Péptidos antigénicos de Neisseria.

Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2884 del documento WO99/51280

(MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTDIAGDTWNTSKVRATLLGISPATQARVKIVTYG NVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR), en la que dicho(s) fragmento(s):

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de: **Fórmula**

y en la que dicha proteína no es SEC ID Nº: 2876, 2878, 2880, 2882, 2884 o 2886 del documento WO99/57280 .

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E10179001.

Solicitante: NOVARTIS VACCINES AND DIAGNOSITICS S.R.L.

Nacionalidad solicitante: Italia.

Dirección: Via Fiorentina 1 53100 Siena ITALIA.

Inventor/es: GRANDI, GUIDO, PIZZA, MARIAGRAZIA, RAPPUOLI, RINO, RATTI, GIULIO, GALEOTTI,CESIRA, MASIGNANI,VEGA, SCARLATO,VINCENZO, SCARSELLI,MARIA, MORA,MARIROSA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > A61K48/00 (Preparaciones medicinales que contienen material genético que se introduce en las células del cuerpo vivo para tratar enfermedades genéticas; Terapia génica)
  • SECCION G — FISICA > METROLOGIA; ENSAYOS > INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION... > Investigación o análisis de materiales por métodos... > G01N33/569 (para microorganismos, p. ej. protozoarios, bacterias, virus)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Técnicas de mutación o de ingeniería genética;... > C12N15/31 (Genes que codifican proteínas microbianas, p. ej. enterotoxinas)
  • SECCION G — FISICA > METROLOGIA; ENSAYOS > INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION... > Investigación o análisis de materiales por métodos... > G01N33/53 (Ensayos inmunológicos; Ensayos en los que interviene la formación de uniones bioespecíficas; Materiales a este efecto)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/12 (contra materiales bacterianos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/095 (Neisseria)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/40 (bacterianos)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/22 (de Neisseriaceae (F), p. ej. Acinetobacter)

PDF original: ES-2539951_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Péptidos antigénicos de Neisseria.

CAMPO DE LA INVENCIÓN 5

La presente invención se refiere a secuencias de péptidos antigénicos de las bacterias Neisseria meningitidis.

TÉCNICA ANTERIOR

N. meningitidis es un diplococo Gram-negativo no móvil que es patógeno en seres humanos.

Basándose en polisacárido capsular del organismo, se han identificado 12 serogrupos de N. meningitidis. El grupo A es el patógeno más frecuentemente implicado en la enfermedad epidémica en el África subsahariana. Los serogrupos B y C son responsables de la gran mayoría de casos en los Estados Unidos y en la mayoría de los 15 países desarrollados. Los serogrupos W 135 e Y son responsables del resto de los casos en los Estados Unidos y países desarrollados.

La vacuna meningocócica actualmente en uso es una vacuna de polisacárido tetravalente compuesta de los serogrupos A, C Y y W135. Sin embargo, el meningococo B sigue siendo un problema. El enfoque de polisacáridos 20 no puede usarse debido a que el polisacárido capsular menB es un polímero del ácido N-acetilneuramínico enlazado a α (2-8) que también está presente en el tejido de mamífero. Un enfoque a una vacuna de menB usa mezclas de proteínas de la membrana externa (OMP) . Para superar la variabilidad antigénica, se han construido vacunas multivalentes que contienen hasta nueve porinas diferentes [por ejemplo, Poolman JT (1992) Development of a meningococcal vaccine. Infect. Agents Dis. 4:13-28]. Proteínas adicionales que van a usarse en las vacunas de la 25 membrana externa han sido las proteínas opa y opc, pero ninguno de estos enfoques ha sido capaz de superar la variabilidad antigénica [por ejemplo, Ala'Aldeen & Borriello (1996) ]. Las proteínas 1 y 2 de unión a transferrina meningocócicas están ambas expuestas en la superficie y generan anticuerpos bactericidas capaces de aniquilar cepas homólogas y heterólogas. [Vaccine 14 (1) :49-53].

DIVULGACIÓN DE LA INVENCIÓN

La invención se refiere a fragmentos de la proteína 936-1 desvelada en las solicitudes de patente internacional WO99/57280 y WO00/22430 (las “solicitudes internacionales”) , en las que los fragmentos comprenden al menos un determinante antigénico y están seleccionadas de los 5 fragmentos de la reivindicación 1, y la invención también 35 proporciona proteínas que comprenden uno o más de estos 5 fragmentos.

La invención está sometida a la condición de que no incluye dentro de su alcance proteínas limitadas a cualquiera de las secuencias de proteína de longitud completa desveladas en las solicitudes internacionales (es decir, las SEC ID Nº 2-3020 pares de WO99/57280 y las SEC ID Nº 963-1045 impares de WO00/22430) . 40

Las proteínas de la invención pueden prepararse, por supuesto, por diversos medios (por ejemplo, expresión recombinante, purificación a partir de cultivo celular, síntesis química, etc.) y en diversas formas (por ejemplo, fusiones nativas, del extremo C y/o extremo N, etc.) . Se preparan preferentemente en forma sustancialmente pura (es decir, sustancialmente libre de otras proteínas de Neisseria o de células huésped) . Se producen preferentemente 45 proteínas cortas usando síntesis química de péptidos.

