27 patentes, modelos y diseños de UNIVERSIDAD NACIONAL DE COLOMBIA

REPLICACIÓN INDUCIDA DE ROTAVIRUS ONCOLÍTICOS PARA EL CONTROL DE NEOPLASIAS.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(28/02/2019). Inventor/es: GUERRERO FONSECA,Carlos Arturo. Clasificación: C12N7/01, C12R1/93, A61K35/765.

La presente invención proporciona un método de producción de rotavirus oncolíticos a partir de cepas de rotavirus parentales y de líneas tumorales de cualquier origen, con capacidad de infectar y lisar células tumorales in vitro e in vivo, las cuales expresan en su membrana citoplasmática las proteínas integrinas (¿ß3), protánas disulfuro isomerasas (PDIs), proteínas de choque térmico (Hsp90, Hsp70, Hsp60 o Hsp70). Además la presente invención proporciona un método para el tratamiento de neoplasias en un animal, que comprende la administración de rotavirus oncolíticos, seleccionados y adaptados a células tumorales, en células "carrier" o transportadoras in vitro y su posterior administración al animal. El método de administración de los rotavirus oncolíticos en células "carrier" permite eludir el reconocimiento por anticuerpos y liberar el rotavirus en células tumorales e infectarlas.

DISPOSITIVO PARA LA ADQUISICIÓN DE DATOS EN CUERPOS DE AGUA.

(07/02/2019) La presente invención corresponde a un dispositivo para la adquisición de datos en cuerpos de agua que comprende una carcasa estanca la cual comprende un primer cuerpo con un primer extremo roscado y un segundo extremo roscado, un segundo cuerpo con un primer extremo roscado y un segundo extremo roscado, donde el extremo roscado se conecta operacionalmente al extremo roscado del primer cuerpo. También, un tapón conectado al segundo extremo roscado del segundo cuerpo, un cuerpo con un sensor localizado en su interior y este cuerpo conectado al segundo extremo roscado del cuerpo. Además, una unidad de cómputo localizada al interior del primer cuerpo y conectado al sensor, una batería localizada al interior del cuerpo conectada a la unidad de cómputo, un módulo de comunicación inalámbrica localizado al interior del primer cuerpo y conectada a la unidad de computo.…

GEOMETRÍA DE UN TORNILLO PARA IMPLANTES.

Sección de la CIP Necesidades corrientes de la vida

(31/01/2019). Inventor/es: CORREDOR GÓMEZ,Jennifer Paola, CORTÉS RODRÍGUEZ,Carlos Julio, GAMBOA MÁRQUEZ,Miguel Alejandro. Clasificación: A61C8/00.

Tornillo para implantes dentales cuya geometría fue diseñada a partir de nueve parámetros (diámetro, longitud, ángulo del cuerpo, paso, ángulo de hilo coronal, ángulo de hilo apical, redondeo apical, ancho de hilo y profundidad de hilo) que permiten calcular la distribución de su carga mecánica. Con esta geometría se pueden distribuir los esfuerzos para optimizar el remodelado óseo y a su vez mejorar la osteointegración.

MÉTODO PARA DETERMINAR EL FACTOR DE PROTECCIÓN SOLAR IN VITRO.

Sección de la CIP Física

(31/01/2019). Inventor/es: VALLEJO DÍAZ,Bibiana Margarita Rosa, PLAZAS BONILLA,Clara Eugenia, BARBOSA BARBOSA,Helber De Jesús, TORRES SALCEDO,Nestor Jaime, VITOLA DOMÍNGUEZ,Angie Viviana, HERNÁNDEZ CAMARGO,Aura Rocío. Clasificación: G01N21/33.

Se describe un método para la determinación del factor de protección solar (FPS) in vitro cuyo fin es lograr reproducibilidad y exactitud en las determinaciones y reemplazar el uso de pruebas sobre seres vivos. Para ello se hace uso del ácido hialurónico, un sustrato natural presente en la piel humana, el cual se prueba en solución o como película sólida, en concentraciones inferiores al 1% p/v y usando de un espectrofotómetro. Una vez calibrado se ha utilizado para corroborar el factor de protección ofrecido por bloqueadores solares comerciales.

PELICULAS DELGADAS DE OXINITRURO BINARIO DE NÍQUEL-COBRE (NiCuOxNy) Y LAS CONDICIONES PARA SU FABRICACIÓN.

