CIP 2015 : A01N 37/46 : Derivados N-acilados.

CIP2015AA01A01NA01N 37/00A01N 37/46[2] › Derivados N-acilados.

Notas[g] desde A01N 25/00 hasta A01N 65/00: Biocidas; Productos que atraen o repelen a los animales perjudiciales; Reguladores del crecimiento de los vegetales

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A01 AGRICULTURA; SILVICULTURA; CRIA; CAZA; CAPTURA; PESCA.

A01N CONSERVACION DE CUERPOS HUMANOS O ANIMALES O DE VEGETALES O DE PARTES DE ELLOS (conservación de alimentos o productos alimenticios A23 ); BIOCIDAS, p. ej. EN TANTO QUE SEAN DESINFECTANTES, PESTICIDAS O HERBICIDAS (preparaciones de uso médico, dental o para el aseo que eliminan o previenen el crecimiento o la proliferación de organismos no deseados A61K ); PRODUCTOS QUE ATRAEN O REPELEN A LOS ANIMALES; REGULADORES DEL CRECIMIENTO DE LOS VEGETALES (mezclas de pesticidas con fertilizantes C05G).

A01N 37/00 Biocidas, productos que atraen o repelen a los animales perjudiciales, o reguladores del crecimiento de los vegetales, que contienen compuestos orgánicos que tienen un átomo de carbono que posee tres enlaces a heteroátomos, con a lo más dos enlaces a un halógeno, p. ej. ácidos carboxílicos (conteniendo ácidos ciclopropanocarboxílicos o sus derivados, p. ej. nítrilos de ácidos ciclopropanocarboxílicos, A01N 53/00).

A01N 37/46 · · Derivados N-acilados.

CIP2015: Invenciones publicadas en esta sección.

Composición que comprende un agente de control biológico y un fungicida seleccionado de metalaxilo y metalaxil-M.

(12/03/2019). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: WACHENDORFF-NEUMANN, ULRIKE, ANDERSCH, WOLFRAM, DR., STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control biológico que es Bacillus subtilis AQ713 (n.º de acceso NRRL B-21661) y al menos un fungicida (I) seleccionado del grupo que consiste en metalaxilo y metalaxil-M (mefenoxam) en una cantidad sinérgicamente eficaz, en la que la relación en peso de agente de control biológico: fungicida (I) está en el intervalo de 1:0,001 a 1:5.

PDF original: ES-2703754_T3.pdf

Composiciones agroquímicas que contienen anticuerpos que se unen a esfingolípidos.

(07/03/2019). Solicitante/s: AgroSavfe nv. Inventor/es: VERHEESEN,PETER, DE JONGHE,CHRIS, VAN DAELE,INGE ELODIE, DE BOLLE,MIGUEL FRANCESCO COLETA, VELOSO VIEIRA,JOÃO FILIPE, CAMMUE,BRUNO, THEVISSEN,KARIN.

Una composición agroquímica para proteger o tratar una planta o una parte de dicha planta de una infección u otra interacción biológica con un hongo fitopatógeno, que contiene al menos un VHH, que se une específicamente a la glucosilceramida de un hongo fitopatógeno, y un agente humectante.

PDF original: ES-2703192_T3.pdf

Proceso de microencapsulación para la producción de microcápsulas que comprende un material inorgánico en partículas modificado en la superficie en una pared de microcápsulas entrecruzadas.

(16/01/2019). Solicitante/s: IMERTECH SAS. Inventor/es: TAYLOR, PHILIP, MULQUEEN, PATRICK, JOSEPH, GITTINS,DAVID IAN.

Un proceso para hacer microcápsulas que comprende; i) formar una solución de un agente de entrecruzamiento en un líquido; ii) formar una pasta de un material inorgánico en partículas modificado en la superficie en un medio acuoso; y iii) dispersar la solución del paso i) en la pasta del paso ii) y hacer o permitir que el agente de entrecruzamiento reaccione con el material inorgánico en partículas modificado en la superficie para formar una pared de microcápsulas entrecruzadas; en el que el material inorgánico en partículas modificado en la superficie es arcilla que ha sido modificada en la superficie con un amino-silano.

PDF original: ES-2720865_T3.pdf

Plaguicidas.

(02/05/2018). Solicitante/s: UNIVERSITY OF DURHAM. Inventor/es: GATEHOUSE,JOHN A, FITCHES,ELAINE C.

