PCT: Austria, Bélgica, Suiza, Alemania, Dinamarca, España, Francia, Reino Unido, Grecia, Italia, Liechtensein, Luxemburgo, Países Bajos, Suecia, Mónaco, Portugal, Irlanda, Eslovenia, Finlandia, Rumania, Chipre, Lituania, Letonia, Ex República Yugoslava de Macedonia, Albania.

google+ twitter facebookPin it

Fragmento de la descripción:

La presente invención se refiere a vacunas contra el VHC.

El sistema inmunitario es una compleja red de tipos de células y moléculas interrelacionadas, que se ha desarrollado para proteger organismos multicelulares de microorganismos infecciosos. Se puede dividir en inmunidad innata (o natural) en personas mayores evolutiva e inmunidad adaptativa (o adquirida). El sistema 5 inmunitario innato reconoce patrones, que son normalmente comunes y esenciales para los patógenos. Para este número limitado de estructuras moleculares se han desarrollado receptores codificados de la línea germinal. En comparación, las células del sistema inmunitario adaptativo - linfocitos B y T - pueden reconocer una enorme variedad de estructuras antigénicas. Los receptores, denominados según los tipos de células que los expresan, receptor de linfocitos B (BCR, sus versiones solubles se denominan anticuerpos) y receptor de linfocitos T (TCR, 10 sólo formas asociadas a la celular), 27, son generados por recombinación somática y muestran una distribución clonal. Así, inicialmente sólo hay un número pequeño de células con una cierta especificidad. Cuando el antígeno se encuentra con estas células empieza a dividirse (expansión clonal) para generar una población efectora capaz de hacer frente al antígeno. Después de la eliminación de antígeno una subpoblación especializada de células que reconoce específicamente este antígeno permanece como memoria inmunológica. Tomados juntos el sistema 15 inmunitario adaptativo está retardado (comparado con la inmunidad innata), sin embargo es específico y mejora con la exposición repetida a un patógeno/antígeno dado.

Los linfocitos T presentan un papel central en la inmunidad adaptativa. Sus receptores (los TCR) reconocen “complejo principal de histocompatibilidad” (MHC o HLA): complejos peptídicos en la superficie de las células. Estos péptidos se denominan epítopos de linfocitos T y representan productos de degradación de antígenos. Hay dos 20 clases principales de linfocitos T: los linfocitos T citotóxicos positivos CD8 (CTL) están restringidos al MHC de clase I. Los linfocitos T auxiliares (HTL) positivos CD4 están restringidos al MHC de clase II. Los HTL son esenciales para muchas características de inmunidad adaptativa: activación de las denominadas “células que presentan antígeno profesional” (las APC), conmutación de clase de inmunoglobulina (Ig), la reacción del centro germinal y maduración de la afinidad Ig, activación de CTL, memoria inmunológica, regulación de la respuesta inmunitaria y otras. 25

Las moléculas MHC recogen péptidos dentro de la célula y los presentan en la superficie de las células en los TCR de los linfocitos T. Hay dos clases principales de MHC, la clase I reconocida por CTL positivos CD8 y la clase II reconocida por HTL positivos CD4.

Las moléculas de MHC de clase I constan de una cadena alfa anclada en la membrana de 45 kDa y la b2-inmunoglobulina unida mediante enlaces no covalentes (b2m) de 12 kDa. La resolución de la estructura 30 tridimensional por cristalografía de rayos X (Stern and Wiley 1.994) revela que la cadena alfa posee una hendidura, que está cerrada en ambos extremos y tiene cabida para péptidos de 8 a 11 aminoácidos de longitud. Las moléculas de clase I se expresan de manera ubicua y los péptidos que presentan se originan de proteínas citoplasmáticas. Estas son degradadas por el proteosoma y los péptidos resultantes son transportados de manera activa al retículo endoplasmático (RE). Allí, con la ayuda de diversas carabinas, se forman complejos MHC:péptido y son 35 transportados a la superficie de las células (Heemels 1.995). Así, la clase I MHC se enfrenta al proteoma de una célula en su superficie y permite que los linfocitos T reconozcan patógenos intracelulares o células malignas.