Sección de la CIP Química y metalurgia

(31/01/2019). Inventor/es: CUBILLOS GONZÁLEZ,Gloria Ivonne, ALFONSO ORJUELA,José Edgar, VELÁSQUEZ MÉNDEZ,Karen Lizzette, UMAÑA PÉREZ,Yadi Adriana. Clasificación: C23C14/34, C01G3/00, C01G53/00.

Se depositaron películas delgadas de oxinitruro binario de níquel-cobre (NiCuOxNy) sobre la superficie de sustratos de acero inoxidable AISI 3161 y vidrio por el método de pulverización catódica Ríen fase reactiva con un espesor entre 700 a 2100 nm bajo diferentes condiciones de depósito a partir de un blanco bimetático precursor de níquel y cobre a unas condiciones específicas como: presión base, presión de trabajo, flujo de argón, flujo de oxígeno, flujo de nitrógeno, potencia del blanco precursor de Ni-Cu, distancia blanco-sustrato y tiempo de depósito. Las películas fueron caracterizadas y se elevó a cabo con ellas un estudio pretiminar de biocompatibilidad y caracterización por sus propiedades ópticas.

COMPLEJO POLIELECTROLÍTICO CON ACTIVIDAD.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(31/01/2019). Inventor/es: BAENA ARISTIZÁBAL,Yolima, MELÉNDEZ MEJÍA,Adelina Del Pilar, DALLOS MORANTES,Leidy Johanna. Clasificación: A61K8/368, A01N37/10, C08F218/10, C08F218/02.

La presente invención ofrece una solución a las limitaciones de los preservantes cosméticos, a través del diseño de un sistema preservante capaz de liberar lentamente la molécula con actividad antimicrobiana y ser soluble y activo en medios acuosos a pH superiores a 5, pH donde generalmente se encuentran los productos con aplicaciones cosméticas. Para llegar a ello se emplearon los principios de la formación de complejos entre moléculas pequeñas, de naturaleza electrolítica, por ejemplo, el preservante ácido benzoico y polielectrolitos catiónicos, de carácter básico en los que mediante interacciones químicas (especialmente iónicas), se obtienen nuevas entidades químicas.

PROCESO PARA OBTENER UN EXTRACTO BIOCIDA.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(05/07/2018). Inventor/es: ARANGO GIRALDO,Natalia, ORTIZ REYES,Adriana Del Socorro, ROMERO TABAREZ,Magally, TORRES GRAJALES,Luisa Fernanda, URIBE LONDOÑO,Miguel. Clasificación: A01N63/02, C12R1/07, C12R1/425, C12R1/385, C12R1/38, C12P1/04, C12R1/185, C12R1/43.

La invención se refiere un proceso para obtener un extracto biocida a partir de microorganismos del género Bacillus sp, Serratia sp, Pseudomonas sp, Burkholderia sp, Brevundimonas sp, Escherichia sp, Delftia sp, Acinetobacter sp, Photorhabdus sp o Xenorhabdus sp, que comprende aislar y purificar el microorganismo, preparar un pre- inóculo, inocular en presencia de una resina adsorbente, y por último, separar y eluir la resina con un solvente orgánico hasta obtener un extracto bacteriano con actividad insecticida, fungicida y/o repelente.

SISTEMA Y PROCESO DE PRODUCCIÓN PARA LA OBTENCIÓN DE BIOACEITE A PARTIR DE BIOMASA.

(08/03/2018) La presente invención corresponde a un sistema para la generación de bioaceite a partir de biomasa, y un proceso de producción de bioaceite a partir de biomasa. El sistema para producción de bioaceite a partir de biomasa que comprende: un mecanismo de suministro continuo de biomasa, un pirolizador que tiene una entrada de biomasa que se conecta al mecanismo de suministro continuo de biomasa, y tiene una malla; un mecanismo de separación de sólidos que se conecta al pirolizador, y; un condensador que se conecta al mecanismo de separación de sólidos. El proceso de producción de bioaceite a partir de biomasa comprende las etapas: a) suministrar biomasa de forma continua a un pirolizador; b) pirolizar la biomasa a una tasa de calentamiento superior a 1000°C/s, a una temperatura entre 300°C y 750°C, y con un tiempo de residencia inferior…

PROCESO PARA PRODUCIR HIDRÓGENO.

Sección de la CIP Química y metalurgia

(14/12/2017). Inventor/es: MORENO CÁRDENAS,Edilson León, CANO QUINTERO,Deisy Yuliana. Clasificación: C02F11/04, C12R1/01, C12P3/00, C01B3/02.

