Anticuerpo anti-adrenomedulina (ADM) o fragmento de anticuerpo anti-ADM o andamiaje proteico sin Ig anti-ADM para reducir el riesgo de mortalidad en un paciente que padece una enfermedad crónica o aguda o un estado agudo.

Anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS

, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente en el que dicho anticuerpo o fragmento se une a la parte del terminal N, aminoácidos 1-21, de adrenomedulina:

YRQSMNNFQGLRSFGCRFGTC; SEC. ID. nº 23.

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E12193118.

Solicitante: AdrenoMed AG.

Nacionalidad solicitante: Alemania.

Dirección: Neuendorfstrasse 15a 16761 Hennigsdorf ALEMANIA.

Inventor/es: BERGMANN, ANDREAS.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P31/00 (Antiinfecciosos, es decir antibióticos, antisépticos, quimioterápicos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P9/00 (Medicamentos para el tratamiento de trastornos en el aparato cardiovascular)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento del aparato urinario... > A61P13/12 (de los riñones)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/26 (contra hormonas)

PDF original: ES-2494190_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Anticuerpo anti-adrenomedulina (ADM) o fragmento de anticuerpo anti-ADM o andamiaje proteico sin Ig anti-ADM para reducir el riesgo de mortalidad en un paciente que padece una enfermedad crónica o aguda o un estado agudo.

Campo de la invención

El objeto de la presente exposición es un anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti- adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de una enfermedad crónica o aguda grave o de un estado agudo de un paciente para la reducción del riesgo de mortalidad para dicho paciente.

Antecedentes

El péptido adrenomedulina (ADM) se describió por primera vez en 1993 (Kitamura, K., et al., "Adrenomedullin: A Novel Hypotensive Peptide Isolated From Human Pheochromocytoma", Biochemical and Biophysical Research Communications, vol. 192 (2), págs. 553-560 (1993)) como nuevo péptido hipotensor que comprende 52 aminoácidos, que había sido aislado a partir de un feocromocitoma humano; SEC. ID. n° 21. En el mismo año, se describieron también el ADNc que codifica un péptido precursor que comprende 185 aminoácidos y la secuencia de aminoácidos completa de este péptido precursor. El péptido precursor, que comprende, entre otras cosas, una secuencia señal de 21 aminoácidos en el extremo del terminal en N, es conocido como "preproadrenomedulina" (pre-proADM). En la presente descripción, todas las posiciones de los aminoácidos especificados por lo general se refieren a la pre-proADM que comprende los 185 aminoácidos. El péptido adrenomedulina (ADM) es un péptido que comprende 52 aminoácidos (SEC. ID. n° 21) y que comprende los aminoácidos 95 a 146 de la pre-proADM, de la que se forma por escisión proteolítica. Hasta la fecha, sustancialmente sólo unos pocos fragmentos de los fragmentos peptídicos formados en la escisión de la pre-proADM se han investigado más exactamente, en particular, la péptidos fisiológicamente activos adrenomedulina (ADM) y "PAMP", un péptido que comprende 20 aminoácidos (22-41) que sigue a los 21 aminoácidos del péptido señal en la pre-proADM. El descubrimiento y caracterización de ADM en 1993 desencadenó intensa actividad de investigación, cuyos resultados se han resumido en diversos artículos de revistas, en el contexto de la presente descripción, haciendo referencia en particular a los artículos que se encuentran en un número de "Peptides "dedicado a ADM en particular (Editorial, Takahashi, K., "Adrenomedullin: from a pheochromocytoma to the eyes", Peptides, vol. 22, pág. 1691 (2001)) y (Eto, T., "A revlew of the blologlcal properties and clinical implications of adrenomedullin and proadrenomedullin N-terminal 20 peptide (PAMP), hypotensive and vasodilating peptides", Peptides, vol. 22, págs. 1693-1711 (2001)). Una nueva reseña es (Hlnson, et al., "Adrenomedullin, a Multifunctional Regulatory Peptide", Endocrine Reviews, vol. 21(2), págs. 138-167 (2000)). En las investigaciones científicas hasta la fecha, se ha descubierto, entre otras cosas, que ADM puede considerarse como un péptido regulador polifuncional. Se libera en la circulación en una forma inactiva extendida por la glicina (Kitamura, K., et al., "The intermedíate form of glycine-extended adrenomedullin is the major circulating molecular form ¡n human plasma", Biochem. Biophys. Res. Commun., vol. 244 (2), págs. 551-555 (1998). Sólo resumen). Existe también una proteína de unión (Pió, R., et al., "Complement Factor H is a Serum-binding Protein for adrenomedullin, and the Resulting Complex Modulates the Bioactivities of Both Partners", The Journal of Blologlcal Chemistry, vol. 276(15), págs. 12292-12300 (2001)) que es específico para ADM y probablemente del mismo modo modula el efecto de ADM. Esos efectos fisiológicos de ADM, así como de PAMP, que son de vital importancia en las investigaciones hasta la fecha eran los efectos que influyen en la presión arterial.

