Remedios para pénfigo que contienen anticuerpos contra el ligando Fas.

Compuesto seleccionado de

(i) un anticuerpo humano monoclonal, o un fragmento del mismo que se une a antígeno, específico para proteína de ligando Fas

(FasL) humano, en el que dicho anticuerpo monoclonal comprende al menos una región variable de cadena pesada y al menos una región variable de cadena ligera, en el que las secuencias de aminoácidos de las regiones determinantes de la complementariedad (CDRs) de la cadena pesada son: (a1) CDR H1: Arg His Gly Ile Thr (SEC ID NO:13), o

(a2) CDR H1: Ser His Gly Ile Ser (SEC ID NO:14),

(b1) CDR H2: Trp Ile Asn Ala Tyr Asn Gly Asn Thr Asn Tyr Ala Gln Lys Val Gln Gly (SEC ID NO:15),

o

(b2) CDR H2: Trp Ile Asn Ala Tyr Ser Gly Asn Thr Asn Tyr Ala Gln Lys Leu Gln Gly (SEC ID NO: 16),

(c1) CDR H3: Glu Thr Met Val Arg Gly Val Pro Leu Asp Tyr (SEC ID NO: 17) o

(c2) CDR H3: Glu Thr Met Val Arg Gly Val Pro Cys Asp Tyr (SEC ID NO: 18),

y las secuencias de aminoácidos de las regiones determinantes de la complementariedad (CDRs) de la cadena ligera son

(a3) CDR L1: Arg Ala Ser Gln Ser Val Ser Ser Ser Tyr Leu Ala (SEC ID NO: 19),

(b3) CDR L2: Gly Ala Ser Ser Arg Ala Thr (SEC ID NO: 20), (c3) CDR L3: Gln Gln Tyr Gly Ser Ser Pro Trp Thr (SEC ID NO: 21) y

(ii) un anticuerpo, o un fragmento del mismo que se une a antígeno, que reconoce el mismo epítopo en FasL humana como un anticuerpo que tiene una región variable de cadena ligera que comprende la secuencia de aminoácidos

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSR

ATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRT VAAPSVFIFP

y la región variable de cadena pesada que comprende la secuencia de aminoácidos

QVQLVQSGAEVKKPGASVKVSCKASGYIFIRHGITWVRQAPGQGLEWMGWINA

YNGNTNYAQKVQGRVTMTTDKSTSTAYMELRSLRSDDAAVYYCARETMVRGVP

LDYWGQGTLVTVSSASTKGPSVFPLA

o

QVQLVQSGAEVKKPGASVKVSCKASGYIFISHGISWVRQAPGQGLEWMGWINA

YSGNTNYAQKLQGRVTMTTDRSTSTAYMELRSLRSDDTAVYYCARETMVRGVP

CDYWGQGTLVTVSSASTKGPSVFPLA,

para uso en la prevención y/o tratamiento de pénfigo.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2009/067129.

Solicitante: Pincell Srl.

Nacionalidad solicitante: Italia.

Dirección: Via del Pozzo 71 41100 Modena ITALIA.

Inventor/es: MARCONI,ALESSANDRA, PINCELLI,CARLO.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/28 (contra receptores, antígenos celulares de superficie o determinantes celulares de superficie)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P17/00 (Medicamentos para el tratamiento de problemas dermatológicos)

PDF original: ES-2534799_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Remedios para pénfigo que contienen anticuerpos contra el ligando Fas

La presente invención se refiere al uso de antagonistas del ligando Fas humano (también denominado CD95L o Apo1L, y abreviado aquí en lo sucesivo como FasL), más particularmente al uso de anticuerpos humanizados frente a FasL para la prevención y/o tratamiento de enfermedades de la piel asociadas con acantólisis de queratinocitos, particularmente para la prevención y/o tratamiento de pénfigo.

El pénfigo es una afección de la piel ampollosa autolnmunltaria caracterizada por pérdida de adhesión queratlnocítlca debido a autoanticuerpos dirigidos contra proteínas desmosómicas (desmogleínas, dsg). El pénfigo tiene una distribución amplia en el mundo, con una Incidencia de aproximadamente 1-5 por 1. por año, y con una predominancia de las mujeres).

