2,411 Patentes de abril de 2015 (pag. 52)

  1. 1633.-

    ESTRUCTURA MODULAR PARA LA FORMACIÓN DE ELEMENTOS DE MOBILIARIO

    (04/2015)

    1. Estructura modular para la formación de elementos de mobiliario, caracterizada porque comprende una pluralidad de tubos principales y, al menos, dos pletinas laterales simétricas que se acoplan a ambos extremos de los tubos, una a cada lado, uniéndolos para conformar elementos de mobiliario, por ejemplo una mesa, una tumbona o una silla, según el diseño y configuración otorgado a dichas pletinas laterales . 2. Estructura modular para la formación de elementos de mobiliario, según la reivindicación 1, caracterizada porque los tubos principales están constituidos por un alma rígida y por una cobertura externa , y las pletinas laterales son también rígidas y resistentes. 3. Estructura modular para la formación de elementos...

  2. 1634.-

    VÁLVULA DE EXPANSIÓN TERMOSTÁTICA DE REGULACIÓN ELECTRÓNICA CON CONTROLADOR

    (04/2015)

    1. Una válvula de expansión termostática de regulación electrónica con controlador, compuesta por una válvula de expansión termostática con bulbo de regulación manual, un módulo termoeléctrico, unas pletinas o piezas de alta conductividad térmica y un controlador electrónico, caracterizado porque: - El módulo termoeléctrico está colocado entre el bulbo y el tubo de salida de la válvula a través de dos pletinas y (una a cada lado del módulo termoeléctrico). Las pletinas, realizadas de cualquier material, podrán tener forma para adaptarse al tubo o al bulbo. Además entre el módulo termoeléctrico y las pletinas podrá haber adhesivo, pasta térmica o similar La pletina correspondiente al tubo podrá ir soldada a...

  3. 1635.-

    Componente para un aparato doméstico, aparato doméstico, y procedimiento para fabricar un componente para un aparato doméstico

    (04/2015)

    La invención se refiere a un componente para un aparato doméstico , con un cuerpo base , donde sobre una superficie del cuerpo base está aplicado un símbolo , y con una capa de cubierta que cubre el símbolo .

  4. 1636.-

    Aspiradora

    (04/2015)

    Una aspiradora que tiene un cabezal móvil adaptado para moverse a lo largo de una superficie para limpiar, teniendo el cabezal móvil un extremo anterior y un extremo posterior, teniendo también el cabezal móvil: Un cepillo giratorio , estando situado el cepillo giratorio en una cámara de cepillo en el extremo anterior del cabezal móvil, teniendo la cámara de cepillo una abertura a través de la cual se proyecta una parte del cepillo giratorio, abarcando la abertura y el cepillo giratorio sustancialmente la totalidad de la anchura del cabezal móvil; Un impulsor Un motor para mover el cepillo giratorio y el impulsor; Una cámara desmontable de recogida de la suciedad, abarcando sustancialmente la...

  5. 1637.-

    Método para producir un cuerpo compuesto sinterizado

    (04/2015)

    Un método de producción de un cuerpo compuesto sinterizado que comprende partículas de nitruro de boro cúbico dispersadas en una matriz de carburo cementado caracterizado por sinterizar una mezcla que comprende partículas de nitruro de boro cúbico y un polvo de carburo cementado a una temperatura de sinterización por encima de 1200ºC y por debajo de 1350ºC a una presión igual a la presión atmosférica o menor, en el que la mezcla comprende una cantidad de partículas de nitruro de boro cúbico del 4% en peso o menor y en el que la presión de la sinterización es menor que 200 mbar.

  6. 1638.-

    Composición farmacéutica

    (04/2015)

    Una preparación oral que comprende hidrocloruro de N-[4-[4-(1,2-benzisotiazol-3-il)-1-piperazinil]-(2R,3R)-2,3- tetrametilenbutil]-(1'R,2'S,3'R,4'S)-2,3-biciclo[2,2,1]heptanodicarboxiimida (lurasidona) de fórmula :**Fórmula** almidón pregelatinizado, un excipiente soluble en agua, un aglutinante polimérico soluble en agua y un disgregante; en donde la preparación oral es un comprimido; en donde el contenido de lurasidona en la preparación es de 20 a 45% (p/p), y el almidón pregelatinizado se incorpora en una cantidad de 10 a 50% (p/p) basándose en el peso de la preparación; y en donde el disgregante es uno o más disgregantes seleccionados del grupo que consiste en almidón de maíz, celulosa...

