MÉTODO PARA AUMENTAR LA RESISTENCIA A LOS PATÓGENOS EN LAS PLANTAS.

La invención se refiere a un método de aumentar la resistencia a uno o más patógenos

, con preferencia patógenos fúngicos o bacterianos, en una planta monocotiledónea o dicotiledónea o una parte de una planta, por ejemplo en órgano, tejido, una célula o parte de una célula de planta, por ejemplo en una organela, donde una secuencia de ADN que codifica proteína de YODA o donde una secuencia de ADN exógena que codifica una proteína de YODA aumenta en la planta o célula de planta en comparación con la planta original, o tipo de salvaje. La invención también se refiere a las plantas, a partes de una planta, por ejemplo un órgano, tejido, una célula o una parte de una célula de planta, por ejemplo, una organela, que se obtienen por los métodos anteriores, y al material de propagación correspondiente.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2013/077076.

Solicitante: UNIVERSIDAD POLITECNICA DE MADRID.

Nacionalidad solicitante: España.

Inventor/es: MOLINA FERNÁNDEZ,Antonio, JORDÁ MIRO,Lucia, SANCHEZ RODRIGUEZ,Clara, SOPENA TORRES,Sara, LÓPEZ GARCÍA,Gemma, MIEDES VICENTE,Eva, SÁNCHEZ VALLET,Andrea, ESCUDERO WELSCH,Viviana Pamela.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Técnicas de mutación o de ingeniería genética;... > C12N15/82 (para células vegetales)
google+ twitter facebookPin it
MÉTODO PARA AUMENTAR LA RESISTENCIA A LOS PATÓGENOS EN LAS PLANTAS.

Fragmento de la descripción:

CAMPO DE LA INVENCIÓN

La presente invención se refiere a un método para aumentar la resistencia fúngica en una planta, donde dicha resistencia aumenta por la introducción de las secuencias de ácidos nucleicos que codifican polipéptidos de YODA o por la modificación de las secuencias de ácidos nucleicos de YODA endógenas. La presente invención también se refiere a constructos de ácidos nucleicos, vectores recombinantes, células, plantas transgénicas, cultivos, material de propagación, composiciones y partes cosechables de una planta que comprende dichas secuencias de ácidos nucleicos.

ANTECEDENTES DE LA INVENCIÓN

Las enfermedades de las plantas que son causadas por varios patógenos, tales como, por ejemplo, virus, bacterias, oomicetos y hongos, puede dar lugar a pérdidas de rendimiento considerables en el cultivo de planta de cultivo, que en primer lugar tiene consecuencias económicas, pero, por otro lado, también pone en peligro la seguridad de la nutrición humana. Desde el siglo pasado, los fungicidas químicos se han empleado para el control de enfermedades fúngicas. Si bien el uso de estas sustancias ha tenido éxito en la reducción de la extensión de enfermedades de las plantas, no se pueden descartar, incluso ahora que estos compuestos tienen un efecto perjudicial sobre los seres humanos, los animales y el medio ambiente. Si el consumo de agentes de protección de plantas convencionales se debe reducir a un mínimo en el largo plazo, por lo tanto, es importante estudiar la defensa de patógenos naturales de diversas plantas contra diferentes microorganismos causales, y aprovecharlos de manera específica para la generación de plantas resistentes a los patógenos por medio de la manipulación recombinante, por ejemplo mediante la introducción de genes de resistencia externos o por la manipulación de la expresión de genes endógenos en las plantas.

Sólo hay algunos métodos, que confieren una resistencia a los patógenos, principalmente patógenos fúngicos y oomicetos, a las plantas. Esta deficiencia puede atribuirse en parte a la complejidad de los sistemas biológicos en cuestión. Otro hecho que se halla en el camino de obtener resistencias a patógenos es que poco se sabe sobre las interacciones entre el patógeno y la planta. El gran número de diferentes agentes patógenos, los mecanismos de infección desarrollados por estos organismos y los mecanismos de defensa desarrollados por las familias de plantas, géneros y especies interactúan entre sí de muchas maneras diferentes.

Las infecciones causadas por los patógenos fúngicso, oomicetos y bacterianos conducen a la activación de mecanismos de defensa de la planta en las plantas infectadas. Por lo tanto, la activación de los sistemas de la inmunidad innata de plantas y animales implica una detección específica de patrones moleculares asociados con microbios (MAMP) por diferentes conjuntos de receptores de reconocimiento de patrones huésped (PRRS). Se ha hallado que varios miembros de la familia de quinasa tipo receptor (RLK) con repetición rica en leucina (LRR) actúan como PRR. Por lo tanto, FLS2 y EFR RLKs son PRR para la flagelina de MAMP y EF-Tu bacterianas, respectivamente, mientras que se ha sugerido que LysM/CERK son el receptor para el MAMP fúngico, quitosano. La iniciación de las respuestas inmunitarias mediadas por estos PRR implica la formación de complejo inducido por MAMPs con RLK adicionales, la endocitosis de proteínas RLKs y la activación de cascadas de MAPK de señalización de MAPK. Algunos LRR-RLKs, como FERONIA, BAK1 y ER; tiene dos funciones que controlan la inmunidad de planta y el crecimiento de células diferentes y procesos de desarrollo. Las bases moleculares y genéticas de esta doble funcionalidad aún son imprecisas.

En consecuencia, la proteína ER regula negativamente, a través de su interacción genética con dos parálogos estrechamente relacionados (ERL1 y ERL2) y proteína tipo receptor LRR "muchas bocas" (TMM), varios procesos de desarrollo, tales como los la modelación de los estomas, arquitectura de la inflorescencia, forma del órgano lateral, desarrollo del óvulo y la eficiencia de la transpiración. Una cascada de señalización MAPK, que incluye los módulos de YODA MAP3K, y MKK4/5 y MPK3/6 quinasa, se ha colocado corriente abajo de los receptores en la modelación de estomas, pero las interacciones bioquímicas y genéticas entre estos componentes no se han demostrado debido a los fenotipos asociados a la letalidad de algunas de los mutantes correspondientes.

El desarrollo de cigotos también depende de la YODA (vía de señalización MAP quinasa). La pérdida del gen YODA de quinasa MAPKK o los dos genes de MAP quinasa MPK3/MPK6 bloquea la elongación del cigoto, de tal manera que la primera división produce una célula basal anormalmente pequeña que normalmente no forma un suspensor reconocible (Lukowitz, W., et al., Cell 116: 109-19 (2004)). Las formas hiperactivos de YODA tienen el efecto opuesto, lo que origina suspensores anormalmente largos y, a menudo inhiben completamente el crecimiento de los proembriones (Lukowitz, W., et al., Cell 116: 109-19 (2004)).

Hasta ahora, la estrategia para la generación de plantas resistentes a los hongos ha implicado con frecuencia la cruza de rasgos de resistencia cuantitativos (QTL de resistencia). Sin embargo, la desventaja de este procedimiento es que los rasgos indeseables frecuentemente también se cruzaron Por otra parte, los métodos de mejoramiento genético son muy complicados y laboriosos.

DESCRIPCIÓN DE LA INVENCIÓN

La presente invención se basa en el objeto de proporcionar un método para generar una resistencia de la planta a los patógenos. El objetivo se obtiene mediante las formas de realización caracterizadas en las reivindicaciones.

La invención en consecuencia se refiere a un método de aumentar la resistencia a uno o más patógenos en una planta monocotiledónea o dicotiledónea, o una parte de una planta, por ejemplo en un órgano, tejido, una célula o una parte de una célula de planta, por ejemplo en una organela, que comprende introducir en y expresar en, la planta o célula de planta un ácido nucleico que codifica una proteína de YODA, y que media un aumento de resistencia al patógeno, con preferencia un aumento de resistencia a los patógenos fúngicos, oomicetes y/o bacterianos.

En una forma de realización adicional, la invención se refiere a un método de aumentar la resistencia a uno o más patógenos en una planta monocotiledónea o dicotiledónea, o una parte de una planta, por ejemplo en un órgano, un tejido, una célula o una parte de una célula de planta, por ejemplo, en una organela, en tal método una secuencia de ADN endógena que codifica la proteína de YODA y que media un aumento de resistencia al

patógeno, con preferencia un aumento de resistencia a patógenos fúngicos, oomicetes y/o bacterianos, aumenta en la planta, parte de planta o célula de planta en comparación con la planta original o tipo salvaje, o una de sus partes, o en tal método, la secuencia génica endógena o con preferencia la región no traducida (5'UTR) se modifica en comparación con la secuencia original.

En forma original, se ha hallado que una mutación letal no embrionaria hipomórfico (elk2/YODA 10) en el gen YODA de Arabidopsis lleva a un aumento de susceptibilidad de estas plantas de YODA10 a los hongos necrotróficos y biotróficos, y una bacteria y que el gen en consecuencia cumple un papel en la mediación de la resistencia al patógeno de plantas.

Además, las plantas con una activación constitutiva de YODA (CA:YODA) mostraron resistencia de espectro amplio, lo que indica que YODA regula las cascadas de señalización de MAPK, que inicia la inmunidad innata. Esta función es distinta de la regulada...

 


Reivindicaciones:

1. Un método para aumentar la resistencia fúngica en una planta, una parte de planta, o una célula de planta, caracterizado porque el método comprende la etapa de aumentar la expresión y/o actividad de una proteína de YODA en la planta, parte de planta, o célula de planta en comparación con una planta de tipo salvaje, parte de planta de tipo salvaje o célula de planta de tipo salvaje.

2. El método de acuerdo con la reivindicación 1, caracterizado porque dicha proteína de YODA comprende una secuencia de aminoácidos que tiene al menos 80% de identidad con SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 69 o 72.