Una proteína de fusión que comprende: (i) una toxina proteica ω-ACTX-Hv1a que comprende la secuencia de aminoácidos SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (SEQ ID NO: 1), o una variante de la misma que retiene sustancialmente la actividad biológica de la toxina proteica ω-ACTX-Hv1a, teniendo dicha variante una secuencia de aminoácidos que tiene al menos un 75 % de identidad con la SEQ ID NO: 1; unida operativamente a (ii) una proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado, en donde la proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado es una lectina vegetal seleccionada entre una cualquiera o más de las siguientes: lectina de galanto (GNA), lectina de ajo Allium sativum, lectina de guisante Pisum sativum (P-lec), lectina de cacahuete Arachis hypogaea, lectina de judía verde (PHA, Phytohaemagglutinin).

PDF original: ES-2674324_T3.pdf

Composición que comprende una mezcla de terpenos pesticidas y un fungicida.

(31/01/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: WACHENDORFF-NEUMANN, ULRIKE, DAHMEN, PETER, HELLWEGE, ELKE.

Una composición que comprende a) una mezcla de terpenos pesticida que comprende, como compuestos químicos de acción pesticida α- terpineno, p-cimeno y limoneno, en la que la relación relativa en peso del α-terpineno a p-cimeno a limoneno es 30 a 70 de α-terpineno, 10 a 30 de p-cimeno y 1 a 20 de limoneno y b) al menos un fungicida (I) en una cantidad sinérgicamente efectiva, en la que el fungicida (I) está seleccionado del grupo que consiste en azoxistrobina, clorotalonilo, difenoconazol, fenhexamida, fenamidona, fludioxonilo, fluopiram, flutolanilo, fluxapiroxad, fosetil-Al, isotianilo, mancozeb, mefenoxam, metalaxilo, penflufeno, propamocarb-HCl, protioconazol, piraclostrobina, espiroxamina, tebuconazol, trifoxistrobina y en la que la relación de la mezcla de terpenos pesticida y el al menos un fungicida (I) está en el intervalo de 1:500 a 500:1.

PDF original: ES-2665770_T3.pdf

Compuestos de pirazol plaguicidas.

(15/11/2017) Un compuesto de pirazol de fórmula I, **(Ver fórmula)** en la que R1 es H, alquilo C1-C2, o alcoximetilo C1-C2; R2 es CH3, CH2F, CHF2, o CF3; R3 es un carbo- o heterociclo monoespiro o diespiro de 5 a 10 miembros, que puede contener 1 o 2 unidades estructurales de heteroátomo seleccionadas entre N-Rc, O, y S(O)k, siendo k 0, 1, o 2, cuyo carbo- o heterociclo está no sustituido o puede estar sustituido con 1, 2, 3, o 4 radicales Ra3; Ra1 es CN, NO2, C(O)NH2, C(S)NH2, alquilcarboniloxi C1-C2, alcoxi C1-C4, haloalcoxi C1-C2, alquiloxicarbonilo C1-C2, o S(O)nRb; Ra2 es halógeno o un grupo mencionado para Ra1; Ra3 es halógeno, alquilo C1-C2, haloalquilo…

Composición para la producción de cuerpos de plantas que tengan un contenido de azúcar mejorado y uso de la misma.

(18/10/2017). Solicitante/s: JAPAN SCIENCE AND TECHNOLOGY AGENCY. Inventor/es: OGAWA,KENICHI.

Uso de una composición para aumentar el contenido de azúcar en un cuerpo de planta, comprendiendo la composición glutatión oxidado.

PDF original: ES-2647918_T3.pdf

Agente protector contra insectos a base de emulsión.

(20/09/2017). Solicitante/s: BEIERSDORF AG. Inventor/es: NIELSEN, JENS, KROPKE, RAINER, VON DER FECHT, STEPHANIE, SCHULZ,JENS,DR, HEPTNER,ASTRID.

Preparación a base de emulsión que comprende a.) uno o varios principios activos repelentes de insectos y b.) glutamato de estearoílo sódico y/o poliestearato de sacarosa así como c.) poliisobutileno hidrogenado caracterizada por que la preparación se encuentra en forma de una emulsión W/O o W/S.