  7. 1639.-

    Método de preparación de nácar mecanoestructurado por mecanosíntesis, nácar mecanoestructurado obtenido de este modo y sus aplicaciones

    (04/2015)

    Método de preparación de nácar mecanoestructurado por mecanosíntesis de polvo micrométrico de nácar, caracterizado porque la temperatura del nácar se mantiene inferior a 40 ºC, preferentemente inferior a 20 ºC, y más preferentemente incluso inferior o igual a 0 º C, y porque las partículas de nácar a tratar provienen del endostraco, es decir, la concha interna, de bivalvo.

  8. 1640.-

    TENSOR PARA LONAS DE CAJAS DE CARGA

    (04/2015)

    1. Tensor para lonas de cajas de cargas, formado por un conjunto funcional que comprende una rueda dentada sobre la que actúa una palanca de accionamiento para hacerla girar y un gatillo que permite el giro de dicha rueda dentada en el sentido de la actuación con la palanca de accionamiento , bloqueando el giro en el sentido contrario, caracterizado porque el gatillo posee unas pestañas enfrentadas a unas conformaciones prominentes que la palanca de accionamiento presenta en su extremo, entre las cuales establecen un tope que impide el basculamiento del gatillo mediante una acción externa cuando la palanca de accionamiento se encuentra basculada hacia atrás en una posición...

  9. 1641.-

    " ROPA REFORZADA "

    (04/2015)

    1. Ropa reforzada caracterizada porque comprende en las zonas de desgaste un elemento protector formado por una cinta adhesiva . 2. Ropa reforzada, según la reivindicación 1, cuya cinta adhesiva posee una capa adhesiva y una capa de plástico . 3. Ropa reforzada, según cualquiera de las reivindicaciones anteriores, cuya cinta adhesiva posee una capa adhesiva y una capa de tejido o de material no tejido. 4. Ropa reforzada, según cualquiera de las reivindicaciones 2 ó 3, donde el adhesivo es termofusible. 5. Ropa reforzada, según cualquiera de las reivindicaciones anteriores, donde la cinta adhesiva está rematada en tramos semicirculares o similar.

  10. 1642.-

    Electrodoméstico para la preparación de biberones

    (04/2015)

    1. Electrodoméstico para preparación de biberones o similares, caracterizado porque comprende un tanque de agua con un sistema de esterilización de agua , un contenedor de producto en polvo con al menos un dosificador de su contenido, un calentador de agua hasta una temperatura superior a 70ºC, y al menos un mezclador del polvo dosificado con el agua proveniente del calentador , y donde el tanque posee al menos dos líneas de agua de salida, una al calentador de agua y otra a cada biberón . 2. Electrodoméstico, según la reivindicación 1, cuyo sistema de esterilización de agua comprende una o más fuentes de luz UV que iluminan el interior del tanque . 3....

  11. 1643.-

    Procedimiento y sistema para retirar líquidos y/o gases

    (04/2015)

    Procedimiento para retirar líquidos y/o gases desde una instalación para almacenar y/o transportar sustancias sólidas, líquidos y/o gases, en particular desde un tanque de almacenamiento (2a, 2b) o desde una tubería, caracterizado por que la instalación , un vehículo móvil de bombeo/succión y una instalación móvil de combustión que está colocada separada, se encuentran conectados unos a otros con la ayuda de conductos (8a, 8b, 8c, 8d), de manera que a continuación el líquido y/o gas, con la ayuda de un dispositivo de bombeo/succión del vehículo de bombeo/succión , es traspasado desde la instalación hacia un depósito intermedio del vehículo de bombeo/succión...

  12. 1644.-

    Transportador de tornillo para utilizar como rascador de superficies en unidades de refrigeración y congelación

    (04/2015)

    Un congelador de flujo continuo para enfriar adicionalmente una masa de crema de helado ya congelada, que comprende un tornillo transportador rascador que tiene una pluralidad de filetes del tornillo cada uno de los cuales se extiende en un trayecto helicoidal alrededor de un eje longitudinal, al menos dos filetes del tornillo se extienden desde una parte de extremo de entrada del tornillo transportador, caracterizado por que los bordes exteriores de los dos filetes del tornillo se extienden en una distancia radial diferente desde el eje longitudinal.

  13. 1645.-

    Dispositivo de alimentación de una unidad de transformación con un soporte en banda continua para una estación de alimentación en una máquina de producción de embalajes

    (04/2015)

    Dispositivo para alimentar a una unidad de transformación con un soporte en banda continua , cuya unidad de transformación transforma el soporte en parada, que comprende: - un rodillo principal de arrastre que gira (T) sobre un árbol principal , - un motor principal eléctrico de accionamiento , que arrastra en su giro (T) el rodillo principal , - un rodillo satélite , apto para oscilar (O) alrededor de dicho rodillo principal , de aguas arriba a aguas abajo, y recíprocamente, y - dos palancas laterales que, sustentando el rodillo satélite , van montadas sobre dicho árbol principal , alojándose y sustentándose el soporte entre dicho rodillo...