Por consiguiente, ADM es un vasodilatador eficaz, y por lo tanto es posible asociar el efecto hipotensor con los segmentos peptídicos específicos en la parte del terminal C de ADM. Además, se ha constatado que el péptido PAMP más fisiológicamente activo mencionado anteriormente formado a partir de pre-proADM presenta asimismo un efecto hipotensor, incluso si parece que tiene un mecanismo de acción diferente del de ADM (véase además de los artículos de la reseña antes citados (Eto, T., "A review of the biological properties and clinical implications of adrenomedullin and proadrenomedullin N-terminal 20 peptide (PAMP), hypotensive and vasodilating peptides", Peptides, vol. 22, págs. 1693-1711 (2001)) y (Hinson, et al., "Adrenomedullin, a Multifunctional Regulatory Peptide", Endocrine Reviews, vol. 21(2), págs. 138-167 (2000)) también (Kuwasako, K., et al., "Purification and characterization of PAMP-12 (PAMP-20) in porcine adrenal medulla as a major endogenous biologically active peptide ", FEBS Lett, vol. 414(1), págs. 105-110 (1997). Resumen solamente), (Kuwasakl, K., et al., "Increased plasma proadrenomedullin N-terminal 20 peptide in patients with essential hypertension", Ann. Clin. Biochem., vol. 36 (Pt. 5), págs. 622-628 (1999). Resumen solamente) o (Tsuruda, T., et al., "Secretion of proadrenomedullin N-terminal 20 peptide from cultured neonatal rat cardiac cells", Life Sci., vol. 69 (2), págs. 239-245 (2001). Resumen solamente) y el documento EP-A2 0 622 458). Además, se ha constatado que las concentraciones de ADM que se pueden medir en la circulación y otros líquidos biológicos son, en numerosos estados patológicos, significativamente superiores a las concentraciones que se encuentran en las personas de referencia sanas. Por lo tanto, la concentración de ADM en pacientes con insuficiencia cardíaca congestiva, infarto de miocardio, enfermedades renales, trastornos de hipertensión, diabetes mellitus, en la fase aguda de choque y en la septicemia y el choque septlcémlco aumentan significativamente, aunque en diferentes grados. Las concentraciones PAMP también aumentan en algunos de dichos estados patológicos, pero las concentraciones en el plasma son Inferiores en relación con ADM ((Eto, T., "A review of the biological properties and clinical Implications of adrenomedullin and

proadrenomedullin N-terminal 20 peptide (PAMP), hypotensive and vasodilating peptides", Peptides, vol. 22, págs. 1693-1711 (2001)); página 1702). Se sabe además que raras veces se observan altas concentraciones de ADM en septicemia, y las mayores concentraciones en el choque septicémico (véase (Eto, T., "A review of the biological properties and clinical implications of adrenomedullin and proadrenomedullin N-terminal 20 peptide (PAMP), hypotensive and vasodilating peptides", Peptides, vol. 22, págs. 1693-1711 (2001)) e (Hirata, et al., "Increased Circulating Adrenomedullin, a Novel Vasodilatory Peptide, in Sepsis", Journal of Clinical Endocrinology and Metabolism, vol. 81(4), págs. 1449-1453 (1996.)), (Ehlenz, K., et al., "High levels of circulating adrenomedullin in severe illness: Correlation with C-reactive protein and evidence against the adrenal medulla as site of origin", Exp. Clin. Endocrino!. Diabetes, vol. 105, págs. 156-162 (1997)), (Tomoda, Y., et al., "Regulation of adrenomedullin secretion from cultured cells", Peptides, vol. 22, págs. 1783-1794 (2001)), (Ueda, S., et al., "Increased Plasma Levels of Adrenomedullin in Patients with Systemic Inflammatory Response Syndrome", Am. J. Respir. Crit. Care Med., Vol. 160, págs. 132-136 (1999)) y (Wang, P., "Adrenomedullin and cardiovascular responses in sepsis", Peptides, vol. 22, págs. 1835-1840 (2001))).