3. El método de acuerdo con las reivindicaciones 1 o 2, que comprende introducir una secuencia de nucleótidos exógena que codifica una secuencia de aminoácidos que tiene al menos 80% de identidad con las SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 69 o 72 en una planta, una parte de una planta, o a célula de planta, y expresar dicha secuencia de nucleótidos en la planta, la parte de la planta, o la célula de planta; donde dicha secuencia de nucleótidos aumenta en la planta, la parte de la planta, o la célula de planta en comparación con la planta original, o de tipo salvaje, parte de la planta, o célula de planta.

4. El método de acuerdo con las reivindicaciones 1 o 2, que comprende modificar una secuencia de nucleótidos endógena que codifica una secuencia de aminoácidos que tiene al menos 80% identidad con SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 69 o 72, y/o la región no traducida (5'UTR) en comparación con la secuencia original.

5. El método de acuerdo con la reivindicación 3, caracterizado porque dicha secuencia de nucleótidos comprende al menos una molécula de ácido nucleico seleccionado del grupo que consiste en:

a) una molécula de ácido nucleico exógena que codifica al menos un polipéptido que comprende la secuencia como se muestra en la SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 69 o 72;

b) una molécula de ácido nucleico exógena que comprende al menos un polinucleótido

de la secuencia como se muestra en la SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21,

23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 70 o 71,;

c) una molécula de ácido nucleico exógena que codifica a polipéptido cuya secuencia tiene al menos 80% de identidad con la secuencia como se muestra en la SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 69 o

72;

d) una molécula de ácido nucleico exógena que comprende al menos un polinucleótido cuya secuencia tiene al menos 80% de identidad con la secuencia como se muestra en la SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 69, 70 o 71;

e) una molécula de ácido nucleico exógena de acuerdo con (a) a (d) que codifica un fragmento o un epitope de la secuencia como se muestra en la SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 69 o 72;

f) una molécula de ácido nucleico exógena que codifica un polipéptido que es reconocido por un anticuerpo monoclonal dirigido contra un polipéptido que está codificado por la molécula de ácido nucleico como se muestra en (a) a (d);

g) una molécula de ácido nucleico exógena que se hibrida en condiciones rigurosas con el complemento de la molécula de ácido nucleico como se muestra en (a) a (d); y

h) una molécula de ácido nucleico exógena que se puede aislar de un biblioteca de ADN usando el complemento de la molécula de ácido nucleico como se muestra en (a) a (d) o sus partes-fragmentos de al menos 15 nt, 20 nt, 30 nt, 50 nt, 100 nt, 200 nt o 500 nt, como sonda condiciones de hibridación rigurosas; la secuencia de nucleótidos es tal que se genera una resistencia al patógeno o aumenta de este modo;

i) una molécula de ácido nucleico exógena de (a) a (d) anterior, pero que difiere de la molécula de ácido nucleico de (a) a (d) anterior debido a la degeneración del código genético.

6. El método de acuerdo con cualquiera de las reivindicaciones 1 a 6, caracterizado porque se genera o aumenta una resistencia al patógeno fúngica o bacteriana.

7. El método de acuerdo con la reivindicación 6, caracterizado porque el patógeno fúngico es necrotrofo, un biotrofo o un patógeno Oomycete.

8. El método de acuerdo con cualquiera de las reivindicaciones 3 o 5-7, caracterizado porque comprende

a) introducir en una célula de planta un casete de expresión recombinante que comprende la molécula de ácido nucleico caracterizada en (a) a (i) en una unión operable con un promotor que es activa en las plantas;

b) regenerar una planta de la célula de planta, y

c) expresar dicha molécula de ácido nucleico para generar o aumentar una resistencia al patógeno en dicha planta.

9. El método de acuerdo con la reivindicación 8, caracterizado porque el promotor es un promotor inducible por patógeno o un promotor específico de epidermis o mesófilo, o el promotor es un promotor inducido por estrés; con preferencia cuando el promotor se selecciona del grupo que consiste en un promotor inducido por: estrés osmótico, estrés por sequía, estrés por frío, estrés por calor, estrés oxidativo, deficiencia de nutrición, infección con un hongo, infección con un oomycete, infección con un virus, infección con una bacteria, infestación con nematodos, infestación con plagas, infestación con malezas, y herbívoro.

10. El método de acuerdo con cualquiera de las reivindicaciones 1-9, caracterizado porque la planta se selecciona del grupo que consiste en: soja, papa, algodón, colza, colza oleaginosas, cañóla, girasol, alfalfa, trébol, banana, mora, arándano, frutilla, frambuesa, melón cantalupo, zanahoria, coliflor, café, pepino, berenjena, uva, melón dulce, lechuga, mango, melón, cebolla, papaya, pimienta, piña, calabaza, espinaca, calabaza, tabaco, tomate, tomatillo, sandía, manzana, durazno, pera, cereza, ciruela, brócoli, col, coliflor, repollos de Bruselas, coles, grosellas, palta, naranja, limón, pomelo, mandarina, alcaucil, cereza, nuez, maní, escarola, puerro, arrurruz, remolacha, yuca, nabo, rábano, ñame, batata, arveja, poroto, caña de azúcar, césped, Miscanthus, pasto varilla, trigo, maíz, maíz dulce, arroz, mijo, sorgo, cebada y centeno.

11. El método de acuerdo con la reivindicación 5, caracterizado porque dicha secuencia de nucleótidos es una unión operable con un promotor inducible por patógeno o un promotor específico de epidermis y/o mesófilo.

12. Un casete de expresión de ADN recombinante caracterizado porque comprende una molécula de ácido nucleico caracterizada en la reivindicación 5.

13. El casete de expresión de ADN recombinante de acuerdo con la reivindicación 12,

caracterizado porque dicha secuencia de ácidos nucleicos es una unión operable con un promotor que es funcional en las plantas.

14. Un vector recombinante caracterizado porque comprende el casete de expresión de acuerdo con la reivindicación 12.

15. Una célula caracterizada porque comprende la molécula de ácido nucleico caracterizado en la reivindicación 5, un casete de expresión de ADN que comprende dicha molécula de ácido nucleico, o un vector que comprende dicho casete de expresión.

16. Un organismo no humano transgénico o una planta, caracterzado porque comprende una molécula de ácido nucleico caracterizada en la reivindicación 5, un casete de expresión de ADN que comprende dicha molécula de ácido nucleico, o un vector que comprende dicho casete de expresión, o que comprende una célula que comprende dicha molécula de ácido nucleico, dicho casete de expresión, o dicho vector.

17. El organismo o la planta de acuerdo con la reivindicación 16, caracterizado porque es seleccionado del grupo que consiste en soja, papa, algodón, colza, colza oleaginosas, cañóla, girasol, alfalfa, trébol, banana, mora, arándano, frutilla, frambuesa, melón cantalupo, zanahoria, coliflor, café, pepino, berenjena, uva, melón dulce, lechuga, mango, melón, cebolla, papaya, pimienta, piña, calabaza, espinaca, calabaza, tabaco, tomate, tomatillo, sandía, manzana, durazno, pera, cereza, ciruela, brócoli, col, coliflor, repollos de Bruselas, coles, grosellas, palta, naranja, limón, pomelo, mandarina, alcaucil, cereza, nuez, maní, escarola, puerro, arrurruz, remolacha, yuca, nabo, rábano, ñame, batata, arveja, poroto, caña de azúcar, césped, Miscanthus, pasto varilla, trigo, maíz, maíz dulce, arroz, mijo, sorgo, cebada y centeno.

18. Un método para generar una planta transgénica que es resistente a oomycetes y/u hongos y /o patógenos bacterianos, caracterizado porque comprende usar la molécula de ácido nucleico caracterizado en la reivindicación 5, un casete de expresión de ADN que comprende dicha molécula de ácido nucleico, un vector que comprende dicho casete de expresión, o una célula que comprende dicha moléculas de ácido nucleico, dicho casete de expresión, o dicho vector.

19. Un cultivo, material de propagación o composición caracterizado porque comprende la molécula de ácido nucleico caracterizado en la reivindicación 5, un casete de expresión de ADN que comprende dichas moléculas de ácido nucleico, o un vector que comprende dicho casete de expresión, o que comprende una célula que comprende dicha molécula de ácido nucleico, dicho casete de expresión, o dicho vector.

20. Uso de alguna de las moléculas de ácido nucleico descripta en las reivindicaciones 5, el casete de expresión de ADN de acuerdo con la reivindicación 13 o 14, o el vector de acuerdo con la reivindicación 15 caracterizado porque es para la transformación de una planta, parte de planta, o célula de planta para proporcionar una planta, parte de planta, o célula de planta resistente a hongos.

21. La parte cosechable de un organismo no humano o planta transgénico descripta en la reivindicación 16 o 17, caracterizada porque la parte cosechable con preferencia es una semilla transgénica de la planta transgénica.

22. El producto derivado de un organismo no humano de acuerdo con la reivindicación 16 o planta de acuerdo con la reivindicación 18, de una planta producible por el método de cualquiera de las reivindicaciones 1-10o18odela parte cosechable de la planta de acuerdo con la reivindicación 21, caracterizado porque el producto es con preferencia harina de soja o aceite de soja.

23. Método para la producción de un producto caracterizado porque comprende

a) cultivar una planta de acuerdo con la reivindicación 16 o 17 o se puede obtener por el método de acuerdo con cualquiera de las reivindicaciones 1-10 o 18 y

b) producir dicho producto de o por la planta y/o parte, con preferencia semillas, de la planta.