La invención se refiere a un proceso para la producción de hidrógeno por fermentación de un sustrato obtenido a partir de residuos orgánicos, en un entorno cerrado sin suministro de oxígeno y en ausencia de luz. El proceso comprende la preparación del sustrato complejo, una etapa de acidificación en condiciones anaerobias a temperatura ambiente y posteriormente el incremento gradual del pH del sistema para obtener así el hidrógeno.

PROCESO PARA OBTENER JARABES AZUCARADOS A PARTIR DE RESIDUOS AGROINDUSTRIALES.

Sección de la CIP Química y metalurgia

(14/12/2017). Inventor/es: RUIZ COLORADO,Angela Adriana, BUENO ZABALA,Karen Alejandra. Clasificación: C08B37/00, C12P19/14, C13J1/06, C12P19/02, C13K1/00.

La invención se refiere a un proceso para obtener jarabes azucarados a partir de residuos agroindustriales que comprende pre-tratar por métodos físicos, biológicos y químicos los residuos agroindustriales y someterlos a hidrólisis enzimática hasta obtener un jarabe azucarado rico en glucosa. Al jarabe azucarado se le adicionan isomerasas para obtener jarabes de mezclas de isómeros de glucosa de gran utilidad para el sector alimenticio, cosmético, farmacéutico y energías alternativas.

PROCESO PARA LA OBTENCIÓN DE UN EXTRACTO DE AZADIRACHTA INDICA.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(30/11/2017). Inventor/es: OROZCO SÁNCHEZ,Fernando, HOYOS SÁNCHEZ,Rodrigo Alberto, MARTÍNEZ MIRA,Anny Daniela, LÓPEZ TABORDA,Juan David, OVIEDO RAMIREZ,Juan Carlos. Clasificación: A01N65/00, C12P17/18.

La presente invención se refiere a un proceso para obtener un extracto a partir de un cultivo de células de Neem (Azadirachta indica). El cultivo de células en suspensión se somete a estrés celular bajo condiciones que favorecen la producción de metabolitos activos tales como azadiractinas y terpeniodes, que luego se extraen con solventes y/o resinas de adsorción. El extracto obtenido, bien sea solo o incorporado en una composición agroquímica, puede ser utilizado para el control de plagas en diversos cultivos.

COMPOSICIONES SÓLIDAS DE AGUACATE Y SU PROCESO DE OBTENCIÓN.

Sección de la CIP Necesidades corrientes de la vida

(30/11/2017). Inventor/es: CÓRTES RODRÍGUEZ,Misael, PADILLA REYES,Fabio Augusto, ESTRADA MESA,Eliana María, ORREGO VARGAS,Francy Stephanie, GIL GONZÁLEZ,Jesús Humberto. Clasificación: A23L3/46, A23L3/40, A23B7/02, A23L3/42, A23B7/022, A23L19/00.

La invención se refiere a un proceso para obtener composiciones sólidas a base de aguacate con un alto contenido de sólidos totales provenientes del fruto de aguacate, sumado a un alto valor nutricional y seguras desde el punto de vista microbiológico, con color, sabor y aroma propios de la pulpa de aguacate. Las composiciones sólidas obtenidas son de gran utilidad para el sector alimenticio, cosmético y farmacéutico.

PROCEDIMIENTO DE CONFECCIÓN MANUAL DE CONCRETO MEDIANTE SUSPENSIÓN MECÁNICA.

Secciones de la CIP Química y metalurgia Técnicas industriales diversas y transportes

(30/11/2017). Inventor/es: BEDOYA MONTOYA,Carlos Mauricio. Clasificación: C04B40/00, B28C5/00, B28C7/04, B28C7/02, B28C5/48.

La presente invención corresponde a un proceso para la elaboración de mezclas de concreto y mezclas de mortero. El proceso comprende las etapas de: a) mezclar y agitar un cementante con un agua hasta lograr una pasta activada; b) adicionar un agregado fino a la pasta activada de la etapa (a) y agitar hasta lograr una mezcla de mortero; y, c) adicionar un agregado grueso a ¡a mezcla resultante de la etapa (b), y agitar hasta lograr una mezcla de concreto. Adicionalmente, la presente invención comprende una pasta activada, una mezcla de mortero y una mezcla de concreto.

PÉPTIDOS SINTÉTICOS MODULADORES DEL RECEPTOR NMDA.