PDF original: ES-2650439_T3.pdf

Combinaciones de compuestos activos que contienen una tiazolilisoxazolina y un fungicida.

(06/09/2017) Combinación que comprende: (A) al menos un tiazolilisoxazolina de fórmula (I)**Fórmula** en la que R1 representa fenilo, que está al menos sustituido con un metilsulfoniloxi y opcionalmente está adicionalmente sustituido con un sustituyente seleccionado entre el grupo que consiste en metilo, metoxi, fluoro o cloro, o una sal agroquímicamente aceptable de la misma, y (B) al menos un compuesto activo adicional seleccionado entre los siguientes grupos 1.41 protioconazol, 1.47 tebuconazol 2.1 bixafeno, 2.2 boscalida 2.6 fluopiram, 2.8 fluxapiroxad, 2.12 isopirazam, 2.21 pentiopirad, 2.27 N-[1- (2,4-diclorofenil)-1-metoxipropan-2-il]-3-(difluorometil)-1-metil-1H-pirazol-4-carboxamida, 2.29 benzovindiflupir, 3.1 ametoctradina, 3.2 amisulbromo, 3.3 azoxistrobina, 3.4 ciazofamida,…

Variantes de proteínas AXMI205 y métodos para su uso.

(23/08/2017). Solicitante/s: Athenix Corp. Inventor/es: HIENRICHS,VOLKER, WILLIAMS,JAYME.

Una molécula de ácido nucleico recombinante que comprende una secuencia de nucleótidos que codifica un polipéptido que es una variante de SEQ ID NO:2, donde dicho polipéptido tiene actividad plaguicida mejorada relativa a la SEQ ID NO:2 y donde dicha secuencia de nucleótidos se selecciona de entre SEQ ID NO:4, 5 ó 6, o una secuencia de nucleótidos que codifica una secuencia de aminoácidos seleccionada de entre SEQ ID NO:7, 8, 9, 10, 11 ó 12.

PDF original: ES-2647596_T3.pdf

Agente de control de enfermedades de las plantas.

(21/06/2017) Un agente de control de enfermedades de las plantas que comprende un derivado de tetrazoiloxima representado por una fórmula **Fórmula** En la fórmula, X representa un átomo de hidrógeno, A representa un grupo tetrazoilo representado por una fórmula **Fórmula** En la fórmula, Y representa un grupo metilo, D representa un grupo representado por una fórmula **Fórmula** En la fórmula, Z representa (CH3)3COCONH, R representa un átomo de hidrógeno, un tensioactivo, y al menos un elemento seleccionado entre el grupo que consiste en fosetil, propamocarb, cloruro de cobre básico, clorotalonil, manzeb, cimoxanil, folpet, ciazofamid, metalaxil, fludioxonil, tebuconazol, protioconazol, tiametoxam, azoxistrobina y sales de los mismos, en donde el tensioactivo es un polioxietilen alquilfenil éter, polioxietilen alquil…

Combinaciones de principios activos fungicidas que contienen fluoxastrobina y metalaxil M.

(07/06/2017). Solicitante/s: Arysta LifeScience Corporation. Inventor/es: DUTZMANN, STEFAN, HEINEMANN, ULRICH, SUTY-HEINZE, ANNE, KERZ-MOEHLENDICK,FRIEDRICH DR.

Procedimiento para la protección de semillas y plantas germinantes frente a la infestación por hongos fitopatógenos, caracterizado por que las semillas se revisten de una combinación de principios activos fungicidas que contiene fluoxastrobina y metalaxil M, en la cual la proporción de mezcla, referida a la proporción de peso, entre fluoxastrobina : metalaxil M es de 5 : 1 a 1 : 100 y siendo los hongos fitopatógenos patógenos de podredumbre y marchitamiento transmitidos por las semillas y el suelo, así como enfermedades de las plántulas, provocadas por Fusarium culmorum, Phytophthora cactorum, Pythium ultimum, Rhizoctonia solani, Sclerotium rolfsii.

PDF original: ES-2636737_T3.pdf

Composición insecticida que comprende una macrolactona, un polímero y un material proteináceo.

(01/03/2017). Solicitante/s: DOW AGROSCIENCES LLC. Inventor/es: DRIPPS, JAMES, EDWIN, LIU,Lei, BOUCHER,RAYMOND E. JR, WILSON,STEPHEN LEWIS, THOMAS,JAMES D, KEMPE,MARGARET SUE.