24. Método de acuerdo con la reivindicación 23 caracterizado porque comprende

a) cultivar una planta de acuerdo con la reivindicación 16 o 17 o se puede obtener por el método de acuerdo con cualquiera de las reivindicaciones 1-10 o 18 y eliminar las partes cosechables definidas en la reivindicación 21 de las plantas; y

b) producir dicho producto de o por las partes cosechables de la planta.

25. Método de acuerdo con las reivindicaciones 23 o 24, caracterizado porque el producto es harina o aceite con preferencia, harina de soja o aceite de soja.

At_YODA

Vv_YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm__YODAl

Gm YODA1

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os_YODAl

Hv_YODAl

Sb_YODAl

Ta^YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

Sl_YODAl

Consensus

1 90

MP-WWK--SKDEKKKTNKESIIDAFNRKLGFASEDRSSGRSRKSRRRRDEIVSERGAISRLPSR

MPSWWGKS SKEVKKKENRESFIDSIHRKFRTVSEEKCNNRSGASQRHCGDTVSEKESRSRAQSR MRSWWGKSSSKEEKKKANKESFIDTINRKFKITSKEKSNNRSGGSRRCCKDTLSERVSLSRVPSR MPSWWGKSSSKEAKKKTNKESFIDTLHRKFKIPSEGKVSNRSGGSHRRCSDTISEKGSQSRAESR MPSWWGKSSSKEAKKKTNKESFIDTLHRKFKIPSEGKVSNRSGGSHRRCSDTISEKGSQSRAESR MPSWWGKSSSKEVKKKANKESFIDTLHRRFKSPSDGKLNGRPGGSRRRCSDTISERGSQSRAESR MPSWWGKSSSKELKKKANKESFIDTLHRRFKSPSDGNLNGRSGGSRRHCSDTISERGSQSRAVSR MPSWWGKSSSKEVKKSKESLIDTLQRKLRT-TDGKTNSKSGESPRNCNDTISEQGSRSPIFSR MPSWWGKSSSTKKKANKESFIDAFHRKFKIPSEGKPSGRSGGSRRHCDDSISEKGAQSPPESR MPSWWGKSSSTKKKANKESFINAFHRKFKIPSEGKPNSRSGGSRRHSNDSISEKGAQSPPESR MLTWWGKSSSKETKKKANKESFFDTLHRKLRISSKGKVSIRSGGSRRHCNDTISEKGDHSPCGSR MLTWWGKSSSKKTKKKANKESFFDTLHRKLRISSEGKVNIRSGGSRRHCNDTISEKGDHSPSGSR MPSWWKSSKEAKKKPTKESFIDTLHRKFKSPAEVKSPGKSGGSRRHNSDIASEKGSLSQAQSR MRSLLRNELVYACDATSNQLKAPEKMPSWMGKSK-AKKKATKESFIDSLHRKFKSPAEAKSPSKSGGSRRHNNEIASEKGSQSQAQSR

MPPWWGKSFSKDAKK-TTKENLIDTFHR-LISPNDQKGSTKSKRSCRRGNDSSVEKSCRSTTVSR MPSWWGKSSSKDAKK-TTKENLMDTFHR-FISPNEQKGSGKSKRRYRRGDDTTVEKVCQSTTVSR MPTWWGKSSSKDVKK-TTKENLIDTFHR-LISPNEQKGSTKSKRNCRRGN-TAAEKVCKSTTVSR MPSWWGKSSSKDAKK-TTKENLMDTFHR-FISPNEQKGSTKSKRRYRRGDDTTVEKVCQSTTVSR MPPWWGKSSSKEVKK-TAKENLIDT FHR-LLS PNEQKGRTKSRGNRRHSKDPTAEKGCWSTAQSR MPPWWGKSSSKEVKK-TAKENL IDT FQR-LIS SNEQKGSRKSRGSRKHGKDTAGDKGCWSTAQSR MPPWWGKSSSKEVKK-SAKENL IDT FQR-L IS SNEQKGSRKSRS SRRHGKDTAGDKGCWSTAQSR

M S S WWE KS S SKD VKRKE KRK S11DTIQRKL--------NKSRGSRRNHSHTNSEKGTTSLVPTT

MRLWWGKSSSKESKRKANKETIIDTIQRKLKNTSEEKCNNKSGRSRRHHDDAISKKGSRSLTPST MRSWWGKSSSKDVRRKSTKESFIDIINRKLKIFTTEKSSGKSGSSRRRRKDTNSVKGSQSRV-SR MpsWWgkSsSKe.Kkk..kEsfiDt.hRkl....e.k...kSggsrR...dt.sekg..S...Sr

At_YODA

Vv_YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm_YODAl

Gm_YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os_YODAl

Hv_YODAl

Sb_YODAl

Ta_YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

S1_Y0DA1

Consensus

91 180

SPSPS---TRVSRCQSF-AERSPAVPLPRPIVRP HVTSTDSGMNG-SQRPGLDANLKPS-WLPLPKPHGATSIPDNTGAEPDFATAS

SPSPS---TKVSRCQSF-AERPHAQPLPLPGPHL--TSVVRTDSGINA-SKKQGLVEGSKTQMVLPLPRPGYVANRLDPTDAEGDLATAS

SPSPS---THVSRCQSF-AERPQAQPLP PLPGVPHTKIGRCDSGISA-SVKPGLDGGGKPLHLLPLPRPGHVLNRLDQADTAGDLATAS

SPSPS---KLVSRCQSF-VERPNAQPLPLPGRHP--ASVGRTDSGISI-STKQRLEKGSKSS-FLPLPRPRCIGGRPDPTDLDGDFV-AS

SPSPS---KLVSRCQSF-VERPNAQPLPLPGRHP--ASVGRTDSGISI-STKQRLEKGSKSS-FLPLPRPRCIGGRPDPTDLDGDFV-AS

SPSPSPSSKHVSRCQSF-AERPHAQPLPLPGVHP--ASVGRTDSGIGI-STKPRLQKGAKSSLFLPLPRPGCMRNKSNPTDLDGDLATTS SPSPS--SKHVSRCQSF-AERPHAQPLPLPGVHL--ANGGRTDSGIGI-LTKPRSEKGANSSLFLPLPRPGCIRNRPNPPDLDGDLATAS

SASPS---KQVLRCQSF-SERPQAQPLPLPGVQP--PIVGRTDSGIRI-SPKPRSERGSKPSSFLPLPRPACIRGQPNHADLDADVGVGS

SPSPS----KVGRCQSF-VERPHAQPLPLPGLHP--SNISRADSEISIPSSRRRHGKGSKSSLFLPLPKPACMRGRLNPAELDGDLVTAS

SPSPS----KVGRCQSF-VDRPHAQPLPLPGLHP--SNISRADSEISIPSSRARHEKGSKPSLFLPLPKPVCIRGRLNPADLDGDLVTAS

SPSPS----KVARCQSF-IDRPHAQPLPLPGLHP--SSVGRVDSEISI-SSKSRLEKVSKPLSFLTLPTPGCIRCRPNPADLDGDMVTAS

SPSPS----KVARCQSF-IDRPHAQPLPLPGLHP--SSVGRVDSEISI-SSKSRLEKVSKPSLFLPLPTPGCIRCRPNPADLDGDMVTPS

ASSPS---KHVSRCQSF-AERPLAQPLPLPGVRPANVGRSDSGISP-SAKSRVEKASKPSLFLPLPKPACIRHRLDPTDTDGELVFAS

SSSPS---KNVSRCQSF-AEKALAQPLPLPGLPPASVVRADSGISQ-SAKPRIGKGSKLSLFLPLPKPACIRHRLDPADADGELVFAS

PTSPS---KEVSRCQSFSADRPHAHPLPIPGVRP--PVTRTVSDITESKPILEKRGKPPLLLPLPKPNRPPRRHGNSEWSEIWAS

ATSPS---KEVSRCQSFSADRLHFQPLPVPGSRP-----------------AVTRTASDVTE SRPILEKRGKP PLLLPLPK PNR PQKR-SEIVIAS

PTSPS---KEVSRCQSFSADRLHAQPLPIPGVRP--RVTRAVADVNDSKPI LEKRGKP PLLLPLPK PN PLQRGPGSS DIPSEIWAS

ATSPS---KEVSRCQSFSADRVHSQPLPVPGSRP-----------------AVTRTASDVTE SRP I LEKRGKP PLLLPLPK PNR PQRR-SEIVIAS

SASPS---KEVSRCQSFAAARAHAQPLPLPRSRA--MVARTASDITESKWLEKRGKGQQL-PLPTTNWVKERPETTEPVAELSTAS

STSPS---KEVSRCQSFAADRPPAQPLPLPKSRA--RVTRTSSDITNSKSTLEKHGKGQLL-PLPPTQ-PRKRPEATEPVTEVATAS

STSPS---KEVSRCQSFAADRPHAQPLPLPKSRA--KVTRTSSDITNSKSTLEKHGKGQLL-PLPPIQ-PKKRPEATEPVTEVATAS

SPSPS---THVSRLQSF-AERPLAQPLPLPGTHCSSTNRANSGTSV-TSKPQSTWGLKSSLYFPLPKPGCVFNRGEPTDAEEDIATAS

SASPS---THVSRVPSF-TERPLSQPLPLPGSHLPAAIDVSSGVIL-TSKLERAIGSKLSLNFPLQKPGYVSNKEDPTDAAGDIASAS

SPSPS-------------------------------------TGSIILV------T GEV S E P S LT LPLPM PR H L P H G PT A AG VDRDL PT AS

spSPS k.VsRcqSF.aerp.aqPLPIPg..p..v.rtdSgi.. ssk..lek..kpsl.1PLP.p r..p.d..g#..taS