Secciones de la CIP Química y metalurgia Necesidades corrientes de la vida

(29/06/2017). Inventor/es: REYES MONTAÑO,Edgar Antonio, REYES GUZMÁN,Edwin Alfredo, VEGA CASTRO,Nohora Angélica. Clasificación: C07K7/08, A61K38/10.

La presente invención provee una serie de péptidos moduladores de la actividad del receptor N-Metil-D-Aspartato (NMDA). Específicamente hace referencia a dos péptidos sintéticos antagonistas del influjo iónico a través del receptor NMDA con especificidad hacia las subunidades GluN2B y GluN2A del receptor MMDA y a un péptido con actividad agonista sobre el receptor NMDA en cultivos de neuronas hipocampales de rata.

PÉPTIDO QUIMÉRICO MODULADOR DE UNA ENZIMA PRESENTE EN LAS BALSAS LIPÍDICAS DE LA MEMBRANA CELULAR.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(22/06/2017). Inventor/es: VERNOT HERNANDEZ,Jean Paul. Clasificación: A61K38/16, A61P35/02, C07K14/01.

La presente invención provee un nuevo péptido quimérico sintético de 35 aminoácidos denominado hTip-CSKH que tiene una región hidrofóbica (hTip), una región de unión a Lck (CSKH) y una región anfipática corta con aminoácidos cargados e hidrofóbicos. El péptido quimérico se inserta en la membrana plasmática específicamente en las denominadas balsas lipídicas (en inglés, lipid rafts) donde modula la actividad de la proteína tirosina quinasa denominada Lck, para inducir su activación y la proliferación de células del sistema inmunitario (linfocitos) normales o inhibir el crecimiento de las leucemias de células T. El péptido es específico para la modulación de Lck ya que utiliza un dominio de unión específica a Lck y no a otras proteínas de la familia Src de proteínas tirosina quinasa como Fyn o Lyn. Además, la secuencia hidrofóbica utilizada (hTip) puede utilizarse como vehículo para la inhibición de otras proteínas presentes en las balsas lipídicas.

MAQUINA PARA TRANSPLANTE DE PLANTULAS CON CEPELLÓN.

Sección de la CIP Necesidades corrientes de la vida

(15/12/2016). Inventor/es: ARISTIZÁBAL TORRES,Iván Darío, MORENO CÁRDENAS,Edilson León. Clasificación: A01B49/04, A01C11/00, A01C11/02, A01C5/04, A01B29/00, A01B29/06, A01C11/04.

La invención corresponde a una máquina para el trasplante de plántulas, que comprende un chasis móvil y una unidad de trasplante. El chasis móvil tiene ruedas y en este se disponen las bandejas que contienen las plántulas a trasplantar. La unidad de trasplante se conforma de un cilindro ahoyador y un ducto operativamente dispuesto en chasis móvil para que el cilindro ahoyador realice los hoyos donde se disponen las plántulas y el ducto guie las plántulas hacia el hoyo.

FORMULACIÓN DE CEMENTO EN BASE A SULFOALUMINATO CON PROPORCIÓN PARTICULAR DE SISTEMAS YELEMÍTICOS.

Sección de la CIP Química y metalurgia

(09/06/2016). Inventor/es: TOBÓN,Jorge Iván, GIRALDO TORRES,Carolina, BERRIO SOLARTE,Ariel, LONDOÑO ZULUAGA,Diana. Clasificación: C04B7/32, C04B28/06, C04B28/16, C04B11/30.

La presente invención corresponde a una formulación de cemento en base a base sulfoaluminato que comprende una proporción específica de cristales de Yeelemita que presenta propiedades de resistencia mecánica, fraguado y emisiones de CO2 mejoradas. Se describe también un concreto obtenido al mezclar dicha formulación con agua y yeso, que presenta un desempeño a edades iniciales mayor en comparación al concreto obtenido a partir de cemento Portland.

EMPAQUE POLIMÉRICO QUE RETARDA EL PROCESO DE MADURACIÓN Y SENESCENCIA DE PRODUCTOS VEGETALES FRESCOS.

Secciones de la CIP Necesidades corrientes de la vida Técnicas industriales diversas y transportes

(12/05/2016). Inventor/es: SIERRA ÁVILA,Cesar Augusto, MARTÍNEZ GÓMEZ,Sugey Maryuri, GUTIERREZ CARRANZA,Luis Alejandro, RODRÍGUEZ ANGULO,Ricaurte. Clasificación: A23L3/3445, A23B7/152, B32B27/18, B65D81/24.