Una composición que comprende entre un 2% y un 25% en peso de una espinosina, de 15% a 75% en peso de al menos un material proteináceo, y de 5% a 70% en peso de al menos un material polimérico, en donde el material proteináceo se selecciona entre el grupo que consiste en albúmina de suero bovino, ovoalbúmina, suero de leche, gelatina y zeína, y seleccionándose el material polimérico entre el grupo que consiste en alcohol polivinílico, derivados de alcohol polivinílico, polivinilpirrolidona y derivados de polivinilpirrolidona, y en donde la composición presenta niveles de actividad pesticida mejorados en comparación con una composición que se diferencia únicamente en que no tiene el al menos un material proteináceo ni el al menos un material polimérico.

PDF original: ES-2624243_T3.pdf

Cocristales de Metalaxilo y Protioconazol y procedimientos de fabricación y uso.

(01/03/2017). Solicitante/s: BAYER CROPSCIENCE LP. Inventor/es: FRIZZELL,DAVID.

Un cocristal que comprende protioconazol y metalaxilo, en el que dicho cocristal tiene un punto de fusión de 95 ºC a 105 ºC cuando se mide con un Calorímetro Diferencial de Barrido mientras se calienta a 5 ºC/minuto.

PDF original: ES-2618222_T3.pdf

Composición para el control de enfermedades de las plantas y método para controlar enfermedades de las plantas aplicando la composición.

(25/01/2017) Composición para el control de enfermedades de las plantas que comprende (Grupo a) (a) al menos un tipo de un compuesto de quinolina seleccionado del grupo que consiste en: (a-14) 3-(5-fluoro-3,3,4,4-tetrametil-3,4-dihidroisoquinolin-1-il)quinolina, (a-18) 3-(4,4-difluoro-3,3-dimetil-3,4-dihidroisoquinolin-1-il)quinolina, y (a-20) 3-(4,4,5-trifluoro-3,3-dimetil-3,4-dihidroisoquinolin-1-il)quinolina, o una sal del mismo, o una sal de los mismos, y (Grupo b) (b) uno o más fungicidas seleccionados del grupo que consiste en los siguientes Grupos mencionados: Grupo un compuesto de la familia de estrobilurinas seleccionado…

Disolución diluyente de esperma y método para inseminación artificial usando la misma.

(21/12/2016). Solicitante/s: Hiroshima University. Inventor/es: SHIMADA MASAYUKI, OKAZAKI TETSUJI.

Diluyente de esperma que comprende un agente de quelación que forma un complejo con un ion calcio, en el que dicho agente de quelación comprende EGTA y EDTA; y un factor inmunosupresor que suprime la migración de leucocitos, en el que dicho factor inmunosupresor comprende cortisol.

PDF original: ES-2620506_T3.pdf

Derivado de amida, agente para el control de plagas que contiene el derivado de amida y uso del agente para el control de plagas.

(02/11/2016) Un derivado de amida representado por la siguiente Fórmula :**Fórmula** en el que, en la Fórmula : A representa un átomo de carbono, un átomo de oxígeno, un átomo de nitrógeno, un átomo de nitrógeno oxidado o un átomo de azufre; K representa un grupo de átomo no metálico necesario para formar un grupo de unión cíclico derivado de piridina, N-óxido de piridina, pirrol, tiazol, furano o tiofeno, junto con A y dos átomos de carbono a los que se une A; X representa un átomo de hidrógeno, un átomo de halógeno, un grupo alquilo C1-C6, un grupo haloalquilo C1-C6, un grupo cicloalquilo C3-C9, un grupo halocicloalquilo…

Láminas, esponjas y bayetas revestidas de un tratamiento antimicrobiano.

(12/10/2016). Solicitante/s: KALLE GMBH. Inventor/es: HAMMER, KLAUS-DIETER, DR., LUTZ,WALTER, POHL,MATTHIAS DR.

Lámina revestida para el tratamiento antimicrobiano a base de biopolímeros o material textil o esponja revestida para el tratamiento antimicrobiano o bayeta revestida para el tratamiento antimicrobiano a base de celulosa regenerada, que se caracteriza por que la lámina o la bayeta está impregnada o revestida de al menos un éster de α-aminoácido de un aminoácido básico, cuyo grupo α-amino está acilado con un ácido graso, o bien el clorhidrato del mismo, donde el éster α-aminoácido forma una unión covalente con la lámina, la esponja o la bayeta.