  14. 1646.-

    Elemento de contacto para un dispositivo conector de enchufe eléctrico

    (04/2015)

    Elemento de contacto para un dispositivo conector de enchufe eléctrico, en el que el elemento de contacto comprende: hechos de un material eléctricamente conductivo, - un primer segmento extremo conformado , - así como un segmento de alojamiento alargado conformado que define un eje longitudinal y que está destinado al acoplamiento mecánico y eléctrico o la recepción de un contraelemento de contacto - configurado de manera complementaria respecto del elemento de contacto - de un dispositivo conector de enchufe a emparejar con el dispositivo conector de enchufe eléctrico, - en el que el segmento de alojamiento alargado se extiende sustancialmente en forma cilíndrica...

  15. 1647.-

    Pesa de halterofilia

    (04/2015)

    1. Pesa de halterofilia que, consistente en una pieza de peso y volumen variable, cuya forma es preferentemente plana y discoidal, y contando en todo caso con un orificio central para su inserción en una barra en la cual figuran sendos topes próximos a sus extremos determinando la posición equilibrada de los pares de pesas que se inserten en la misma, está caracterizada porque la pesa incorpora, al menos, un imán en algún punto de su superficie dispuesto de tal modo que, al insertarla en la barra , el imán se une magnéticamente o con la superficie de metal férrico o imantada del tope prevista al efecto y, cuando se añade otra pesa igual o semejante...

  16. 1648.-

    Aparatos, sistema y procedimiento para detectar accidentes

    (04/2015)

    Procedimiento para detectar accidentes, caracterizado porque comprende las siguientes etapas operativas: - obtención, por lo menos, de dos aceleraciones axiales (Ax, Ay, Az) que comprenden una primera aceleración axial (Ax) orientada a lo largo de un primer eje (x) y una segunda aceleración axial (Ay) orientada a lo largo de un segundo eje (y) que es sustancialmente perpendicular al primer eje (x); - integrar, por lo menos, la primera aceleración axial (Ax) y la segunda aceleración axial (Ay) de dichas aceleraciones axiales (Ax, Ay, Az) para obtener, por lo menos, dos valores integrados (IAx, IAy) de la aceleración axial; - cálculo de un...

  17. 1649.-

    Piridazinonas, procedimiento de preparación y procedimientos de utilización de las mismas

    (04/2015)

    Compuesto seleccionado de la fórmula I:**Fórmula** y sus estereoisómeros, tautómeros o sales farmacéuticamente aceptables, en la que: R1 se selecciona de entre:**Fórmula** en las que la línea ondulada indica el sitio de unión; R4 se selecciona de entre OH, CN, NRbRc, cicloalquilo C3-C6 sustituido opcionalmente con alquilo C1-C6 o haloalquilo C1-C4 y alquilo C1-C6 sustituido opcionalmente con OH u O-alquilo C1-C4; R2 es H, CH3 o CF3; el anillo B se selecciona de entre fenilo, heteroarilo de 5-6 miembros que presenta por lo menos un átomo anular de nitrógeno y heterociclilo de 8 a 11 miembros que presenta por lo menos un átomo...

  18. 1650.-

    Método para la separación de polímero de una suspensión

    (04/2015)

    Método para separar polímero de una suspensión producida en un reactor de polimerización en suspensión usado para polimerizar propileno o etileno, comprendiendo dicha suspensión dicho polímero y fluido portador sin reaccionar, que comprende: (a) suministrar dicha suspensión a un primer medio de calentamiento para aumentar la temperatura de dicha suspensión; (b) usar un primer medio separador para extraer de dicha suspensión una parte de dicho fluido portador sin reaccionar para obtener una suspensión enriquecida en polímero, teniendo dicho primer medio separador una primera presión de al menos 1,52 MPa; (c) suministrar dicha...

  19. 1651.-

    Disposición de agarre en un tubo flexible de aspiración

    (04/2015)

    Disposición de agarre en un tubo flexible de aspiración especialmente equipado para la extracción por pulverización, con un manguito interno colocado en un extremo del tubo flexible de aspiración que no puede girar con respecto al tubo flexible de aspiración y con un tubo de agarre en el que está introducido el manguito interno y que está fijado en su interior de manera hermetizada, de forma que puede girar pero no se puede desplazar axialmente, estando conducida una conducción de líquido flexible desde el tubo flexible de aspiración y el manguito interno en dirección aproximadamente radial a través de una abertura...