La presente invención refiere una composición polimérica para absorber etileno y otros compuestos gaseosos que comprende un sustrato polimérico que consiste en poliolefina o una mezcla de poliolefinas y uno o más agentes de captura de etileno en una concentración entre 0.5% y 5%. Otros objetos de invención son un empaque que retarda el proceso de maduración y senescencia en frutas, vegetales y follaje caracterizado porque contiene dicha composición, y un procedimiento para extender la vida útil de dichos productos perecederos durante su transporte, almacenamiento y comercialización.

PROCEDIMIENTO PARA LA PREPARACIÓN DE COLÁGENO TIPO 1 Y DE SOPORTES UNIDIRECCIONALES Y MULTIDIRECCIONALES QUE LO CONTIENEN.

(12/05/2016) El trabajo en ingeniería de tejidos aquí reclamado estableció un procedimiento para aislar colágeno tipo I de cola de rata y elaborar soportes multidireccionales (Pérez et al., 2001). En los últimos años, el método de aislamiento fue modificado y estandarizado. Del mismo modo, se introdujeron cambios en el procedimiento de obtención de soportes a partir de este colágeno y se desarrolló un método novedoso de elaborar soportes unidireccionales laminares. En el método optimizado, la fuente de colágeno animal se limpia, corta y suspende en solución de ácido acético hasta alcanzar un pH en la fase liquida entre 2.5 y 3.2 a 4 °C en agitación constante. Dicha suspensión se centrifuga y el pH del sobrenadante obtenido se neutraliza con…

HERRAMIENTA ORTODÓNTICA PARA UBICAR, POSICIONAR Y ADOSAR BRACKETS EN LA SUPERFICIE VESTIBULAR DEL DIENTE.

Sección de la CIP Necesidades corrientes de la vida

(26/02/2015). Ver ilustración. Inventor/es: GARCÍA ACOSTA,Gabriel, LANGE MORALES,Karen, PUENTES LAGOS,David Ernesto, PARADA PARADA,Sara Estela, RUÍZ ORTIZ,Manuel Ricardo, GARZÓN PACHECO,Ana María, LEÓN CASTELLANOS,William Ricardo, ÁLVAREZ,Juan Ricardo, VANEGAS MATA,Carlos Julio, NUÑEZ VILORIA,Jhon Walther. Clasificación: A61C8/00.

Herramienta ortodóntica para ubicar, posicionar y adosar brackets por método directo o indirecto que consta de dos partes: un cuerpo para manipulación del dispositivo y una punta . La morfología del cuerpo permite que el usuario tenga control, confort y compatibilidad con la mano, en el momento de colocar el bracket en el objetivo, que es el centro meso - distal de la pieza dental o diente, a una altura predeterminada , lo que se traduce en precisión y exactitud.

DISPOSITIVO Y MÉTODO PARA LA PRODUCCIÓN DE CULTIVOS SIN TIERRA.

Sección de la CIP Necesidades corrientes de la vida

(04/12/2014). Ver ilustración. Inventor/es: RESTREPO PULGARIN,Hugo, GUARIN GIRALDO,German Wbeimar. Clasificación: A01G31/00.

La presente invención se refiere a un dispositivo y método para el desarrollo y producción de cultivos sin tierra con base en la nebulización y el control de la energía del agua. El dispositivo del presente invento utiliza dos cámaras independientes climáticamente, una para el follaje y otra para las raíces. El contacto con el medio ambiente es controlado de acuerdo con las condiciones termodinámicas al interior de las cámaras y/o necesidades del metabolismo de las plantas. La energía del agua o soluciones nutritivas se contraía mediante la nebulización, la cual está asociada mediante algoritmos con la ventilación y la calefacción o la refrigeración.

MÉTODO Y SISTEMA PARA LA DETECCIÓN Y DIAGNÓSTICO DE FALLAS EN MÁQUINAS ELÉCTRICAS EN OPERACIÓN.

(12/09/2014) La presente invención divulga un método de detección y diagnóstico de fallas para máquinas eléctricas en operación. El método comprende: i) adquirir simultáneamente una señal de corriente y una señal de voltaje asociadas al devanado de la máquina eléctrica; ii) definir un conjunto de vectores cuyas componentes son valores de DC y/o AC a diferentes niveles de separación y amplificación de las señales de corriente y voltaje; iii) adquirir simultáneamente una señal de corriente y una señal de voltaje asociadas a una falla emulada; iv) definir un conjunto de vectores cuyas componentes son valores de DC y/o AC a diferentes niveles de separación y amplificación para las señales de corriente y…

SISTEMA DE REACCIÓN PARA LA PRODUCCIÓN DE ALQUIL ESTERES GRASOS EMPLEANDO UN REACTOR DE PELÍCULA LÍQUIDA OPERADO EN CONTRACORRIENTE.