Ei£U

At_YODA

Vv_YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm_YODAl

Gm_YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

S1YODA2

S1YODA3

OsYODAl

HvYODAl

SbYODAl

Ta_YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

S 1_ YO DA 1

Consensus

Deleción CA:YDA

181 ^ 270

VSSGSSV-GDIPSDSLLSPLASDCENGNRT---PVNISSRDQ-SMHSNKNSAEMFKP VPNKNRILSASPRRRPLGTHVKNLQIP

VFSYSSIDSEDPSES-RLLSPQASDYENGNRTTMNSPSSVMHKDQSPVLTPRKPREALRPA-NLLLNNQIHSTSPKWVPLSTHVPNFPVP VSSDSSIDSDDLPDS-RVLSPLTSDYENGNRTAVNSPPSVMRQDQSPIINRKNSRETLKHA-NLPANNQTLSTPPKRAIFSSQVQNLQIP VYSEGSTDSEDAADS-HHRSPQATDYDNGTRTAASIFSSVMLKDQ-SPVAHVNAREAQKPA-NLLFSNHISPTSPKRRPLSSHVPNLQVP VYSEGSTDSEDAADS-HHRSPQATDYDNGTRTAASIFSSVMLKDQ-SPVAHVNAREAQKPA-NLLFSNHISPTSPKRRPLSSHVPNLQVP VFSESSTDSEDPADS-SHRSPLATDYDLGTRTIASSPSSAMVKDHCATVSQVNSREAKKPA-NLSFGNHTSPTSPKRRPISSHVPNLQVP VSSESATDSDDPADS-SHRSPAATDYDLGTRTTTSSPSSAMLKDQCAIVSHSNSKEAKKPA-SLSFGNHTSSTSPKRRPVSSHVLNLQVP VSSESSTDSTDLSDS-RHRSPQATDYDLGTKTAASSPSSVILKDQSSTLTQPSSQKARKPA-NISLSNHIFSTSPKRRPLSSHVPNLQVP VSSESSADSDEPVDS-HNRSPLATDCETGTRTAAGSPSSLMQKDQSSTVSQINSREAKKPA-NI-LGNHMSSTSPKRRPLSNHVTNLQIP VSSESSADSDEPVDS-RNRSPLATDCETGTRTAAGSPSSLMVKDQSTTVSQINSREAKKPA-NI-LGNHTSSTSPKRRPLSNHVTNLQIP VFSDCSADSDEPADS-HNRSPLAIDCETGTRTAAGSPSSLMLKDQPPAVSQLNSTGVKKPG-NI-LSNHMSSTSPKRRPLRNHVPNLQVP VFSDCSADSDEPADS-HNRSPLATDCETGTRTAAGSPSSSMLKDQPPTVSLLNSTGVKKPG-NI-LSNHMSSTSPKHRPLRNHVPNLQVP ISSECSIESDDPIDS-RQRSPLATDYETGSRTAAGSPSSLWKDQ-SAVGQISLKEMTRPV-SLSPSRNVSSVSPKRRPLSSHVTTLQVP ISSECSVESDDPTDS-RQRSPLTFDYETGNRTPLGSPPRLAVKDQ-SAVGQTSIKEATELV-NLSPSGHVSSRSPKRRPLNSHLSSIQIP PSSNCS-DSDDHGDS-QLQSPVGNDAENATLVTLKNKSSNARKECPGPITAKNMKEIHRPA-NQVHGSHILSTSPRG-VAADSYQSNLQN LSSNCSIDSDDHGDS-QLPSPVGNDAENTTNTTSKSKSSNVRKERPGAITTKHTKEMTKTA-NQFLSNHTLSTSPRG-IAADNHQSNPQN VSSNCSADSEDRADS-QLQSPVGNDSDNVTKVSSKKKSSNVRKDQSGAITTKTTKEILKPAANAFPSNHTQSTPPRG-ISADNNQPDLQN LSSNCSVDSDDHGDS-QLPSPVGNDAENTTNTTSKSKSSNVRKERPGAITTKNTKEMAKTA-NQFLSNHTLSTSPRG-IAADNHQPNPQN ISSHGSIDSDDPGDL-RLQGPVANDTDNVAKVATTGNSSVVHKECSSAITRKGTKEVTMPT-NAFLSNQILSTSPRGTWADSYQSNLQN VSSNCSIDSDDPGDS-RLQSPVGNEVENATRITATSSSSVLHKERSSAITKKSTKEVAKPN-NAFLSNQILSTSPRGTV-ADGYQSNLQS VSSNCSIDSDDPGDS-QLQSPVGNEAENATRITATSSSSVVRKECSSAITRKNTKEVAKPN-SAILSNQILSTSPRGTF-ADGYQSNLQS ISSGSSIDSDDQCDS-HFLSPLASDSENGNQATVHNTVSVVHKDQPPITIQKNSRVSSKPA-PQLCNHQLLYNTPKGASLHLPNPQIA VSSDSSIDSGNSFDSPHLVSPLASDCENGNPATINSSLSVVHRNQSLITIQRNSRASSKSS-PQLCNNKTSSTSPRGAPLHLQNLKIA VSCDSSSDSDDLTDS-RFLSPQTSDYENGSRTALNSPSSLKQKVQSPIASNASSGEMLKSA-TLLSDNQAIPTSPRQRLLRSHVPPGLQI vsS.sS.#Sd#..DS...SP.a.D.#ngtrt...spss...k#q......ns.e..kpa n....nh..stsPk.rpl..hv.nlq.p

At_YODA

Vv_YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm_YODAl

Gm_YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os_YODAl

Hv_YODAl

Sb_YODAl

Ta^YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

S 1_ YO DA 1

Consensus

271 360

QRDLVLCSAPDSLLSSPSRSPMRSFIPDQVSNHGLLISKPYSDVSLLGSGQCSSPGSGYNSGNNSIGGDMATQLFWPQSRCSPECSPVPS QNG-AFCSAPDSSMSSPSRSPMRLFSPEQVMNSSFWTGKPYADIALLGSGHCSSPGSGHNSGHNSIGGDMSGQLFWPHSRCSPECSPIPS HRV-AFFSAPDSSMSSPSRSPMRAFGTEQVINNGFWAGKTYSDIGLLGSGQCSSPGSGYNSGQNSIGGDMSGQLLWPNSRCSPECSPLPS YHG-AFGSAPDSSMSSPSRSPLRAFGTDQGLNSAFWAGKPYSDVTLLGSGQCSSPGSGQNSGHNSMGGDMSGQLFWQPSRGSPE SPIPS YHG-AFGSAPDSSMSSPSRSPLRAFGTDQGLNSAFWAGKPYSDVTLLGSGQCSSPGSGQNSGHNSMGGDMSGQLFWQPSRGSPE SPIPS KHG-SFCSAPDSYMSSPSRSPMRAFGAEQVINSAFWAGKPYPDVNLLGSGHCSSPGSGYNSGHNSMGGDMSGQLFWQQSRGSPECSPIPS QHV-ASGSAPDSSMSSPSRSPMRASSTEQVINSAFWAGKPYPDANFLGSGHCSSPGSGYNSGHNSMGGDMSGQLFWQQSRGSPECSPIPS YHG-NVCIAPDSSMSSPSRSPIRAFSSEQVINNAVSTGKFYMDVTFPGSGHCSSPGSGYNSGHNSMGGDLSGQLFLQQSRGSPE SPVPS PHG-AFFSAPDSSRSSPSRSPLRAFGTEQVLNSAFWAGKPYPEVNFGGSGHCSSPGSGHNSGHNSMGGDMSGQLFWQPSRGSPE SPVPS PHG-AFCSAPDSSRSSPSRSPLRSFGTEQVLNSAFWAGKPYPEVNFGGSGHCSSPGSGHNSGHNSMGGDMSGQLFWQPSRGSPE SPVPS PHG-AFYSAPDSSLSSPSRSPLRAFGTDQVLNSAFLAGKPYPEINFVGSGHCSSPGSGHNSGHNSMGGDMSGPLLWQPSRGSPE SPVPS PHG-AFYSTPDSSLSSPSRSPLRAFGTDQVLNSAFLAGKPYPEVNFVGSGHCSSPGSGHNSGYNSMGGDMSGPLLWQPSRGSPE SPVPS PPG-AFCSAPDSSMSSPSRSPMRAAASEQVTSSTLWAGRAYPDLPSLGSGHCSSPGSGQNSGHNSMGGDMSGQLFWQPCRGSPE SPIPS SHG-TLCSVPDSSISSPSRNPMKAAGCEQVSSSTFWAGKTYPDLPLLGSGHCSSPGSGQNSGHNSMGGDMVGQLFWQPSRGSPE SPIPS PRPLVLDSAPNSLMSSPSRSP-RRICPDHIPTSAFWAVKPHTDVTFVGSGQCSSPGSGQTSGHNS GGDMLAQLFWQPSRSSPECSPIPS PRPWLESAPNSLMSSPSRSP-RRICPDHIPTSAFWAVKPHTDVTFLGSGQCSSPGSGQTSGHNS GGDMLAQLFWQPSRGSPECSPIPS LRPWFESAPNSLMSSPSRSP-RPICPDHIPTSAFWAVKPHADVTFLGSGQCSSPGSGQTSGHNS GGDMLAQLFWQPTRGSPECSPVPS PRPWLESAPNSLMSSPSRSP-RRI CPDH IPTSAFWAVKPHTDVTFLDSGQCSSPGSGQTSGHNS GGDMLAQLFWQPSRGSPECSPIPS SRKWLDSAPNSVMSSPSRSP-RILCPDQIPSSAFWAVKPHTDVTFVGSAQCSSPGSGQTSGHNS GGDMLAQLFWQPSRGSPECSPIPS PRQIALESAPNSLMSSPSRSP-RIICPDQIPTSAFWAVKPHTDITFLGSGQCSSPGSGQTSGHNS GGDMLGPIFWQPSRGSPECSPIPS PRQIALESAPNSLMSSPSRSP-RNICPVQIPTSAFWAIKPHTDVTFLGSGQCSSPGSGQTSGHNS GGDMLGPIFWQPSRGSPECSPIPS