PDF original: ES-2603058_T3.pdf

Mezcla de repelentes de insectos.

(28/09/2016). Solicitante/s: MERCK PATENT GMBH. Inventor/es: GRUENEWALD,HANS-WERNER, AXT-HEIDEMANN,ALEXANDRA.

Uso del éster 2-(2-hidroxietil)-1-metilpropílico del ácido 1-piperidincarboxílico como potenciador de la acción para al menos un repelente de insectos, caracterizado porque en el caso del al menos un repelente de insectos se trata de éster etílico del ácido 3-(acetil-butil-amino)-propiónico.

PDF original: ES-2608028_T3.pdf

Xenorhabdus, lipopéptido y procedimientos mosquitocidas.

(14/09/2016). Solicitante/s: WISCONSIN ALUMNI RESEARCH FOUNDATION. Inventor/es: ENSIGN,JERALD, LAN,QUE, DYER,DAVID.

Un procedimiento de control de un insecto que comprende la etapa de aplicar a un entorno del insecto una cantidad eficaz de una toxina lipopeptídica que tiene actividad funcional contra un insecto, en el que dicha toxina lipopeptídica es producida por un cultivo bacteriano puro de Xenorhabdus MT depositado en la ATCC como PTA- 6826, y en el que el insecto es un miembro de Culicidae.

PDF original: ES-2607059_T3.pdf

Composiciones pesticidas y procesos relacionados con las mismas.

(31/08/2016) Una composición que comprende una molécula de acuerdo con la Fórmula Uno:**Fórmula** en la que: (a) R1 está seleccionado entre H, F, Cl, Br, I, CN, NO2, alquilo(C1-C8), haloalquilo(C1-C8), alcoxi(C1-C8), haloalcoxi(C1-C8), Salquilo(C1- C8), S(haloalquilo(C1-C8)), S(O)alquilo(C1-C8), S(O)(haloalquilo(C1-C8)), S(O)2alquilo(C1-C8), S(O)2(haloalquilo(C1- C8)), N(R14)(R15), alquilo(C1-C8) sustituido, en el que dicho alquilo(C1-C8) sustituido tiene uno o más sustituyentes seleccionados entre CN y NO2, haloalquilo(C1-C8) sustituido, en el que dicho haloalquilo(C1-C8) sustituido tiene uno o más sustituyentes seleccionados entre CN y NO2, alcoxi(C1-C8) sustituido, en el que dicho alcoxi(C1-C8) sustituido tiene uno o más sustituyentes…

Uso de agente quelante y compuestos peptídicos antimicrobianos.

(10/08/2016). Solicitante/s: Consumo Em Verde - Biotecnologia Das Plantas, S.A. Inventor/es: DE SEIXAS BOAVIDA FERREIRA,RICARDO MANUEL, VALADAS DA SILVA MONTEIRO,SARA ALEXANDRA, CARREIRA,ALEXANDRA MANUELA LOURENÇO.

Uso de un agente quelante y un agente antimicrobiano que es eficaz contra un microorganismo patógeno de plantas para inhibir el crecimiento de y/o destruir un microorganismo patógeno de plantas en una planta; en el que dicho agente antimicrobiano comprende un polipéptido que comprende la secuencia Blad mostrada en la SEQ ID NO: 4 o una variante activa de la misma que tiene actividad antimicrobiana y que comprende una secuencia que tiene al menos el 70 % de identidad con la SEQ ID NO: 4 o un fragmento de SEQ ID NO: 4 que tiene al menos 100 aminoácidos de longitud.

PDF original: ES-2600970_T3.pdf

Tensioactivo polimérico útil para la preparación de composiciones agroquímicas pesticidas.

(15/06/2016). Solicitante/s: LAMBERTI SPA. Inventor/es: LI BASSI, GIUSEPPE, BOHUS, PETER, FEDERICI, FRANCO, PAGANINI,GIANFRANCO.

Composición acuosa que contiene de 30 a 60% en peso del polímero obtenido por polimerización de: a) de 60 a 90% en moles de una mezcla que comprende a') de 0 a 70% en moles de ácido acrílico o metacrílico y a") de 30 a 100% en moles de ácido 2-acrilamido-2-metilpropanosulfónico; b) de 10 a 40% en moles de un éster de ácido acrílico o metacrílico de un alcohol C8-C18, y que tiene peso molecular numérico promedio comprendido entre 1.000 y 5.000 dalton, y al menos 20% en peso de agua.