  20. 1652.-

    Dispositivo de control de abertura y cierre de una puerta pivotante y deslizante o similar

    (04/2015)

    Dispositivo de control para la apertura y cierre de una hoja de puerta que oscila y se desliza con respecto a una carrocería de un vehículo , siendo capaz el dispositivo de accionar la hoja de una posición cerrada en la que bloquea una abertura creada en la carrocería hasta una posición abierta en la que libera la abertura , y viceversa, definiendo la abertura un plano de abertura de la puerta, comprendiendo el dispositivo de control : - un estabilizador vertical del eje A que lleva los piñones (5a, 5b), estando cada piñón (5a, 5b) destinado a engranarse con una cremallera creada en la hoja , y - un...

  21. 1653.-

    Férula palmar para el pulgar y la articulación en silla de montar del pulgar

    (04/2015)

    Férula palmar para el pulgar y la articulación en silla de montar del pulgar, que comprende una primera parte de férula para alojar el pulgar , así como medios para sujetar la primera parte de férula a la mano , estando configurada la primera parte de férula como parte de carcasa en sí rígida, aunque deformable plásticamente con la mano, abierta hacia arriba, en la que puede introducirse el pulgar , estando unida la primera parte de férula de manera firme con una parte de canto de mano en sí rígida, aunque deformable plásticamente con la mano, que cuando la férula está colocada abarca el canto de...

  22. 1654.-

    Procedimiento y dispositivo de identificación y señalización de un suceso que acontece en la ubicación de un objeto fijo o móvil

    (04/2015)

    Procedimiento de identificación y de señalización de un suceso, tal como un incidente o un accidente, que acontece en la ubicación de un objeto fijo o móvil, concretamente un vehículo, provisto de un equipo de gestión electrónica, del que se obtiene al menos una información relacionada con este suceso a partir de un parámetro físico, se mide dicho parámetro físico, se memoriza el resultado de dicha medición de dicho parámetro físico y se comunica a una unidad de vigilancia y/o de alarma, y en el que - se evalúa en la ubicación del objeto dicho parámetro físico y se determina un grado de calificación...

  23. 1655.-

    Receptor de eritropoyetina protector de tejido (NEPOR) y métodos de uso

    (04/2015)

    Un método de determinar si un paciente con cáncer es adecuado para terapia con eritropoyetina (EPO), que comprende (A) determinar el nivel de expresión de EPH-B4 en una muestra de tejido aislada de dicho paciente; y (B) correlacionar una presencia de expresión de EPH-B4 con una respuesta fisiológica negativa a terapia con EPO.

  24. 1656.-

    Dispositivo y procedimiento para cerrar recipientes

    (04/2015)

    Un dispositivo para cerrar recipientes (C) que incluye una primera (C1) y una segunda (C2) semicoquillas con forma de copa a acoplar con sus respectivas porciones de embocadura en una relación (C12) de acoplamiento frontal como consecuencia de un movimiento de cierre por volteo que lleva a dicha segunda semicoquilla (C2), dispuesta en el lado de dicha primera semicoquilla (C1) a voltear sobre dicha primera coquilla (C1), estando el dispositivo caracterizado porque incluye: - un cuerpo de soporte con una estructura portadora para recibir dicha primera semicoquilla (C1) de al menos uno de dichos...

  25. 1657.-

    Conexión de ajuste Luer y jeringuilla de ajuste Luer

    (04/2015)

    Una jeringuilla que comprende: un cuerpo cilíndrico que incluye una pared lateral que tiene una superficie interior que define una cámara para la retención de fluido, un extremo proximal abierto y un extremo distal que incluye una pared distal que tiene una punta Luer con una abertura a través de la misma en comunicación de fluido con dicha cámara ; un collar que se extiende desde la pared distal , definiendo el collar en disposición coaxial con la punta Luer un canal para la recepción de un soporte de aguja en el mismo, y el collar incluye un hueco periférico...