SSG-GLWSAPDSSMSSPSRSPLRMFGSEQVLNSGFCTGKLYPDLA--TRHCSSP----GSGHNS GGDLTGHN-----------SPIPS

QPG-GLCSAPDSSVSSPSRNQMGAFGPEQMLNSELHTGKPYPDIP--SGRCYNPVSGRDSGHNS GGDISGQMILPQNKRSPECSSIPS

PHHGASYSAPDSSMSSPSRSPMRVFGHETVMNPGFWLGKPHGEITFLGSGHCSSPGSGQNSGHNSIGGDMLAQPFWPHSRCSPECSPVPS..g....SAP#SsmSSPSRsP.r.fg.#qv.nsafwagKpy.#v.flgSg.CSSPgSG.nSGhNS.GGD$sgqlfwqpsrgSPEcSP!PS

Ei£U

Deleción CA:YDA

At_YODA

Vv^YODAl

Pt^YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

CmJfODAl

GmJfODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os^YODAl

HvJfODAl

Sb_YODAl

Ta_YODAl

Os_YODA2

Sb_YODA2

Zm^YODAl

Gm_YODA5

Gm_YODA6

SlJfODAl

Consensus

361 450

PRMTSPGPSSRIQSGAVTPLHPRAGGSTTGSPTRRLDDN-RQQSH LPLPPLLISN-TCPFSPTYSAATSP-SV' RSPARAEATVSPGSR PRMTSPGPSSRIQSGAVTPLHPRAGAAAAESPTNRPDDG-KQQSHRLPLPPITISN-SCPFSPTYSTSTTP-SV' rspgr enpispgsr PRVISPGPSSRIHSGAVTPLHPRAAGVTIESPTSRPDDG-KQQSHRLPLPPITISN-THPFSPTYSASTSP-SV' RSPSRMENPTSSGTR PRMTSPGPSSRIHSGAVTPLHPRAGGAASESQTSWPDEG-KQQSHRLPLPPVAVSS-SSPFSHSNSPAASP-SV' RSPGRAEAPTSPGSR PRMTSPGPSSRIHSGAVTPLHPRAGGAASESQTSWPDEG-KQQSHRLPLPPVAVSS-SSPFSHSNSPAASP-SV RSPGRAEAPTSPGSR PRMTSPGPSSRV SGAVTPIHPRAGGTI-ESQTSWPDDG-KQQSHRLPLPPVTVSS-PSPFSHSNSAAASP-SV' RSPGR ENPTSPGSR PRMTSPGPSSRV SGAVTPIHPRAGGTIIESQTSWTDDG-KQQSHRLPLPPVIISS-PSPFSHSNSAAASP-SV' RSPGR ENPTSPGSR

PRMTSPGPSSRV SGAVTPIHPRAGGIPTESQTSWPDE--KQTHRLPLPPVAISNAPFSHSNSAATSP-SV' RSPGR DNPASPGSR

PRMTSPGPSSRIQSGAVTPIHPRAGGTPNESQTGRIDDV-KPQSHRLPLPPLAVTN-TLPFSHSNSAATSP-SM: RSPGR DNPISPGSR PRMTSPGPSSRIQSGAVTPIHPRAGGTPNESQTGRVDDV-KPQSH LPLPPLAVTN-TLPFSHSNSAATSP-SM: RSPGR DNPISPGSR PRMTSPGPSSRIQSGAVTPIHPKAGGTPTESQT-----------HRLPLPPLSVSN-SSLFSHSNSAATSP-SM: RSPARADNPNS-GSR

prmtspgpssriqsgavtpihpkaggtptesqt-----------hrlplpplsvsn-sspfshsnsaatsp-sm: rsparadnpss-gsr

PRMTSPGPSSRIHSGTVTPIHPRAVGGAGELQTSWPDDG-KAQSHPLPLPPLTISN-SSPFSHSNSVATSP-SV' RSPGR ENLASPGSR PRMTSPGPSSRIHSGAVTPIHPKAGGGASELQTNWPDDA-KPESHPLPRPPLAISN-SSPFSHSNSVATSP-SV' RSPGR ENLSSPGSR PRMTSPGPSSRV SGSVSPLHPRSGGMAPESPTNRHDDGKKKQTHKLPLPPLSISHSSFHPNNSTPTSPISV' RSPGRIENPPSPGSR PRMTSPGPSSRV SGSVSPLHPRSGGMAPESPTGRNDGGKKKQTHRLPLPPLSISNSSFFPNKSTPASPISA. RSPGRIENPPSPGSR PRMTSPGPSSRV SGSVSPLHPRSGGVAPESPTSRHDDGKKKQTHKLPLPPLSISNTNSSFLPNNSMPSSPISV' RSPGRTENPSSPASR PRMTSPGPSSRV SGSVSPLHPRSGGMAPESPTGRNDGGKKKQTHRLPLPPLSISNSSFFPNKSTPASPISA. RSPGRIENPPSPGSR PRMTSPGPSSRV SGSVSPLHPRAGGMAPESPTRRLDEGKRKQTH LPLPPLSICN-NSTFLPNNSTPTSPISHSPGR ENPTSPGSR PRMTSPGPSSRV SGSVSPLHPRAGGVTPESPTNRHAEGNKKQTHRLPLPPISTAN-ISTFLPNSSTPASPISRSPGRTENPPSPGSR PRMTSPGPSSRV SGSVSPLHPRAGGVTPESPTNRHAEGNKKQTHRLPLPPLSIAN-SSTFLPNSSNPTSPISRSPGRTENPPSPGSR PGMKSPGFSSRIHSGAVTPLHPRAGSAALESPTRRPDDV-KQ-THRLPLPPITIPN-HCPFSPTYSATTTP-SA. RSPSIAENLTYPGSR PR `TSPGPSSRTQSGTVTPLHPKAGGAAAEAPTRRPDDV-KQKNHQLAIPPITATK-SCPFSPTYSALTTP-SA. RSPGR!ENSSSPGSR

PRMTSPGPGSRIHSGAVTPLHPRAGGTLAESSTASLDNG-KQQSHRLPLPPISIPH-SSTFSLSCSMTP--Al: RSPGRTGNPPSPGPR

PR SPGPSSR!hSGiVtPIHPraGg.a.EspT.r.ddg.k.q.HrLPIPPl.!sn.spFsp.nS..tsP.S.pRSPgRa#np.SpGsR

At_YODA

Vv^YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm^YODAl

Gm^YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os^YODAl

Hv^YODAl

SbJÍODAl

TaJÍODAl

Os_YODA2

Sb_YODA2

Zm_Y ODA1

Gm_YODA5

Gm_YODA6

Sl_YODAl

Consensus

AhJ_________________________________________________________un.