Es conocido en la técnica además un método para identificar inmunorreactividad de adrenomedulina en líquidos biológicos para diagnóstico y, en particular en el ámbito del diagnóstico de septicemia, diagnóstico... [Seguir leyendo]

 


Reivindicaciones:

1. Anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente en el que dicho anticuerpo o fragmento se une a la parte del terminal N, aminoácidos 1-21, de adrenomedulina:

YRQSMNNFQGLRSFGCRFGTC; SEC. ID. n° 23.

2. Anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente según la reivindicación 1, en el que dicho anticuerpo, fragmento de anticuerpo o andamiaje sin Ig es monoespecífico.

3. Anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o el andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente según cualquiera de las reivindicaciones 1 o 2, en el que dicho anticuerpo, fragmento o andamiaje presenta una afinidad de unión a ADM de por lo menos 10'7 M.

4. Anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente según cualquiera de las reivindicaciones 1 a 3, en el que dicho anticuerpo, fragmento o andamiaje no es la proteína-1 de unión a ADM, factor Fl del complemento.

5. Anticuerpo anti-ADM o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 1 a 4, en el que dicho anticuerpo, fragmento o andamiaje reconoce y se une al extremo terminal N, aminoácido 1, de adrenomedulina.

6. Anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o el andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 1 a 5, caracterizado por que dicho anticuerpo, fragmento de anticuerpo o andamiaje sin Ig no se une a la parte del terminal C de ADM, que son los aminoácidos 43-52 de ADM

PRSKISPQGY-NH2; SEC. ID. n° 25.

7. Anticuerpo anti-ADM o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 1 a 6, en el que dicho anticuerpo, fragmento o andamiaje es un anticuerpo, fragmento o andamiaje estabilizante de ADM que aumenta la vida media, tiempo medio de retención t1/2, de adrenomedulina en el suero, la sangre, el plasma, por lo menos el 10%, preferentemente al menos, 50%, más preferentemente > 50%, aún más preferentemente > 100%.

8. Anticuerpo anti-ADM o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 1 a 7, en el que dicho anticuerpo, fragmento o andamiaje bloquea la bioactividad de ADM no más del 50%, en el que la bioactividad de ADM se determina en un análisis funcional de AMPc receptor de adrenomedulina recombinante humana.

9. Anticuerpo anti-ADM o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente según cualquiera de las reivindicaciones 1 a 8, en el que dicho paciente es un paciente en la UCI.

10. Anticuerpo anti-ADM o un fragmento de anticuerpo anti-adrenomedulina para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 1 a 9, en el que dicho anticuerpo o fragmento es un anticuerpo monoclonal humano o fragmento que se une a ADM o un fragmento de anticuerpo del mismo en el que la cadena pesada comprende las secuencias

SEC. ID. n° 1 GYTFSRYW

SEC. ID. n° 2 ILPGSGST

SEC. ID. n° 3 TEGYEYDGFDY

y en las que la cadena ligera comprende las secuencias

SEC. ID. n° 4 QSIVYSNGNTY

SEC. ID. n° 5 RVS

SEC. ID. n° 6 FQGSHIPYT.

11. Anticuerpo monoclonal humano o fragmento que se une a ADM o un fragmento de anticuerpo del mismo para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según la reivindicación 10, en el que dicho anticuerpo o fragmento comprende una secuencia seleccionada de entre el grupo que comprende:

SEC ID n°: 7 AM-VH-C

OVOLOOSGAELMKPGASVK1SCKATGYTFSRYWIEWVKORPGHGLEWIGEILPGSG STNYNEKFK.GKATIT ADTSSiVZH YMQLSSLTSEDSA VYYCTEGYEYDGFDYWGOGTTLT VSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSGVHTFPA VLQS SGLYSLSSWTVPSSSLGTOTYICNVNHKPSNTKVDKRVEYKHHHHHH