(07/08/2014) La presente invención relaciona un sistema de reacción para la producción de alquil ásteres de ácidos grasos utilizando reactores empacados, particularmente reactores de película líquida, con esquema de flujo de las corrientes de alimentación en contracorriente, basado en la alcohólisis de aceites y grasas, específicamente la metanólisis de aceite de palma y de soya. El sistema de reacción consta de un reactor de película líquida descendente, que emplea un empaque semi-estructurado para la generación de área interfacial. Al reactor se alimentan, independientemente, el aceite o grasa, por el fondo del reactor, y una mezcla que contiene alcohol, glicerol y catalizador, que puede alimentarse en una etapa intermedia.…

MÉTODO Y APARATO PARA LA PERFORACIÓN ELÉCTRICA DE LÁMINAS.

Secciones de la CIP Física Técnicas industriales diversas y transportes

(07/08/2014). Ver ilustración. Inventor/es: LEMESHKO,Victor, ÁLVAREZ BUSTAMANTE,José Alexander. Clasificación: G06K1/12, B26F1/28.

La presente invención comprende un método y un aparato para la aplicación de descargas eléctricas sobre láminas para su perforación. El método incluye la impregnación o deposición de sustancias como pinturas, tintes, colorantes y sustancias de distintos grados de hidrofobicidad en las láminas durante la perforación eléctrica. El aparato de perforación incluye medios de perforación eléctrica, con líquido o gel como medio de conducción para la descarga eléctrica, y como soportes para las láminas; también como medio para disolver o mezclar sales, pinturas, tintes, colorantes y sustancias de distintos grados de hidrofobicidad.

PROCESO PARA LA OBTENCIÓN DE PULPA A PARTIR DE DESECHOS VEGETALES Y PRODUCTO OBTENIDO.

Sección de la CIP Textiles y papel

(07/08/2014). Inventor/es: GARZÓN FLÓREZ,Luis Eduardo. Clasificación: D21C5/00, D21C3/00.

Proceso para la obtención de pulpa a partir de desechos vegetales y producto obtenido. El proceso consta de los siguientes pasos: a. Romper mediante un proceso mecánico las fibras de los desechos vegetales; b. Liberar al ambiente los desechos tratados anteriormente; c. Tratamiento térmico de los desechos; d. Secado; e. Recuperación de los líquidos extraídos durante el proceso. La pulpa es útil para la fabricación de papel, cartón o sustitutos de poliestireno expandido.

PÉPTIDO SINTÉTICO POLICATIÓNICO CON PROPIEDADES IONOFÓRICAS, ANTIMICROBIANAS, ANTITUMORALES E INSECTICIDAS.

Secciones de la CIP Necesidades corrientes de la vida Química y metalurgia

(07/08/2014). Ver ilustración. Inventor/es: LEMESHKO,Victor, ORDUZ PERALTA,Sergio. Clasificación: A61P35/00, C07K14/325, A61P31/00, A61K38/16.

La presente invención se refiere a una nueva clase de péptidos sintéticos cuya secuencia de aminoácidos es la secuencia IAPALIAVAPIAKYLATALAKWALKQGFAKLKS (SEQ ID N°. 1) que presenta una homología de al menos 90% a la SEQ ID N°. 1. Los péptidos de la invención presentan actividad antimicrobiana, ionofórica, antitumoral e insecticida. La presente invención también se refiere a composiciones farmacéuticas y agrícolas que los contienen y que son útiles en la inhibición del crecimiento microbiano y tumoral.

BIOPOLIMERO BASADO EN LACTOCOCCUS LACTIS, NRRL B-30656, PROCESO PARA EL CULTIVO DEL LACTOCOCCUS LACTIS NRRL B-30656 Y PROCESO PARA PREPARAR EL BIOPOLIMERO.

(24/02/2010) Un microorganismo aislado de suelo fue identificado como una cepa de Lactococcus lactis, NRRL B-30656, el cual al crecer en un medio que contiene sacarosa produce una enzima transferasa, extracelular, la cual al ser purificada y colocarse en un medio con sacarosa, a condiciones adecuadas de temperatura y pH, produce un biopolimero de glucosa y fructosa

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015