  26. 1658.-

    Péptidos antigénicos de Neisseria

    (04/2015)

    Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2918 del documento WO99/57280 (MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPIANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAKLKAEKFNCYQSPMEKTEVCGGDFSTTIDRTKWGMDYLV NVGMTKSVRIDIQIEAAKQ), en la que dicho(s) fragmento(s): (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de: y en la que dicha proteína no es SEC ID Nº: 2916, 2918 ó 2920 del documento WO99/57280

  27. 1659.-

    Procedimiento de preparación de péptidos mediante el ensamblaje de múltiples fragmentos peptídicos

    (04/2015)

    Un procedimiento de preparación de un ensamblaje peptídico de n fragmentos y de n-1 aminoácidos portadores de una función tiol, representado por la fórmula: A1-C1-A2-C2-A3-... -Ci-1-Ai-.... -Cn-1-An (I) en la que A1, A2, A3, ... Ai... , An son fragmentos peptídicos, C1, C2, C3... Ci-1... Cn-1 son residuos de aminoácidos portadores de una función tiol, n está comprendido entre 3 y 50, preferentemente entre 3 y 20, 10 o entre 3 y 10, e i es un número entero cualquiera comprendido entre 2 y n, caracterizado por que se implementa en la preparación de un péptido-tioéster...

  28. 1660.-

    Nuevos derivados de pirazol e imidazol útiles como antagonistas de orexina

    (04/2015)

    Un compuesto de fórmula (I)**Fórmula** en la que R1 representa arilo o heteroarilo de 5 a 10 miembros, en el que el arilo o heteroarilo de 5 a 10 miembros está independientemente sin sustituir o mono-, di- o tri-sustituido; en el que los sustituyentes son seleccionados independientemente entre el grupo que consiste en: • alquilo (C1-4), alcoxi (C1-10 4), halógeno, ciano, fluoroalquilo (C1-3), fluoroalcoxi (C1-3); y • -NR4R5, en el que R4 y R5 son independientemente hidrógeno o alquilo (C1-4); o R4 y R5 junto con el átomo de nitrógeno al que están unidos para formar...

  29. 1661.-

    Dispositivo de cerradura de llave para un disyuntor

    (04/2015)

    Un dispositivo de cerradura de llave para un disyuntor adaptado para fijarse sobre un panel de un mecanismo de conmutación del disyuntor, caracterizado porque dicho dispositivo de cerradura de llave comprende: una pluralidad de cuerpos de llave provistos respectivamente con un orificio de inserción de llave en el que se puede insertar una llave; una pluralidad de ganchos (380a, 380b) conectados con la pluralidad de cuerpos de llave , para ser girados, respectivamente, por un giro de una llave; un elemento de cierre conectado con la pluralidad de ganchos (380a, 380b),...

  30. 1662.-

    Compuestos de ésteres boronato y composiciones farmacéuticas de los mismos

    (04/2015)

    Un compuesto de fórmula (II):**Fórmula** o una sal farmacéuticamente del mismo, en donde: A es 0; Ra es isobutilo; Ra1 es hidrógeno; P es Rc-C(O)-; Rc es -RD; -RD es 2,5-diclorofenilo; cada uno de Rb1 y Rb2 es independientemente hidrógeno, -CO2H, -OH o un grupo alifático, arilo, heteroarilo o heterociclilo sustituido o no sustituido; cada uno de Rb3 y Rb4 es independientemente hidrógeno, -CO2H, o un grupo alifático, arilo, heteroarilo o heterociclilo sustituido o no sustituido; o Rb2 y Rb4 son cada uno independientemente hidrógeno, y Rb1 y Rb3, junto con...

  31. 1663.-

    Procedimiento de obtención de compuestos derivados de tetrahidro-ß-carbolina

    (04/2015)

    Procedimiento de obtención de compuestos derivados de tetrahidro-ß-carbolina de fórmula 3'cisHX **Fórmula** donde R representa un grupo metilo, etilo, isopropilo, n-propilo, n-butilo o sec-butilo y X representa cloro o bromo, que comprende la reacción de un éster alquílico del D-triptófano, en forma de sal con un hidrácido HX, de fórmula 1'HX **Fórmula** donde R y X tienen el mismo significado que en 3'cisHX, y piperonal, de fórmula 2 **Fórmula** en ausencia de cualquier componente adicional y a una temperatura comprendida entre 40 y 150ºC.

  32. 1664.-

    Sistema de refrigeración de bucle con bomba

    (04/2015)

    Un sistema de refrigeración de bucle con bomba , que comprende: una pluralidad de primeros componentes generadores de calor y al menos un intercambiador de calor en contacto térmico con los primeros componentes generadores de calor para absorber el calor de los primeros componentes generadores de calor por medio de refrigerante que circula a través del intercambiador de calor, una pluralidad de segundos componentes generadores de calor , un enfriador para refrigerar con aire los segundos componentes generadores de calor, un condensador para recibir y condensar el...

<< · 26 · 39 · 45 · 48 · 50 · < · 52 · > · 55 · 58 · 64 · >>