SEC ID n°: 8 AM-VH1

OVOLVOSGAEVKKPGSSVKVSCKASGYTFSRYWISWVROAPGOGLEWMGRILPGS GSTNYAQKFQGRVTITADE.ST.ST.4 YMELSSLRSEDTA VYYCTEGYEYDGFDYWGOGTTV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSG VHTFPA VLQ SSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKHHHHHH

SEC ID n°: 9 AM-VH2-E40

OVOLVOSGAEVKKPGSSVKVSCKASGYTFSRYWllWVROAPGOGLEWMGRILPGS GSTNYAOKFOGRVTITADE,S75Tf YMELSSLRSEDTA VYYCTEGYEYDGFDYWGOGTTV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEPVTVSWNSGALTSG VHTFPA VLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEYKHHHHHH

SEC ID n°: 10 AM-VH3-T26-E55

ovolvosgaevkkpgssvkvsckaígytfsrywíswvroapgoglewmgíilpgs

GSTNYAQKFQGRVTITADES7SL4 YMELSSLRSEDTA VYYCTEGYE YDGFD YWGOGTTV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCL VKDYFPEP VTVSWNSGALTSG VHTFPA VLQ SSGLYSLSSVVTVPSSSLGTQTYJCNVNHKPSNTKVDKRVEFKHHHHHH

SEC ID n°: 11 AM-VH4-T26-E40-E55

GSTNYAOKFOGR VTITADESrm YMELSSLRSEDTA VYYCTEGYEYDGFD YWGOGTTV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRmVKHHHHHH

SEC ID n°: 12 AM-VL-C

DVT.T.SOTPLSLPVSLGDOATTSCR SSQSÍ WSNGNTYLEWYLOKPGOSPKLLIYRVSN RFSOVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFOGSHIPYTFGGGTK.LEIKRTVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

SEC ID n°: 13 AM-VL1

nVVMTOSPLSLPVTLGOPASISCRSSOSIVYSNGNTYLNWFOORPGOSPRRLIYRVSN RDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFOGSHIPYTFGOGTKLEIKRTVA APSWIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KD S T YS LSSTLTLS ÍCAD YEKHKV YAC EVTHQGLS SP VTKSFNRGEC

SEC ID n°: 14 AM-VL2-E40

DVVMTOSPLSLPVTLGQPASISCRSSQSIVYSNGNTYLEWFQORPGOSPRRLIYRVSN

RDSGVPDRFSGSGSGTDFTLKiSRVEAEDVGVYYCFOGSHiPYTFGQGTKLEIKRTVA

APSWIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS

KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

12. Anticuerpo anti-ADM o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente según cualquiera de las reivindicaciones 1 a 11 para su utilización en combinación con vasopresores, por ejemplo catecolaminas y/o líquidos administrados por vía intravenosa.

13. Anticuerpo o fragmento de anticuerpo anti-adrenomedulina o andamiaje proteico sin Ig anti-ADM para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente según cualquiera de las reivindicaciones 1 a 11 o una combinación según la reivindicación 12 para su utilización en combinación con proteína-1 de unión a ADM, factor H del complemento, y/u otros principios activos.

14. Formulación farmacéutica para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente que comprende un anticuerpo, fragmento o andamiaje según cualquiera de las reivindicaciones 1 a 12.

15. Formulación farmacéutica para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho

paciente según la reivindicación 14 en la que dicha formulación farmacéutica es una solución, preferentemente una solución lista para su uso.

16. Formulación farmacéutica para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según la reivindicación 14, en la que dicha formulación farmacéutica está en estado liofilizado.

17. Formulación farmacéutica para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 14 a 15, en la que dicha formulación farmacéutica se administra por vía intramuscular.

18. Formulación farmacéutica para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque, por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 14 a 15, en la que dicha formulación farmacéutica se administra por vía ¡ntravascular.

19. Formulación farmacéutica para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según la reivindicación 18, en la que dicha formulación farmacéutica se administra por infusión.

20. Formulación farmacéutica para su utilización en el tratamiento o prevención de SIRS, meningitis, septicemia, choque por ejemplo choque septicémico en un paciente para la reducción del riesgo de mortalidad para dicho paciente según cualquiera de las reivindicaciones 14 a 19, en la que dicha formulación farmacéutica debe administrarse de forma generalizada.