Las moléculas de MHC de clase II constan de dos proteínas ancladas en la membrana (cadena alfa y beta) de 35 kDa y 30 kDa, respectivamente. Estas forman juntas una hendidura, abierta en ambos extremos, que puede tener cabida para péptidos de longitud variable, normalmente de 12 a 25 aminoácidos. A pesar de estas diferencias, las 40 moléculas de clase I y II poseen en común una similitud estructural sorprendente (Stern and Wiley 1.994). Las moléculas de clase II sólo se expresan en células dendríticas (DC) incluyendo APC profesional, linfocitos B y macrófagos/monocitos. Estas células están especializadas en absorber y tratar antígenos en la ruta endosómica. Inmediatamente después de su biosíntesis, las moléculas de clase II se complejan por la denominada cadena invariante (li), que evita la unión de péptidos en el RE. Cuando las vesículas que contienen complejos de clase II:li 45 se fusionan con productos de degradación que contienen endosomas, de antígeno exógeno, se degrada li hasta que la hendidura que une MHC sólo se compleja por el denominado péptido CLIP. Lo último es con ayuda de carabinas como HLA-DM intercambiado por péptidos antigénicos (Villadangos 2.000). Finalmente, los complejos MHC:péptido se presentan de nuevo en la superficie de las APC, que interactúan de numerosas formas con HTL.

Siendo tanto poligénico como extremadamente polimórfico, el sistema MHC es muy complejo. Para la cadena alfa 50 de clase I en seres humanos hay tres locus del gen denominados HLA-A, -B y –C. Igualmente, hay tres locus de cadena alfa de clase II (DRA, DQA, DPA); para los locus de cadena beta de clase II la situación es incluso más compleja ya que hay cuatro cadenas beta DR diferentes (DRB1,2,3,5) más DQB y DPB. Excepto DRA de cadena alfa de DR monomórfico, cada locus de genes está presente en muchos alelos diferentes (docenas a cientos) en la población (Klein 1.986). Los diferentes alelos presentan especificidades de unión en gran parte distintas para 55 péptidos. Los alelos se designan, por ejemplo, HLA-A*0201 o HLA-DRB1*0401 o HLA-DPA*0101/DPB*0401.

Se han identificado epítopos de linfocitos T por una variedad de propuestas (Van den Eynde 1.997). Se han usado por ejemplo líneas de linfocitos T y clones para cribar bibliotecas de expresión de ADNc por ejemplo en el contexto de células COS transinfectadas con la apropiada molécula HLA. Alternativamente, se han perseguido propuestas bioquímicas. Lo último implicaba la elución de ligandos naturales a partir de moléculas de MHC en la superficie de células diana, la separación de estos péptidos por diversas etapas cromatográficas, análisis de su 5 reactividad con linfocitos en ensayos de reconstitución de epítopos y secuenciación por espectrometría de masas (Wölfel et al., 1.994, Cox et al. 1.994).

Recientemente, la llegada de ensayos de detección de citocinas altamente sensibles como el ELIspot de IFN-gamma permitió usar linfocitos directamente ex vivo para el cribado de péptidos sintéticos superpuestos (Maecker 2.001, Kern 2.000, Tobery 2.001). Principalmente, Kern et al. (1.999 y 2.000) usaron series de conjuntos de péptidos 10 9meros superpuestos para mapear epítopos de linfocitos T CD8+ in vitro. Más tarde, Tobery et al. 2.001 modificaron esta propuesta y demostraron que se pueden usar conjuntos que contengan tantos como 64 péptidos 20meros para cribar epítopos de linfocitos T tanto CD8+ como CD4+ en ratones. Estos dos procedimientos estaban basados en el control de la respuesta específica del antígeno por medición de producción de IFN-gamma o por coloración intracelular (Kern et al 2.000) o en ensayo ELIspot (Tobery et al. 2.001). Mediante el uso de mezclas de 15-meros 15 las respuestas de los linfocitos T CD4+ son aproximadamente iguales a las detectadas cuando se usaba proteína soluble completa como antígeno,...



1. Vacuna contra el virus de la hepatitis C (VHC) que comprende al menos los tres péptidos siguientes:

a) AYAAQGYKVLVLNPSVAAT o una parte del mismo que contiene al menos un epítopo y

b) GEVQVVSTATQSFLATCINGVCWTV o una parte del mismo que contiene al menos un epítopo y

c) HMWNFISGIQYLAGLSTLPGNPA o una parte del mismo que contiene al menos un epítopo. 5

2. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende los siguientes péptidos:





3. Vacuna contra el VHC según la reivindicación 1 ó 2, caracterizada porque comprende el péptido KFPGGGQIVGGVYLLPRRGPRLGVRATRK.

4. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido DLMGYIPAV.

5. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido CINGVCWTV como un epítopo que contiene parte de GEVQVVSTATQSFLATCINGVCWTV. 15

6. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido HMWNFISGIQYLAGLSTLPGNPA.

7. Vacuna contra el VHC según la reivindicación 1, caracterizada porque comprende el péptido GYKVLVLNPSVAAT como un epítopo que contiene parte de AYAAQGYKVLVLNPSVAAT.

8. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 7, caracterizada porque contiene 20 además un péptido inmunoestimulador que comprende una secuencia R1-XZXZNXZX-R2, en la cual N es un número entero entre 3 y 7, de preferencia 5, X es un resto de aminoácido natural y/o no natural cargado positivamente, Z es un resto de aminoácido seleccionado del grupo constituido por L, V, I, F y/o W y R1 y R2 se seleccionan independientemente uno de otro del grupo constituido por -H, -NH2, -COCH3, -COH, un péptido con hasta 20 restos de aminoácido o un grupo reactivo peptídico o un conector peptídico con o sin péptido; X-R2 puede ser una amida, 25 éster o tioéster del resto de aminoácido C-terminal del péptido (“Péptido A”).

9. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 8, caracterizada porque contiene además una molécula de ácido oligodesoxinucleico (ODN) inmunoestimuladora con la estructura de acuerdo con la fórmula (I).


en la que:

R1 se selecciona de hipoxantina y uracilo,

cualquier X es O o S,

cualquier NMP es un monofosfato o monotiofosfato de 2' desoxinucleósido, seleccionado del grupo constituido por monofosfato o monotiofosfato de desoxiadenosina, desoxiguanosina, desoxiinosina, desoxicitosina, desoxiuridina, desoxitimidina, 2-metil-desoxiinosina, 5-metil-desoxicitosina, desoxipseudouridina, desoxiribosapurina, 5 2-amino-desoxiribosapurina, 6-S-desoxiguanina, 2-dimetil-desoxiguanosina o N-isopentenil-desoxiadenosina,

NUC es un 2' desoxinucleósido, seleccionado del grupo constituido por desoxiadenosina, desoxiguanosina, desoxiinosina, desoxicitosina, desoxiinosina, desoxitimidina, 2-metil-desoxiuridina, 5-metil-desoxicitosina, desoxipseudouridina, desoxiribosapurina, 2-amino-desoxiribosapurina, 6-S-desoxiguanina, 2-dimetil-desoxiguanosina o N-isopentenil-desoxiadenosina, 10

a y b son números enteros de 0 a 100 con la condición de que a + b esté entre 4 y 150 y

B y E sean grupos comunes para los extremos 5' o 3' de moléculas de ácidos nucleicos (“I-/U-ODN”).

10. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 9, caracterizada porque contiene además un adyuvante de Al(OH)3.

11. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 10, caracterizada porque contiene 15 además un péptido policatiónico inmunoestimulador.

12. Vacuna contra el VHC según una cualquiera de las reivindicaciones 8 a 11, caracterizada porque dicho Péptido A es KLKL5KLK.

13. Vacuna contra el VHC según una cualquiera de las reivindicaciones 9 a 12, caracterizada porque dicho I-/U-ODN es oligo d(IC)13. 20

14. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 13, caracterizada porque contiene además un oligodesoxinucleótido inmunoestimulador que contiene un motivo CpG.

15. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 14, caracterizada porque está liofilizada en una forma que es reconstituible en 15 min a 37ºC.

16. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 15, caracterizada porque contiene 25 entre 20 g y 10 mg de cada péptido.

17. Vacuna contra el VHC según una cualquiera de las reivindicaciones 1 a 16, caracterizada porque está liofilizada y contiene trazas de ácido acético.

18. Uso de una vacuna según una cualquiera de las reivindicaciones 1 a 17, para la preparación de un medicamento para la prevención y el tratamiento de una infección por VHC. 30

19. Procedimiento para la preparación de una vacuna según una cualquiera de las reivindicaciones 1 a 17, caracterizado por las siguientes etapas:

- sintetizar químicamente los al menos tres péptidos como están definidos en las reivindicaciones 1 a 17,

- solubilizar estos péptidos mediante una disolución acuosa que contenga al menos un ácido orgánico seleccionado del grupo constituido por ácido fórmico, ácido acético, ácido propiónico, ácido butírico y formas 35 halogenadas o hidroxiladas de los mismos,

- mezclar los péptidos solubilizados y

- liofilizar opcionalmente los péptidos mezclados.