PDF original: ES-2603217_T3.pdf

HERBICIDA FORMULADO CON GLIFOSATO Y AMINOÁCIDOS PARA EL CONTROL Y/O ELIMINACIÓN DE MALEZAS Y USOS.

(31/03/2016). Solicitante/s: MIRRANDA ARREDONDO, Luis Enrique. Inventor/es: MIRRANDA ARREDONDO,Luis Enrique.

La presente invención se refiere a una composición sinérgica mejorada para el control y/o la eliminación de maleza caracterizada porque comprende: a) 20% hasta 72% de Glifosato; b) 15% hasta 67% de al menos un aminoácido o una mezcla de algunos o de todos los aminoácidos esenciales; c) 8% de un diluyente; y d) 5% de un surfactante, todo esto debe sumar el 100%. Los porcentajes de cada componente en la composición de la presente invención proporcionan un efecto sinérgico que proporciona una mayor efectividad en el combate de maleza, gracias a una mayor permeabilidad de la membrana celular que favorece la absorción del Glifosato, de acción sistémica en la maleza, por lo que se considera que es nueva e inventiva porque si soluciona la problemática de la resistencia al Glifosato. Además la composición de la presente invención garantiza el control sobre cualquier tipo de maleza, tanto monocotiledóneos (hoja delgada) como dicotiledóneoa (hoja ancha).

Raticida.

(16/03/2016). Solicitante/s: THE SECRETARY OF STATE FOR DEFENCE. Inventor/es: OYSTON, PETRA, CLAIRE, FARQUHAR, CLARK,GRAEME CHRISTOPHER.

Un método para matar un roedor que comprende administrar a dicho roedor mediante administración oral una dosis letal de polipéptido de toxina murina de Yersinia aislado o un análogo antigénico aislado del mismo.

PDF original: ES-2566736_T3.pdf

Combinaciones de un compuesto activo que comprenden un derivado de carboximida y un compuesto fungicida.

(25/02/2016) Una composición activa que comprende (A) al menos un derivado de fórmula (I)**Fórmula** en el que T representa un átomo de oxígeno y X se selecciona de la lista de 2-isopropilo, 2-ciclopropilo, 2-tercbutilo, 5-cloro-2-etilo, 5-cloro-2-isopropilo, 2-etil-5-flúor, 5-fluoro-2-isopropilo, 2-ciclopropil-5-flúor, 2-fluoro-6- isopropilo, 2-etil-5-metilo, 2-isopropil-5-metilo, 2-ciclopropil-5-metilo, 2-terc-butil-5-metilo, 5-cloro-2- (trifluorometilo), 5-metil-2-(trifluorometilo), 2-cloro-6-(trifluorometilo), 3-cloro-2-fluoro-6-(trifluorometilo) y 2-etil-4,5- dimetilo, o una sal agroquímicamente aceptable de los mismos, y (B) al menos un compuesto activo fungicida adicional B, seleccionado de: ciproconazol , epoxiconazol , fenhexamida , metconazol , propiconazol , protioconazol ,…

Mezclas fungicidas a base de azolopirimidinilaminas.

(01/02/2016) Mezclas fungicidas que contienen como componentes activos: 1) Azolopirimidinilaminas de la fórmula I,**Fórmula** en la cual los sustituyentes tienen el siguiente significado: R1 alquilo C5-C12; R2 alquilo C1-C12, haloalquilo C1-C4, alcoxi C1-C4- alquilo C1-C4; R3 hidrógeno, NH2; A N; y 2) por lo menos un principio activo II elegido de entre los siguientes grupos: A) Azoles elegidos de entre Bitertanol, Bromuconazole, Cyproconazole, Difenoconazole, Diniconazole, Enilconazol, Epoxiconazole, Fluquinconazole, Fenbuconazole, Flusilazol, Flutriafol, Hexaconazol, Imibenconazole, Ipconazol,…

Composición fungicida que comprende un derivado de ácido fosforoso, un compuesto de tipo mandelamida y un compuesto fungicida adicional.