El pénfigo se caracteriza por pérdida de adhesión de queratinocitos suprabasales que termina en un proceso denominado acantólisis. La patogénesis del pénfigo está sufriendo una revisión importante, principalmente debido a que, además de anticuerpos anti-desmogleínas, un nuevo grupo de anticuerpos anti-receptor colinérgico puede inducir acantólisis (Kalish, 2). Además, se ha demostrado que el impedimento estérico solo no puede dar cuenta de la formación de ampollas con la unión antígeno-anticuerpo (Kitajima, 22). Además, se demostró que la formación de desmosomas no está inhibida por autoanticuerpos del pénfigo (PVIgG) que se unen a pénfigo, mientras que las conexiones desmosómicas se disocian 24-36 h después del tratamiento con PvIgG. Durante este tiempo, tiene lugar una serie de etapas de transducclón de señales disparadas por PVIgG.

Estas observaciones sugieren un papel para la apoptosls en el pénfigo. De hecho, el pénfigo es una enfermedad debido a la falta de adhesión celular (Payne AS et al, 1978), y se puede producir apoptosis en asociación con el desprendimiento celular (Marconi et al, 24). Estos conceptos están completamente confirmados por la detección de apoptosis en piel con pénfigo lesional. En particular, las células acantolíticas expresan los marcadores principales de la apoptosls (Wang X et al, 24). De forma más Interesante, también se encuentran núcleos de mareaje por TUNEL unidas al techo de la ampolla, sugiriendo la presencia de células apoptóticas en piel perilesional antes del desprendimiento. Además, en el borde de la lesión se detectan células apoptóticas que expresan Ig y caspasa-8 activada, en áreas en las que no es visible ninguna Interrupción de los contactos célula con célula (Wang X et I, 24). Estos datos demuestran definitivamente que, en el pénfigo, la apoptosls tiene lugar en queratinocitos antes de la acantólisis.

La apoptosis desempeña un papel fundamental en la regulación de la homeostasis celular, y está implicada en muchos procesos patofisiológicos. La apoptosis puede resultar tanto del desprendimiento de célula a célula (Rezgui et al, 2; Bergin et al, 2) como de la pérdida de interacción célula-matriz (Giancotti y Ruoslahti, 1999).

Fas (o FasR) es un miembro de la superfamilia de receptores de TNF que, al unirse con el ligando Fas (FasL), dispara la apoptosis en muchos sistemas celulares (Sharma et al, 2). La señalización ¡ntracelular de apoptosis inducida por Fas-FasL opera vía el reclutamiento de un número de moléculas adaptadoras tales como FADD (dominio de muerte asociado a Fas) y FLICE (ICE similar a FADD, caspasa 8), que a su vez es inhibida por FLIP (proteína inhibidora de FLICE) (Juo et al, 1998). La interacción Fas-FasL está implicada en los patomecanismos de varias afecciones inmunitarias-inflamatorias e infecciosas, tales como SIDA (Bahr et al, 1977) y lupus eritematoso sistémico (Kovacs et al, 1997). Las enfermedades cutáneas caracterizadas por una implicación de la ruta Fas-FasL incluyen enfermedad aguda de hospedante frente a injerto, necrólisis epidérmica tóxica y melanoma (Wehrli et al, 2). Además, se dio a conocer que se observan lesiones de tipo acantolíticas en queratinocitos cultivados tratados tanto con PVIgG como con anti-FasR, mientras que PvIgG induce el agrupamiento de FasR, FasL y caspasa-8 en la membrana celular varias horas después de la formación de las lesiones (Wang X et al, 24). Además, se dio a conocer que el inhibidor similar a caspasa-1 bloqueó significativamente la formación de ampollas en el modelo de ratón de pénfigo (Li et al, 26). Tomados en conjunto, estos datos indican que FasL y la ruta apoptótica extrínseca desempeñan un papel crítico en los mecanismos que subyacen a la acantólisis. Cualquiera que sea la naturaleza de los autoanticuerpos del pénfigo, la exposición a PVIgG aumenta la expresión de varios genes proapoptóticos, incluyendo FasL, muchas horas antes de la acantólisis. Además, IgG intravenosa (IVIgG) evita el aumento, inducido por PvIgG, de FasL y apoptosis en queratinocitos. IVIgG también evita la acantólisis y la apoptosis in vivo (Arredondo J et al, 25).

Puviani et al. (J. Investigative Dermatology, vol. 12, n° 1, enero 23, páginas 164-167) describen que la adición de anticuerpos neutralizantes anti-FasL inhibe parcialmente la apoptosis de queratinocitos Inducida por sueros con pénfigo in vitro. Puviani et al. no proporcionan ninguna prueba de un efecto sobre la acantólisis o de la eficacia in vivo de dichos anticuerpos.