WKKGRLLGMGSFGHVY gfnsesgemcamkevtlcsddPKSresAQQL QEISVLSRLRHQNIVQYYGSETVEDKLYIYLEYVSGGSIYK WKKGPLGG? GTFGHVY GFNSESGEMCAMKEVTLFSDD KSKESAQQL QEISLLSRLRHPNIVQYYGSETVEDKLYIYLEYVSGGSI YK W 2KGRMLGF GSFG OVYLGFNRERGEMCAMKEVTLFSDD KSKESAQQLGQEIGLLSRLRH PNIVQ YYGSETVRDKLYIYLEYVSGGSIYK WKKGKLTjGFGTFGHVYVGFNSESGEMCAMKEVTLFSDD KSKESAí QLGQEI LLSRLCH PNIVQ YYGSETVCDKLYI YLEYVSGGSI YK WKKGKLLGFGTFGHVYV GFNSESGEMCAMKEVTLFSDD KSKESAí QLGQEI LLSRLCH PNIVQ YYGSETVGDKLYIYLEYVSGGSIYK WKKGKLLGFGTFGHVYLGFNSESGEMCAMKEVTLFSDD KSKESAÍ QLMQEISLLSRFQHPNIVQYYGSETVCDRLYIYLEYVSGGSIYK WKKGKLRGFGTFGHVY' GFNSERGELCAMKEVTLFSDD KSKESAKQLÍ QEISLLSRLQHPNIVQYKGSETVGDRLYIYLEYVSGGSIYK WKKGKLLGFGTFGHVYV GFNSESGEMCAMKEVTLFSDD KSKESAKQLÍ QEITLLSRLRHPNIVQYYGSETVGDRFYIYLEYVSGGSIYK WKKGKLLGF GTFGHVY! GFN ESGEMCAMKEVTLFSDD KSKESAKQLÍ QEITLLSRLRHPNIVQYYGSETVGDKLYI YLEYVAGGSIYK WKKGKLLGF GTFGHVY! GFN ESGEMCAMKEVTLFSDD KSKESAKQLI QEITLLSRLRH PNIVQYYGSETVGDKLYI YLEYVAGGSI YK WKKGKL GSGSFGHVY GFNSERGEMCA KEVTLFSDD KSMESAI QFMQEI LLSRLQH PNTVQYYGSETVDNKLYIYLEYVSGGSIHK WKKGK L LG S G S FGHVY RGFNSESGEMCA KEVTLFSDD PKS ESAí QFMQEI LLSRLQH PNIVQ YYGSET VE DKLYIYLEYVSGGSIHK WKKGKLLGF GTFGHVY! GFNSDSGEMCAMKEVTLFSDD KSKESAí QLGQEI LLSRLRHQNIVR YYGTETVGDKLYIYLEYVSGGSIYK WKKGKLLGF GTFGHVY! GFNSDSGEMCAMKEVTLFSDD KSKESVKQLTQEISLLSRLRH PNIVQYYGSEMVFDKLYIYLEYVSGGSIYK WKKGKLIGFGTFGHVY' GFNSDSGEMCAMKEVTLF DDPKSKESAí QLGQEISLLSRLQHPNIVQYYGSETVEDKLYIYLEYVSGGSIHK WKKGKLIGFGTFGHVYV GFNSDSGEMCAMKEVTLFSDD PKS KESAKQL QEISLLSRLQHPNIVFYYGTETVEDKLYIYLEFVSGGSIHK WKKGKLIGF GTFGHVY!:GFN DSGEMCAMKEVTLF DD KSKESAKQL QEVSLLSRLRHPNIVQYYGSEMVE DKLYIYLEYVSGGSIHK WKKGKLIGF GTFGHVY" GFNSDSGEMCAMKEVTLFSDD KSKESAKQL QEISLLSRLQHPNIVF YYGTETVEDKLYI YLEFVSGGSIHK WKKGKLVGF GTFGHVYIGFNSDKGEMCAMKEVTLFSDD KSKESAí QL QEILLLNRLQHPNIVF YYGSEMVE DKLYIYLEYVSGGSIHK WKKGKLI GF GTFGHVYY GFNSDRGEMCAMKEVTLFADD KSKESAí QL QEISLLSRLQHPNIVF YYGSETVEDKLYIYLEYVSGGSIHK WKKGKL I GF GTFGHVY! GFNSDRGEMCAMKEVTLFS DD PKS KESAf QLC QEI SLLSRLQH PNIVRYYGSETVEDKLYIYLEYVSGGSIHK WKKG 'LLGFGTFGHVYLGFNSESGEMCAMKEVTLFSDD KSRESA QLGQEI LLSHLRHPNIVQYYGSETVEDKLYIYLEYVSGGSIYK WKKG 'LLGFGTFGHVYLGFN ECGEMCAMKEVTLFSDD KSRESA QLGQEI MLSQLRHPNIVQYYGSETVEDRLYVYLEYVSGGSIYK WKKGRLIGSGTFGHVYLGFNSESGEMCAMKEVTLFSDDPKSRESA QLGQEI SLLSRLRH PNIVQYYGSETVEDKLYIYLEYVSGGSIYK WKKGkLlGrGtFGHVYvGFNs#s GEMCAMKEVTLF DD KS ESAOLOEI.SLS L H NIVgYYG.-EtV D LYIYLEYVSGGSI K

EijM

AtYODA

VvYODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm_YODAl

Gm_YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os_YODAl

Hv_YODAl

Sb_YODAl

Ta_YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

Sl_YODAl

Consensus

ydalO (P a L)