(20/01/2016). Solicitante/s: Bayer Intellectual Property GmbH. Inventor/es: LATORSE, MARIE-PASCALE, GOUOT, JEAN-MARIE.

Una composición fungicida que comprende: A) un derivado de ácido fosforoso seleccionado entre fosetil-Al y ácido fosforoso; B) mandipropamid; y C) un compuesto fungicida adicional seleccionado entre folpet y mefenoxam en la que las relaciones de peso de los compuestos A:B:C están entre el intervalo 1:0,01:0,01 al intervalo 1:0,1:2.

PDF original: ES-2567138_T3.pdf

Genes delta-endotoxina AXMI221Z, AXMI222Z, AXMI223Z, AXMI224Z, y AXMI225Z y métodos para su uso.

(20/01/2016). Solicitante/s: Athenix Corp. Inventor/es: TOMSO,DANIEL JOHN, SAMPSON,KIMBERLY S.

Una molécula de ácido nucleico recombinante que comprende una secuencia de nucleótidos que codifican una secuencia de aminoácidos que tiene actividad plaguicida, en la que dicha secuencia de nucleótidos se selecciona del grupo que consiste en: a) la secuencia de nucleótidos expuesta en cualquiera de las SEQ ID NO: 3, 8, 13 o 18; b) una secuencia de nucleótidos que codifican un polipéptido que comprende la secuencia de aminoácidos de las SEQ ID NO: 27 o 28; y c) una secuencia de nucleótidos que codifican un polipéptido que comprende una secuencia de aminoácidos que tiene al menos 95 % de identidad de secuencia con la secuencia de aminoácidos de SEQ ID NO: 27 o 28.

PDF original: ES-2647595_T3.pdf

Combinaciones de principios activos fungicidas sinérgicas.

(19/01/2016). Solicitante/s: Bayer Intellectual Property GmbH. Inventor/es: DUNKEL, RALF, RIECK, HEIKO, ELBE, HANS-LUDWIG, WACHENDORFF-NEUMANN, ULRIKE, DAHMEN, PETER, SUTY-HEINZE, ANNE.

Combinaciones de principios activos fungicidas sinérgicas que contienen la carboxamida N-[2-(1,3- dimetilbutil)fenil]-5-fluoro-1,3-dimetil-1H-pirazol-4-carboxamida (grupo 1) y al menos un principio activo del grupo , seleccionándose los principios activos de la siguiente lista: metalaxil-M, caracterizadas porque el principio activo de fórmula se encuentra con respecto al principio activo en la siguiente proporción de mezcla expresada en proporciones en peso: 10:1 a 1:150.

PDF original: ES-2556640_T3.pdf

Método para potenciar el crecimiento de cultivos, plantas o semillas y supresión de enfermedades de las plantas.

(30/09/2015) Un método para mejorar la supresión de una enfermedad fitopatogénica, donde el método comprende aplicar un material que comprende ácido γ-poliglutámico ("γ-PGA," forma H) y / o su sal, un hidrogel de γ-poliglutamato, un caldo de fermentación que comprende γ- PGA, su sal y / o un hidrogel de γ-poliglutamato, o una mezcla de los mismos, a los cultivos, plantas o semillas, o a un campo para el cultivo de la cosecha, planta o semilla.

Método para inhibir el crecimiento de microorganismos en sistemas acuosos usando una composición que comprende lisozima.

(08/07/2015) Un método para controlar el crecimiento de algas en un sistema acuoso, comprendiendo el método: proporcionar una composición que comprende una combinación de al menos una lisozima y al menos un compuesto de amonio cuaternario seleccionado entre cloruro de N,N-dietil-N-dodecil-N-bencilamonio, cloruro de N,N-dimetil-N-octadecil-N-(dimetilbencil)amonio, cloruro de N,N-dimetil-N,N-didecilamonio, cloruro de N,N-dimetil- N,N-didodecilamonio, cloruro de N,N,N-trimetil-N-tetradecilamonio, cloruro de N-bencil-N,N-dimetil-N-(alquil C12-C18)amonio, cloruro de N-(diclorobencil)-N,-N-dimetil-N-dodecilamonio, cloruro de N-hexadecilpiridinio, bromuro de N-hexadecilpiridinio, bromuro de N-hexadecil-N,N,N-trimetilamonio, cloruro de N-dodecilpiridinio, bisulfato…

1 · · 3 · ››

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015