Morrison Lynn (J. Am. Acad. Dermatol., vol. 51, n° 5, Noviembre 24, páginas 817-819) describen el uso del anticuerpo monoclonal anti-CD2, rituximab, en el tratamiento de pacientes con pénfigo vulgar. Morrison no describe anticuerpos frente al ligando Fas y tampoco su uso en el tratamiento de pénfigo.

Sin tratamiento, la mortalidad del pénfigo vulgar se aproxima a 1%. Es necesaria la terapia slstémica prematura para controlar el pénfigo, pero los efectos secundarios debidos a la terapia sistémica son una complicación

importante. El tratamiento incluye la administración de corticosteroides, medicaciones que contienen oro, el fármaco antiinflamatorio dapsona, o medicaciones que suprimen el sistema inmunitario (tal como azatioprina, metotrexato, ciclosporina, ciclofosfamida, o micofenolato mofetilo). El tratamiento más habitual para pénfigo es actualmente los esteroides, que necesitan ser administrados durante toda la vida y pueden provocar efectos secundarios graves. La mayoría de los pacientes con pénfigo mueren debido a estos efectos secundarios. Algunos antibióticos también son eficaces, particularmente minociclina y doxiciclina. Ocasionalmente se usa inmunoglobulina intravenosa (IVIg). La plasmaféresis es un proceso mediante el cual se elimina de la sangre plasma que contiene anticuerpos y se sustituye por fluidos intravenosos o plasma donado. La plasmaféresis se puede usar además de las medicaciones sistémicas para reducir la cantidad de anticuerpos en el torrente sanguíneo. También está bajo desarrollo un número de nuevas moléculas: micofenolato mofetilo, PI-824, PRTX-1, anti-CD2 son fármacos inmunosupresores que actúan sobre células T y B.

La tasa de mortalidad actual todavía oscila de 5 a 25%; la infección es la causa más frecuente de muerte, y la terapia inmunosupresora a largo plazo (principalmente corticosteroide) es uno de los factores significativos que todavía provocan una tasa elevada de mortalidad. La inmunoglobulina puede producir cierta mejora a corto plazo, pero no parece inducir remisiones duraderas, y su coste hace muy poco práctico el uso a largo plazo.

También hay varias advertencias en el uso de la plasmaféresis. Los pacientes suprimidos con prednisona u otros agentes inmunosupresores y que reciben plasmaféresis tienen un mayor riesgo de muerte repentina por septicemia. Además, el tratamiento es muy caro, y es necesario un período de hospitalización de 2... [Seguir leyendo]

 


Reivindicaciones:

1. Compuesto seleccionado de

(i) un anticuerpo humano monoclonal, o un fragmento del mismo que se une a antígeno, específico para proteína de ligando Fas (FasL) humano, en el que dicho anticuerpo monoclonal comprende al menos una región variable de cadena pesada y al menos una región variable de cadena ligera, en el que las secuencias de aminoácidos de las regiones determinantes de la complementariedad (CDRs) de la cadena pesada son:

(ai)

CDR

H1:

Arg

His Gly lie Thr (SEC ID NO:13), o

(32)

CDR

H1:

Ser

His Gly lie Ser (SEC ID NO:14),

(bi)

CDR

H2:

Trp

lie Asn Ala Tyr Asn Gly Asn Thr Asn Tyr Ala Gln Lys Val Gln

Gly

(SEC

ID

NO: 15),

U

(b2)

CDR

H2:

Trp

lie Asn Ala Tyr Ser Gly Asn Thr Asn Tyr Ala Gln Lys Leu Gln

Gly

(SEC

ID

NO: 16),

(C1)

CDR

H3:

Glu

Thr Met Val Arg Gly Val Pro Leu Asp Tyr (SEC ID NO: 17) o

O

to

CDR

H3:

Glu

Thr Met Val Arg Gly Val Pro Cys Asp Tyr (SEC ID NO: 18),

y las secuencias de aminoácidos de las regiones determinantes de la complementariedad (CDRs) de la cadena ligera son

(a3) CDR L1: Arg Ala SerGIn Ser Val Ser Ser Ser Tyr Leu Ala (SEC ID NO: 19),

(b3) CDR L2: Gly Ala Ser Ser Arg Ala Thr (SEC ID NO: 2), (c3) CDR L3: Gln Gln Tyr Gly Ser Ser Pro Trp Thr (SEC ID NO: 21) y

(¡i) un anticuerpo, o un fragmento del mismo que se une a antígeno, que reconoce el mismo epítopo en FasL humana como un anticuerpo que tiene una región variable de cadena ligera que comprende la secuencia de aminoácidos

EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSR ATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRT VAAPSVFIFP

y la reglón variable de cadena pesada que comprende la secuencia de aminoácidos

QVQLVQSGAEVKKPGASVKVSCKASGYIFIRHGITWVRQAPGQGLEWMGWINA

YNGNTNYAQKVQGRVTMTTDKSTSTAYMELRSLRSDDAAVYYCARETMVRGVP

LDYWGQGTLVTVSSASTKGPSVFPLA

o

QVQLVQSGAEVKKPGASVKVSCKASGYIFISHGISWVRQAPGQGLEWMGWINA

YSGNTNYAQKLQGRVTMTTDRSTSTAYMELRSLRSDDTAVYYCARETMVRGVP

CDYWGQGTLVTVSSASTKGPSVFPLA.

para uso en la prevención y/o tratamiento de pénfigo.

2. El compuesto para el uso según la reivindicación 1, en el que el compuesto es:

(i) un anticuerpo humano monoclonal, o un fragmento del mismo que se une a antígeno, específico para proteína de ligando Fas (FasL) humano, en el que dicho anticuerpo monoclonal comprende al menos una región variable de cadena pesada y al menos una reglón variable de cadena ligera, en el que las secuencias de aminoácidos de las reglones determinantes de la complementariedad (CDRs) de la cadena pesada son:

(a-i) CDR H1: Arg His Gly lie Thr (SEC ID NO: 13),

(bi) CDR H2: Trp lie Asn Ala Tyr Asn Gly Asn Thr Asn Tyr Ala Gln Lys Val Gln Gly (SEC ID NO: 15),

(d) CDR H3: Glu Thr Met Val Arg Gly Val Pro Leu Asp Tyr (SEC ID NO: 17),

y las secuencias de aminoácidos de las regiones determinantes de la complementariedad (CDRs) de la cadena ligera son

(a3) CDR L1: Arg Ala Ser Gln Ser Val Ser Ser Ser Tyr Leu Ala (SEC ID NO: 19),

(b3) CDR L2: Gly Ala Ser Ser Arg Ala Thr (SEC ID NO: 2),

(c3) CDR L3: Gln Gln Tyr Gly Ser Ser Pro Trp Thr (SEC ID NO: 21) para uso en la prevención y/o tratamiento de pénflgo.

3. El compuesto para el uso según la reivindicación 1, en el que el compuesto es:

(i) un anticuerpo humano monoclonal, o un fragmento del mismo que se une a antígeno, específico para 5 proteína de ligando Fas (FasL) humano, en el que dicho anticuerpo monoclonal comprende al menos una

región variable de cadena pesada y al menos una región variable de cadena ligera, en el que las secuencias de aminoácidos de las reglones determinantes de la complementariedad (CDRs) de la cadena pesada son:

(a2) CDR H1: Ser His Gly lie Ser (SEC ID NO: 14),

(b2) CDR H2: Trp lie Asn Ala Tyr Ser Gly Asn Thr Asn Tyr Ala Gln Lys Leu Gln Gly (SEC ID NO: 16),

(c2) CDR H3: Glu Thr Met Val Arg Gly Val Pro Cys Asp Tyr (SEC ID NO: 18),

y las secuencias de aminoácidos de las regiones determinantes de la complementariedad (CDRs) de la cadena ligera son

(a3) CDR L1: Arg Ala Ser Gln Ser Val Ser Ser Ser Tyr Leu Ala (SEC ID NO: 19),

(b3) CDR L2: Gly Ala Ser Ser Arg Ala Thr (SEC ID NO: 2),

(c3) CDR L3: Gln Gln Tyr Gly Ser Ser Pro Trp Thr (SEC ID NO: 21) para uso en la prevención y/o

tratamiento de pénflgo.

4. El compuesto para el uso según una cualquiera de las reivindicaciones 1 a 3, en el que el anticuerpo o un fragmento del mismo que se une a antígeno se selecciona de un anticuerpo parcial o totalmente humanizado, un anticuerpo monocatenarlo parcial o totalmente humanizado, o un fragmento del mismo.

5. El compuesto para el uso según una cualquiera de las reivindicaciones anteriores, en el que el compuesto se usa

en una terapia de combinación con al menos una terapia adicional eficaz frente a pénflgo.

6. El compuesto para el uso según la reivindicación 5, en el que el compuesto se usa en combinación con al menos un fármaco ¡nmunosupresor adicional, en particular con al menos un esteroide adicional.