341_______________________________________________________ fian

LLQEYGQ ZGENAIRNYTQQILSGLAYLH K TVHRDIKGANILVDPHGRVKVADFGMAKHITAQSGPLSFKGSPYWMAPE---VIKNSN

LLQEYGQ GEIAIRSYTQQILSGLAYLH K TVHRDIKGANILVDPNGRVKLADFGMAKHITGQSCPLS KGSPYWMAPE--VIKNSN

LLQEYGQ GEIAIRSYTQQILF GLAYLHAK TVHRDIKGANILVDPTGRVKLADFGMAKHISGQSCPLSFKGSPYWMAPE--VIKNSN

LLQEYGQ GELAIRSYTQQILSGLAYLH^1 K TVHRDIKGANILVDPSGRVKLADFGMAKHITGQSCPLSFKGSPYWMAPE--VIRNSN

LLQEYGQ GELAIRSYTQQILSGLAYLH K TVHRDIKGANILVDPSGRVKLADFGMAKHITGQSCPLSFKGSPYWMAPELFAQVIRNSN

LLQEYGQ GELVIRSYTQQILSGLAFLHSKSTVHRDIKGANILVDPNGRVKLADFGMAKHITGQSCPLSFKGSPYWMAPE---VIKNSN

LLQEYGQ GELVIRSYTQQILSGLAFLHSKSTVHRDIKGANILVDPNGRVKLADFGMAKHITGQSCPLSFKGSPYWMAPE---VIKNSN

LLQEYGQ GDSALRSYTQQILSGLAYLH KSTVHRDIKGANILVDPTGRVKLADFGMAKHITGQSCPLSFKGSPYWMAPE---VIKNSN

LLQEYGQ GELAIRSYTQQILSGLAYLH K TVHRDIKGANILVDTNGRVKLADFGMAKHITGQSCPLSFKGSPYWMAPE--VIKNSN

LLQEYGQ GELAIRSFTQQILSGLAYLH K TVHRDIKGANILVDTNGRVKLADFGMAKHITGQSCPLSFKGSPYWMAPE--VIKNSN

LL EYGQ GELVIRSYTQQILSGIAYLHAK TLHRDIKGANILVDPTGRVKLADFGMAKHITGQSCPLSFKGTPYWMAPE--VIKNSN

LLQEYGQ GELVIRSYTQQILSGIAYLHAK TLHRDIKGANILVDPTGRVKLADFGMAKHITGQSCLLSFKGTPYWMAPE--VIKNSN

LLQEYGAFGEAAIRSYTQQILSGIAFLH K TVHRDIKGANILVDPNGRIKLADFGMAKHITGQSCPLSFKGSPYWMAPE---VIKNSS

LLQEYGPI GETTIRSYTQQILSGIAYLH K TVHRDIKGANILVDPNGRIKLADFGMAKHITGQSCPLSFKGSPYWMAPE--VIKN S

LLQEYGQ GEQAIRSYTQQILSGLAYLHAK TVHRDIKGANILVDPSGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPE--VIKNSN

LLQEYGQ GEPAIRSYTQQILSGLAYLHAK TVHRDIKGANILVDPSGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPE--VIKSSN

LLQEYGQ GEPAIRSYTQQILSGLAYLH K TVHRDIKGANILVDPSGRVKLADFGMAKHINGQHCPFSFKGSPYWMAPE--VIKNSN

LLQEYGQ GEPAIRSYTQQILSGLAYLH K TVHRDIKGANILVDPSGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPE--VIKSSN

LLQEYGQ GEPAIRSYTf QIL GLAYLH K TVHRDIKGANILVDPNGRVKLADFGMAKHINGQQCAFSFKGSPYWMAPE--VIKNSN

LLQEYGQ GEQAIRSYTf QIL GLAYLH K TVHRDIKGANILVDPNGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPE--VIKN -S

LLQEYGQ GEQAICSYTf QIL GLAYLH K TVHRDIKGANILVDPNGRVKLADFGMAKHINGQQCPFSFKGSPYWMAPE--VIKN -S

LLQQYGQ jSEIVIRNYTE QIL GLAYLH K TVHRDIK ANILVDPNGRVKLADFGMAKHISGQSCPLSFKGSPYWMAPE--VIKNSN

LVKEYGQ GEIAIRNYTI QIL GLAYLH K TVHRDIKGANILVDPSGRIKLADFGMAKHISGSSCPFSFKGSPYWMAPE--VIKNSN

ILQEYGQ GELAIQSYTQQILSGIAYLH K TVHRDIKGANILVDPNGRVKLADFGMAKHITGHYCPLSFKGSPYWMAPE--VIKNSN

LLQEYGQ- GE. al- YT:QIL.'-.GLA%LHnK TVHRDIKGANILVDP. GR! KLADFGMAKHItGasCPI SFKGSPYWMAPE VIKN

At_YODA

Vv_YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm_YODAl

Gm_YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os_YODAl

Hv_YODAl

Sb_YODAl

Ta_YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

Sl_YODAl

Consensus

gil mn

G-SNLAVDIWSLGCTVLEMATTKPPWSQYEGV A FKIGNSKELPDIPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRNVMPMER G-CNLAVDLWSLGCTVLEMATTKPPWSQYEGV A FKIGNSKELPTIPDHLSEEGKDFVRQCLQRNPLHRPTAAWLLEHPFVRNAAPLER G-CNLAVDIWSLGCTVLEMATTKPPWSQYEGV A FKIGNSKELPEIPDNLSDDGKDFVRQCLQRNLSHRPTAAQLLEHPFVKNVAPMER G-CNLAVDIWSLGCTVLEMATTKPPWSQFEGV A FKIGNSKDLPAIPDHLSDEGKDFVRQCLQRNPLHRPTAAQLLEHPFVKNAAPLER G-CNLAVDIWSLGCTVLEMATTKPPWSQFEGV A FKIGNSKDLPAIPDHLSDEGKDFVRQCLQRNPLHRPTAAQLLEHPFVKNAAPLER G-CNLAVDIWSLGCTVLEMATTKPPWSQFEGV A FKIGNSKDLPEIPEDLSDEGKDFVRQCLQRNPVHRPTASQLLEHPFVKLAAPLER G-CNLAVDIWSLGCTVLEMATTKPPWSQFEGV A FKIGNSKDLPTIPDHLSDEGKDFVRQCLQRNPLHRPTAAQLLEHPFVKSAAPLER G-CNLAVDIWSLGCTVLEMATTKPPWSQYEGV A FKIGNSKELPEIPDHLSHDGKDFVRQCLQRNPAHRPTAAQLLI.HPFVKIIAAPLER G-CNLAVDIWSLGCTVLEMATTKPPWSQYEGV A FKIGNSKELPTIPDHLSSEGKDFVRKCLQRNPHNRPSASELLDHPFVKCAAPLER G-CNLAVDIWSLGCTVLEMATTKPPWSQYEGV A FKIGNSKELPTIPDHLSCEGKDFVRKCLQRNPHNRPSASELLDHPFVKYAAPLER G-CNLAVDIWSLGCTVLEMATTKPPW QYEGV A FKIGNSKELPTIPDHLSNEGKDFVRKCLQRNPHDRPSASELLDHPFVKNAAPLER G-CNLAVDIWSLGCTVLEMATTKPPW QYEAV A FKIGNSKELPTIPDHLSNEGKDFVRKCLQRNPYDRPSACELLDHPFVKNAAPLER G-CNLAVDIWSLGCTVLEMATSKPPFSQYEGV A FKIGNSKELPTIPEQLSDEAKDFVRKCLQREPRLRPTAAQLLDHPFVKNVATLEK G-CNLAVDVWSLGCTVLEMATSKPPWSQYEGV A FKIGNSKELPTIPEELSDEGKDFVRKCLQREPRNRPTAAELLEHPFVKDAAPLEK G-CNLAVDIWSLGCTVLEMATSKPPWSQYEGIAAMFKIGNSKELPPIPDHLSEPGKDFIRKCLQRDPSQRPTAMELLQHPFVQKAVSLEK GGCNLAVDIWSLGCTVLEMAT KPPWSQYEGIAAMFKIGNSKELPPIPDHLSEQCKDFIRKCLQRDPSQRPTAMELLQHSFIQYKVRLEK G-CNLAVDIWSLGCTVLEMATSKPPWSQYEGIAA FKIGNSKELPPIPDHLSEHCKDFIRKCLQRDPSQRPTSVELLQHPFIQNGVSLEK GGCNLAVDIWSLGCTVLEMAT KPPWSQYEGIAAMFKIGNSKELPPIPDHLSEQCKDFIRKCLQRDPSQRPTAMELLQHPFIQYKVRLEK G-CNLAVDIWSLGCTVLEMATSKPPWSQYEGIAA FKIGNSKELPPIPDHLSEEGRDFIRQCLQRNPSSRPTAVDLLQHSFIRNñSPLEK G-CNLAVDIWSLGCTVLEMATSKPPWSQYEGIAAMFKIGNSKELPPIPDHLSEEGKDFIRKCLQRDPSSRPTAVDLLQHAFVRNAPPLEK G-CNLAVDIWSLGCTVLEMATSKPPWSQYEGIAAMFKIGNSKELPPIPDHLSEEGKDFIRQCLQRDPSSRPTAVDLLQHPFVQNñPPLEK G-CNLAVDIWSLGSTV EMATTKPPWSQYEGV A FKIGNSKDLPAMPDIILSEDGKDFIRQCLQRNPVHRPSAAQLLI,HPFVKKAT-LGR G-CNLAVDIWSLGCTVLEMATTKPPWSQYEGV Al FKIGNSKELPTIPDHLSEDGKDFVRLCLQRNPLNRPSAAQLLDHPFVKNAM-LER G-CNLAVDIWSLGCTVLEMATTKPPWSQYEGV AIFKIGNSKEVPAIPYHLSDKGKDFVRQCLQRNPLHRPTASQLLKHPFVKSTAPMER G CNLAVDIWST.GCTVT.F.MAT KPPWSO.EG ' aAmFKIGNSKJILP TPIthT.R eaKDF ' R CLQR4P. RPt A. #U.. HpF ! knaanSEr

EigU

At_YODA

VvYODAl

PtYODAl

Vv YODA2

Vv YODA3

Pt_YODA2

Pt_YODA3

CmYODAl

GmYODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

S1YODA2

S1YODA3

Os_YODAl

Hv_YODAl

Sb^YODAl

Ta^YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

S1_Y0DA1

Consensus

721 810

PIVSGEPAEAM---NVASSTMRSLDIGHARSLPCLDSEDATNY-QQKGLKHGSGFSISQSPRNMSCPISPVGSPIFHSHSP-HISGR

PSLSSEL-EPP----PAVTNAVRSMAIGHTRNVLESEGVAIH-QSRCSKTGSGSSDTHTPRNLSSPVSP GSPLLHSRSPQHMSGR

PFLSPELSEEL----PAIMNSGRSMGIGPARNVSGFDSEGISMH-QSRATKIGSGISDAHM-KNSSCPVSP GSPHLYSRSPLNLSGR

PILSPET-SDP---PPGVTNGVKSLGIGHAKNLSSLDSERLAVH-SFRVLKTGSHSSDPHIARNISCFVSP GSPLLHSRSPQHLNGR

PILSPET-SDP---PPGVTNGVKSLGIGHAKNLSSLDSERLAVH-SFRVLKTGSHSSDPHIARNISCPVSP GSPLLHSRSPQHLNGR

PILCLDP-TDP---PPGVSNGVKILGINHARNFPTLDSERLAVH-SSRVSKTGLHTSDLHIPRNISCPVSP GSPLLHSRSPQHLNGR

PIPSPEP-TDP---PPGVTNGVKAMGINQARNFPTLDSERLAVH-SSRVSKTGLLASDLHIPRNISCPVSP GSPLFHSRSPQHLNGR

PILGSEH-SDP---TPGITNGVRTLGIEQGRNPSFLDSDRSAAH-SSRLPTAAFHSSEIHIPRNLSCPVSP GSPLVHSRSPQHPSGR

PILGPESPSDPAPAVSGITQGATASGIGQGRNPSKLDSDRLSLH-SSRFLKTNPHASEIHIPRNISCPVSP GSPLLRPRSPQHMNGR PILGPESPSDPAVSGITQGATTSGIGQGRNPSKLDSDRLSLH-SSRFLKTNPHASEIHIPRNISCPVSP GSPLLRPRSPQHMNGR

PIPAPEA-LDP---VSGITQGAKALAIGQGRNLSSLDSDRLSVH-SSRFLKTNPHESEIHIPRNISCPVSP GSPLLRSRSPQHRNGK

PILAPEV-LDP---VSGIIQGAKALAAGQGKNLSSLDSDRLSIH-SSRFLKTNPRESEIHIPRNISCPVSP GSPLLRSRSPQHRNGK

PNISPPA-DPP----CAGANGVKSLGIGQARNIPTSESERLATH-SSRVSKSNFHCSDISITRNISCPVSP GSPLLHPRSPQHLNGR

QNMFPTSFDLP----CVAASGIKLLGTGSARNYPTPDSERLAIH-SSRASKSKFHCSDIHIPKNISCPVSP GSPLPRSPHNLNGR

SVLSEPLEH--LAVISCRSSAKMAAHTRNISSLGLEGQTIY-QRRGAKFSSKHSDIRIRSNISCPVSPCGSPLLKSRSPQHSNGR

SVMSDPLEH--LPVISCRPNSKVAGHTTNISSLGLEGQTIY-QRRGAKFSSKHSDIHIRSNISCPVSPCGSPLLRSRSPQHTNGR

SVIPNHLEH--LAAISCRTKPKVAVQTRN-ASLGFEGQTIY-QRRGVKLSSKHSDIHIRSNISCPVSPCGSPLLKSRSPQHTSGR

SVMSDPLEH--LPVISCRPNSKVAGHTTNISSLGLEGQTIY-QRRGAKYSSKHSDIHIRSNISCPVSPCGSPLLRSRSPQHTNGR

SLSDPLL--Q--LSTTSCKPDLKWGHARNMSSLGLEGQSIY-QRRAAKFSSVHSDIHVRSYISCPVSPCGSPHLRSRSPQHQNGI

SSASHPLEVEQ--LTAISCRTNSKWEHARNMSSLGLEGQSIL-QRRAAKFSLPISDIHIRSNISCPVSPCGSPLLRSRSPQHQNGR

SSASHPLEQ--LTAISCRTNSKWEHARNMSSLGLEGQSIL-QRRAAKFSLPNSDIHIRSNISCPVSPCGSPLLRSRSPQHQNGR

PVLSADPLEAK---PDFVNTMRSLAIGPAKHNLGLVSEAAGTY-LSRSLRTGSGSSEAHTPRNISYPVSPTGNPLLPPRL-LHVSGR

SILTAVPSEDP---TAI INAVRSLAVGPVKHNLCLDSEVAGIY-PLRSLRTGSGSSNAHTPRNISCPVSPS------LPYKS-LHRSGR

FI-----------------------GIGHLKDPPCVGSEEVAVH HE PRS SIF F PG FSDVPVPRSCPVSPVGIESPVYHSQSPKHMSGR

p..s......... i....s..igh.rn.s.lds#....h..R..k..s..S#ihiprniScPVSP.G sPll.srSpqH.nGr

