43 inventos, patentes y modelos de RAPPUOLI, RINO

  1. 1.-

    Péptidos antigénicos de Neisseria

    (05/2015)

    Una proteína que comprende uno o más fragmentos de la proteína "961" seleccionados de:**Fórmula** que comprende al menos un determinante antigénico, y en la que dicha proteína no es SEQ ID NO:2944 del documento WO99/57280.

  2. 2.-

    Péptidos antigénicos de Neisseria

    (04/2015)

    Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2918 del documento WO99/57280 (MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPIANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAKLKAEKFNCYQSPMEKTEVCGGDFSTTIDRTKWGMDYLV NVGMTKSVRIDIQIEAAKQ), en la que dicho(s) fragmento(s): (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de: y en la que dicha proteína no es SEC ID Nº: 2916, 2918 ó 2920 del documento WO99/57280

  3. 3.-

    Péptidos antigénicos de Neisseria

    (03/2015)

    Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2884 del documento WO99/51280 (MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTDIAGDTWNTSKVRATLLGISPATQARVKIVTYG NVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR), en la que dicho(s) fragmento(s): (a) comprenden al menos un determinante antigénico; y (b) comprenden una secuencia seleccionada de: **Fórmula** y en la que dicha proteína no es SEC ID Nº: 2876, 2878, 2880, 2882, 2884 o 2886 del documento WO99/57280 .

  4. 4.-

    Antígenos de Neisseria meningitidis

    (03/2015)

    Una proteína que comprende una secuencia de aminoácidos antigénica con homología de secuencia del 80% o superior con SEC ID Nº 2 ó SEC ID Nº 4, con la condición de que dicha proteína no sea (i) una proteína que tiene la secuencia de aminoácidos SEC ID Nº 7, ó (ii) un fragmento de SEC ID Nº 7.

  5. 5.-

    Antígenos y composiciones de neisseria meningitidis

    (03/2015)

    Una composición que comprende una proteína aislada que comprende: (i) una secuencia de aminoácidos seleccionada del grupo consistente de las SEQ IDs 2918, 2916 y 2920; o (ii) una secuencia de aminoácidos que tiene un 90% o más de identidad de secuencia con una secuencia de aminoácidos seleccionada del grupo consistente de las SEQ IDs 2918, 2916 y 2920.

  6. 6.-

    Polipéptidos PUfH meningocócicos

    (12/2014)

    Un polipéptido que comprende la secuencia de aminoácido SEQ ID NO: 23

  7. 7.-

    Composición inmunogénica que comprende una proteína espicular del coronavirus del SARS

    (12/2014)

    Composición inmunogénica que comprende un polipéptido aislado o purificado que comprende a) la secuencia de aminoácidos del polipéptido proteína espicular del virus del síndrome respiratorio agudo grave (SARS) SEQ ID NO: 6042, o b) una secuencia de aminoácidos con >80% de identidad de secuencia con la SEQ ID NO: 6042, o c) un fragmento de al menos 10 aminoácidos consecutivos de la SEQ ID NO: 6042; a condición de que el polipéptido no sea MFIFLLFLTLTSGSDLDRCTTFDDVQAP.

  8. 8.-

    Mejoras referentes a vesículas de membrana externa meningocócicas

    (10/2014)

    Una composición que comprende vesículas de membrana externa (VME) de dos o más de los serogrupos A, B, C, W135 e Y de meningococo.

  9. 9.-

    Antígenos Neisseriales conservados

    (08/2014)

    Una proteína que comprende un fragmento de una proteína de Neisseria, la proteína de Neisseria tiene la secuencia de aminoácidos de cualquiera de las SECs ID Nº 1 a 6, en la que dicho fragmento comprende una región antigénica de la proteína de Neisseria y consiste en 7 o más aminoácidos conservados consecutivos, en la que los aminoácidos conservados se encuentran en al menos el 50 % o más de las SECs ID Nº 1 a 6, con la condición de que dicha proteína no es una proteína completa de Neisseria que tiene la secuencia de aminoácidos de cualquiera de las SECs ID Nº 1 a 41.

  10. 10.-

    Vesículas de membranas externas bacterianas mejoradas

    (08/2014)

    Un proceso para la fabricación de una preparación de vesícula de membrana externa de una bacteria Gramnegativa recombinante que sobreexpresa el inmunógeno 287, en el que la membrana bacteriana se interrumpe sustancialmente en ausencia de detergente de desoxicolato.