Según otro aspecto, la invención proporciona anticuerpos que reconocen los fragmentos de la invención, con la condición de que la invención no incluya dentro de su alcance anticuerpos que reconocen cualquiera de las secuencias de proteínas completas en las solicitudes internacionales. Los anticuerpos pueden ser policlonales o 50 monoclonales, y pueden producirse por cualquier medio adecuado.

Composiciones que comprenden proteína y/o anticuerpo según la invención pueden ser adecuadas como vacunas, por ejemplo, o como reactivos de diagnóstico, o como composiciones inmunogénicas.

La proteína, o anticuerpo según la invención, puede usarse como medicamentos (por ejemplo, como vacunas o como composiciones inmunogénicas) o como reactivos de diagnóstico. Pueden usarse en la fabricación de: (i) un medicamento para tratar o prevenir infección debida a la bacteria de Neisseria; (ii) un reactivo de diagnóstico para detectar la presencia de bacterias de Neisseria o de anticuerpos producidos contra bacterias de Neisseria; y/o (iii) un reactivo que puede producir anticuerpos contra bacterias de Neisseria. Dichas bacterias de Neisseria pueden ser de 60 cualquier especie o cepa (tal como N. gonorrhoeae) , pero son preferentemente N. meningitidis, especialmente la cepa A o la cepa B.

La divulgación también proporciona un método para tratar un paciente, que comprende administrar al paciente una cantidad terapéuticamente eficaz del ácido nucleico, proteína y/o anticuerpo según la invención. 65

Un resumen de las técnicas y procedimientos convencionales que pueden emplearse con el fin de realizar la invención (por ejemplo, utilizar las secuencias desveladas para vacunación o fines de diagnóstico) sigue a continuación. Este resumen no es una limitación de la invención, sino que más bien da ejemplos que pueden usarse, pero no se requieren.

General

La práctica de la presente invención empleará, a menos que se indique lo contrario, técnicas convencionales de biología molecular, microbiología, ADN recombinante e inmunología, que están dentro del conocimiento general de la técnica. Tales técnicas se explican completamente en la bibliografía, por ejemplo, Sambrook Molecular Cloning; A 10 Laborator y Manual, segunda edición (1989) ; DNA Cloning, Volúmenes I and II (D.N Glover ed. 1985) ; Oligonucleotide Synthesis (M.J. Gait ed, 1984) ; Nucleic Acid Hybridization (B.D. Hames & S.J. Higgins eds. 1984) ; Transcription and Translation (B.D. Hames & S.J. Higgins eds. 1984) ; Animal Cell Culture (R.I. Freshney ed. 1986) ; Immobilized Cells and Enzymes (IRL Press, 1986) ; B. Perbal, A Practical Guide to Molecular Cloning (1984) ; the Methods in Enzymology series (Academic Press, Inc.) , especialmente los volúmenes 154 y 155; Gene Transfer 15 Vectors for Mammalian Cells (J.H. Miller and M.P. Calos eds. 1987, Cold Spring Harbor Laborator y ) ; Mayer and Walker, eds. (1987) , Immunochemical Methods in Cell and Molecular Biology (Academic Press, London) ; Scopes, (1987) Protein Purification: Principles and Practice, segunda edición (Springer-Verlag, N.Y.) y Handbook of Experimental Immunology, Volúmenes I-IV (D.M. Weir and C. C. Blackwell eds 1986) . En esta memoria descriptiva se usan las abreviaciones estándar para nucleótidos y aminoácidos. 20

Definiciones

Una composición que contiene X está “sustancialmente libre de” Y cuando al menos el 85 % en peso del total X+Y en la composición es X. Preferentemente, X comprende al menos aproximadamente el 90 % en peso del total de 25 X+Y en la composición, más preferentemente al menos aproximadamente el 95 % o incluso el 99 % en peso.

El término “que comprende” significa “que incluye”, así como “que consiste”, por ejemplo, una composición “que comprende” X puede consistir exclusivamente en X o puede incluir algo adicional a X, tal como X+Y.

El término “determinante antigénico” incluye epítopes de linfocitos B y epítopes de linfocitos T.

El término “heterólogo” se refiere a dos componentes biológicos que no se encuentran juntos en la naturaleza. Los componentes pueden ser células huésped, genes o regiones reguladoras, tales como promotores. Aunque los componentes heterólogos no se encuentran juntos en la naturaleza, pueden funcionar juntos, como cuando un 35 promotor heterólogo a un gen está operativamente ligado al gen. Otro ejemplo es donde una secuencia de Neisseria es heteróloga a una célula... [Seguir leyendo]

 


Reivindicaciones:

1. Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2884 del documento WO99/51280 (MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTAGDIAGDTWNTSKVRATLLGISPATQARVKIVTYG NVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR) , en la que dicho (s) fragmento (s) : 5

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de:

y en la que dicha proteína no es SEC ID Nº: 2876, 2878, 2880, 2882, 2884 o 2886 del documento WO99/57280

2. Un anticuerpo que reconoce el fragmento como se define en la reivindicación 1.