At_YODA

Vv_YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3

Pt_YODA2

Pt_YODA3

Cm_YODAl

Gm_YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os_YODAl

HvJfODAl

SbJfODAl

TaJfODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

Sl_YODAl

Consensus

811 900

RSPSPISSPHALSGSSTPLTGCGGAIPFHHQRQTTVNFLHEGIGSSRSPGSGGNFYTNSF------------FQEPSRQQDRS-RSSPRT

MSPSPISSPRTTSGSSTPLSGGSGAIPFHHPKP-IN-YMHEGIGIIPRSQSSLYANGSSS------------YQDPQPDLFRGMPQVSHV

MSPSPISSPHTASGSSTPLTGGCGAIPFHHAKQHIM-YLQESKGMVPGSQSSFYPNNNNL------------YQEPKPDLFRGMSQASCV

MSPSPISSPRTTSGPSTPLTGGSGAIPF-PHLKPSV-YLQEGFGNVSKPLNNPYSNGPS-------------YHDPNADIFRGMQLGSHI

MSPSPISSPRTTSGPSTPLTGGSGAIPF-PHLKPSV-YLQEGFGNVSKPLNNPYSNGPS-------------YHDPNADI FRGMQLGSHI

MSPSPIASPRTTSGSSTPLTGCTGAIPF-NHLKHSV-HFQEGFGNMQNHSNGIYVNGLA-------------YHDSSPDLFRGMQPGSPI

MSPSPIASPRTTSGSSTPLTGGTGAIPF-NHLKQSV-YLQEGFGNMPYHTNGIYANGLA-------------YHDSIPDLFQGMQPGSPI

MSPSPISSPRNMSGASTPLTGGSGAIPH-QHLKQSL-YLQEGFGNLPKPSMAPYSNGPS-------------FHDINPDIFQGIQPGSHI

MSPSPISSPRTASGASTPLNGGSGAIPFSNHL--V-YIQEGLGNLPKSSNGVYVSGPA-------------HHDLNVDIFRGMQQTSHI

MSPSPISSPRTASGASTPLNGGSGAIPFSNHL--V-YIQEGLGSLPKSSNGVYVSVPAA------------HHDLNIDI FRGMQQTSHI

MSPSPISSPRTASGASTPLAGGSGAIPFGNHSKQSI-YFQEGFGSIPKSSNGVYMNGHS-------------HHDSNVDIFRGMQMGSHI

MSP-PISSPRTASGASTPLAGGSGAIPFGNHSKQPI-YFQEGFGSIPKSSNGVYINGHS-------------HHDSSVDIFRGMQIGSHI

LSPSPISSPITMSGSSTPLSGGTGAIPF-HHLNQSV-YLQEA---APLPQSPYMNGPS-------------YWDPDVLRGPPSGSHA

MSPSPISSPLNTSGSSTPISGGNGVIPF-RHINQSV-YLQEA---RTVPNSPYMNGSS-------------YWDPDVLRGSPSGSHA

MSPSPISSPRTTSGTSTPLSGGNGAIPFNHLKQSTYSNEGFAIPSRSPDDLFASRPT---------------DPDLGQFIRVHQVSQG

MSPSPISSPRTLSGASTPLSGGNGAIPFNHSKQPTYSNEGFAIASRGPDDHFPNRPT---------------DRNLGQFGRVHQVSQG

MSPSPISSPRTMSGTSTPLSGGNGAIPFNHLRYATYSSEGFGTTSRGLDDHFPNRHK---------------DPILGHFAQAHQVSQG

MSPSPISSPRTLSGASTPLSGGNGAIPFNHSKQPTYNNEDLQSHQEAQMITSPTGLQ---------------IVTLGSLVECIKSHRG

MSPSPISSPRTTSGASTPLTGGNGAIPFNHARHLAYNNEGFTITSRCLDEPLPNQPP---------------DPVLGRFVRVKQPSLG

MSPSPISSPRTTSGASTPLTGGSGAVPLNHVRQPAYRNEGFTVTSRGFDDHIPSRPV---------------DPVHGRFIRVQQFSAG

MSPSPICSPRTTSGASTPLTGGSGAVPLNHVRQPAYRNEGFTVTSRGFDDHMPSRPV---------------DPVHGRFIRVQQIPVG

LSPS--SPHTASGSSTPLTGG GAVPFHQTKQPMFSHEGISVIQRPQSYQEPMHDPL------------WGIL-----KSTLACPDI

MSPSPIPSPNTASGSSSPLTSGGGAIPFHQTKQPL FSHEWGMIQKSQNGAIPTGRPCAVSGSSSPRTSGGGWPFHQTKKTLLSYEV

LSPSTISSPRAVSGSSTPLSGGGGAVPLSNPIMPTT-SSSEDMGTSPKAQSCFYP------------------------DAYTSHGLKSDM

$SPSpIsSPrt. SG. STPLtGG. GA! Pf....... y..Eg.g........y.ng....d...d.f.....s..

Ei£U

901

PPHVFWDNNGSIQPGYN-WNK-------DNQPVLSDHVSQQLL--SEHLKLK-SLDLRPGFSTPGSTNRGP

FREMISSESGSFGNQFG-RPVHGDPRDLCDAQSVLSDRVAQQLL--RDHTNLHLSLDLNPGSPMLTRTNGI

FREIISSENSNPGNQLG-WP-----ELYDGHPVLADRVSQQLL--RDHMKLKPSLDLNPNSSIRGRTNGI

FPE-----SDALGKQFG-RTAHV---ELYDGQSVLADRVSRQLL--RDQVKMNPSLDLSPSSMLPSRNTGI

FPE-----SDALGKQFG-RTAHV---ELYDGQSVLADRVSRQLL--

RDQDQFIRQIVCNKDPKLKLWNKLDFWKKMWWKTYRRSWILVSM

Pt_YODA2 FSELVPCENDLIGKQLG-RPTQG--EPYDGQSVLADRVSRQLL--RDHVKMKPSLDLSPNSPLPSRTGGI

FSELVPCENDLMGKQFG-RPTQG--EPYDGQSVLAVRVSRQLL--RDHVKMKPSLDLSPNSPLPSRTGGI

FSELVHHETDFLGKQFG-KPAW---ELYDGQAVLADRVSRQLL--SDHIT-TPSLDLSPSSLLTNRK

TSELVPSESDVLGKQFA-RTPHN--EPYDVQSVLADRVCRQLL--GDNVKINQCLDLSPNS-LLSRANGL

TSELVPSESDVLGKQFA-RSPHN--EPYDVQSVLADRVCRQLL--GDNVKINPSLDLSPNS-LLSRANGL

SPELVSSENDVLVKQFA-RHPHA--EPYDFQSVLADRVGRQLL--GEHVKINPSIDLSPNSSLLSRPNGL

QPELVSSENDVLVNQFA-RHPHA--EPYDFQSVLADRVGRQLLREHVKINPSIDLSPNSSLLSRPNGL

FRELASSQNDALGKQFG-RTTGG--ELYDGQSVLANRVSQQLLRDHVKLVPSLDLNPCPPLDGRTGEA

FRELASVEYDALGKQFG-RLATG--ELCNGQSALANRVSQQLLRDHVKSISPVDLNPCPPLGGRPGGT

LQERWSEADILSPQFG-K-RLGNVFDLRD-KLSPSERFTHHAFVDHVKLNPSLDLTSGSPHLGLKHGN IQERIVSEANILSPQFG-K-RLGNVFDLRD-RLSPSEHFTRPALVDHVKPSPSLDLTTSSPHHGLKRDN PRERWSEADILSPQFG-K-KLGNVFDLRE-RLSPSEHFTRHALVDHVDLNPSLDLTSGSLHPGLKRGK IRRG

FQERAVPEADILSPQFG-RMGHVSVWNLHD-KPLPSEHASQKGFEDRVKLKPPLDLRSGPPHLGCNHGH RQERWSEADILSSQFG-KMRHANVWDSHD-RPLPSERSSQQCFGDHVKLKPSLDLRSGPRHPGRNHGH RQERWSEVDILSSQYG-KMRHANVWDPHD-RPLPSERSSQQCFGNHAKLKPSLDLRSGPRHPGRNHGH

VS---SNNDALGNHNR-RVGQGLPRDFYDGKSYLADRVSQQLLNDHVRKFHS

VGMIQKSRNGAIPISSP-

HTASGSSSPLTSGGGAIPFHQTKQPLFSNEWAMIQKSQSGAIPISSPRTGSGSSSPLTSGGGAIPFHQTNQ S1_Y0DA1 SREAPPYGNGFFGENFGGHAQSGVNGQPYQGQSVLANRVAQQLLRDQVKLSPSFDLNPGSPVFSWDNGV Consensus..e...se.d.lg.qfg....g.... lyd.qsvla.rvs.qll. #hvk..psldl.p.s....r..g..

990

At_YODA Vv_YODAl Pt_YODAl Vv_YODA2 Vv Y0DA3

Pt_YODA3 Cm_YODAl Gm_YODAl Gm_YODA2 Gm_YODA3 Gm_YODA4 Sl_YODA2 Sl_YODA3 Os_YODAl Hv_YODAl Sb_YODAl Ta_YODAl Os_YODA2 Sb_Y0DA2 Zm_Y0DAl Gm_YODA5 Gm YODA6

991 1080

At_YODA

Vv_YODAl

Pt_YODAl

Vv_YODA2

Vv_YODA3 VMVF

Pt_YODA2

Pt_YODA3

Cm_YODAl

Gm_YODAl

Gm_YODA2

Gm_YODA3

Gm_YODA4

Sl_YODA2

Sl_YODA3

Os_YODAl

Hv_YODAl

Sb_YODAl

Ta_YODAl

Os_YODA2

Sb_YODA2

Zm_YODAl

Gm_YODA5

Gm_YODA6

PLFSHEWGMIQKPPNVFYSNGNTAYQGSKHEQFGRNLQTTHPCWDWSSDNDALPNHSRRAVQGDPIKFRDEKSCLADCVSQQLLRDYV

Sl_YODAl

Consensus

Fia. 1