  11. 11.-

    Vacuna de estreptococo del grupo B

    (07/2014)

    Una composición inmunogénica que comprende: a. uno o más antígenos de polipéptido GBS, y b. antígenos de sacárido GBS de GBS serotipos Ia, Ib y III, donde la composición comprende GBS80 o un fragmento inmunogénica del mismo.

  12. 12.-

    Vacuna OMV suplementada contra meningococo

    (07/2014)

    Una composición que comprende (a) una preparación de membrana externa del serogrupo B de N. meningitidis, y (b) un componente inmunogénico que comprende una proteína que comprende (i) una secuencia de aminoácidos seleccionada del grupo consistente de las SEQ IDs: **Fórmula** y **Fórmula** como se describe en la WO99/57280, (ii) un fragmento inmunogénico de una o más de las mencionadas SEQ IDs 2534, 2536 y 2538 o (iii) una secuencia de aminoácidos que tiene más de un 80% de identidad de secuencia con una de las mencionadas SEQ IDs 2534, 2536 y 2538.

  13. 13.-

    Vesículas de membranas externas bacterianas mejoradas

    (06/2014)

    Un procedimiento para la elaboración de una preparación de vesículas de membranas externas a partir de una bacteria Gram-negativa recombinante que sobre-expresa el inmunógeno 741, en el que la membrana bacteriana es sustancialmente rota en ausencia de detergente de desoxicolato.

  14. 14.-

    Antígenos neisseriales conservados

    (04/2014)

    Una proteína que comprende un fragmento antigénico de la proteína 953 neisserial MKKIIFAALAAAAVGTASATYKVDEYHANVRFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITI PVANLQSGSQPFTGHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMRGKTAPVKLKAEKFN CYQSPMAETEVCGGDFSTTIDRTKWGVDYLVNAGMTKNVRIDIQIEAAKQ; MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDIT IPIANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKF NCYQSPMEKTEVCGGDFSTTIDRTKWGMDYLVNVGMTKSVRIDIQIEAAKQ; o MKKIIIAALAAAAIGTASAATYKVDEYHANARFSIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDIT IPVANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKF NCYSPMLKTEVCGGDFSTTIDRTKWGMDYLVNVGMTKSVRIDIQIEAAKQ, siempre que dicha...

  15. 15.-

    Mejora de las vesículas de membrana externa bacteriana

    (09/2013)

    Una composición que comprende vesículas de membrana externa meningocócica, un adyuvante de hidróxido dealuminio, un tampón de histidina y cloruro sódico, donde: (a) la concentración de VMEs es inferior a 100 μg/ml; y/o(b) la concentración de cloruro sódico es superior a 7,5 mg/ml.

  16. 16.-

    Vacunas adyuvantadas con antígeno de no virión preparadas a partir de virus de la gripe cultivados en cultivo celular

    (08/2013)

    Una composición inmunogénica que comprende: (i) antígenos de superficie purificados preparados a partirde un virus de la gripe cultivado en un cultivo celular de mamífero o aviar; y (ii) un adyuvante de emulsión de aceiteen agua que tiene gotitas submicrométricas e incluye en volumen 5% de escualeno, 0,5% de polisorbato 80 y 0,5%de Span 85; en la que la composición está libre de ADN de pollo, albúmina de huevo y ovomucoide

  17. 17.-

    Vacunación con múltiples clados del virus de la gripe A H5

    (08/2013)

    Una composición inmunogénica que comprende antígeno de hemaglutinina de un primer clado del virus de la gripe A H5 para su uso en un procedimiento para inmunizar un sujeto contra el virus de la gripe que comprende las etapas de (i) administrar al sujeto la composición inmunogénica que comprende antígeno de hemaglutinina del primer clado del virus de la gripe A H5, y después (ii) administrar al sujeto una composición inmunogénica que comprende antígeno de hemaglutinina de un segundo clado del virus de la gripe A H5, en la que el primer y segundo clados...

  18. 18.-

    Antígenos Neisseriales conservados

    (03/2013)

    Una proteína que comprende un fragmento de al menos n aminoácidos conservados consecutivos de las SEC IDNos: 1-21, en la que n es 7 y el fragmento comprende una región antigénica de la SEC ID Nº, a condición de que laproteína no comprenda ninguna de las SEC ID Nos: 254-267.

  19. 19.-

    Dominios y epítopes de proteínas meningocócicas NMB 1870

    (10/2012)

    Un procedimiento para producir una secuencia de aminoácidos NMB1870 quimérica, que comprende las etapasde: (a) alinear una primera secuencia de aminoácidos NMB1870 con una segunda secuencia de aminoácidosNMB1870, en la que la primera y segunda secuencias son diferentes y provienen de familias diferentes deNMB1870, para proporcionar un par de secuencias alineadas; (b) seleccionar una parte de la primera secuencia deaminoácidos, comenzando en el aminoácido a1 de dicha primera secuencia de aminoácidos y acabando en elaminoácido b1 de dicha primera secuencia de aminoácidos, en la que la parte es una secuencia de superficie enbucle; (c) seleccionar una...

  20. 20.-

    Toxinas bacterianas ADP-ribosilantes

    (04/2012)

    Una proteína que consiste en una secuencia de aminoácidos de SEC ID Nº: 1, excepto que la secuencia de aminoácidos contiene entre una y veinte mutaciones, en la que cada mutación implica un único aminoácido y en la que la mutación o mutaciones reducen o eliminan la actividad ADP-ribosilante de la proteína.

  21. 21.-

    Vacunas contra la gripe que incluyen combinaciones de adyuvantes particulados e inmunopotenciadores

    (04/2012)

    Una composición inmunogénica que comprende: (i) un antígeno del virus de la gripe que es un virus inactivado y comprende virus completos, virus fraccionados o antígenos de superficie purificados, o está en forma de virosomas; (ii) un adyuvante particulado insoluble que comprende una micropartícula preparada a partir de poli(lactida-coglicolida); y (iii) un inmunopotenciador que es un oligonucleótido inmunoestimulante.

  22. 22.-

    POLIPÉPTIDOS QUIMÉRICOS , HIBRIDOS Y EN TANDEM DE NMB1870 MENINGOCOCICO

    (12/2011)

    Un polipéptido que comprende una secuencia de aminoácidos que tiene una identidad de al menos 85% con la SEC ID Nº 57 y en la que uno o más de los residuos siguientes, En comparación con la SEC ID Nº 57 está sustituido con otro aminoácido. A67; K70; K85; T147; N149; I39; K48; E51; R54; T56; A78; A79; D97; P105; S114; S116; L118; N120; Q121; A122, y en el que el polipéptido tiene la capacidad d einducir anticuerpos que son bactericidas contra cepas de cada una de las tres familias de NMB1870 I a III

  23. 23.-

    PROCEDIMIENTO PARA LA PREPARACIÓN DE UN FACTOR INMUNOGENO DE CORYNEBACTERIUM DIPHTERIAE USANDO UN MEDIO DE CULTIVO CON EXTRACTO DE LEVADURA COMO FUENTE DE AMINOACIDOS Y SIN COMPLEJOS PROTEICOS DE ORIGEN ANIMAL

    (03/2011)

    Un procedimiento para la preparación de un factor inmunógeno de una bacteria patógena que comprende las etapas de: a) cultivo de Corynebacterium diphtheriae en un medio que comprende al menos 20% en peso seco de un material proteínico de procedencia no animal, y el cual no comprende material proteínico de procedencia animal, en el que el material proteínico de procedencia no animal es un extracto de levadura; y b) purificación del factor inmunógeno a partir del medio

  24. 24.-

    PROTEÍNA PORTADORA DE POLIEPÍTOPOS

    (03/2011)

    Una proteína portadora que comprende 10 a 20 epítopos CD4+ de linfocitos T

  25. 25.-

    ANTIGENOS DE NEISSERIA MENINGITIDIS

    (02/2010)

    Una proteína que comprende una secuencia de aminoácidos antigénica con homología de secuencia del 80% o superior con SEC ID Nº 2 ó SEC ID Nº 4, con la condición de que dicha proteína no sea (i) una proteína que tiene la secuencia de aminoácidos SEC ID Nº 7, ó (ii) un fragmento de SEC ID Nº 7

  26. 26.-

    VACUNAS DTPA MUCOSICAS

    (07/2009)
    Ver ilustración. Solicitante/s: CHIRON S.P.A.. Clasificación: A61K39/39, A61P31/04, A61K39/108, A61K39/116, A61K39/106.

    El uso de LT-K63 o LT-R72 para la fabricación de un medicamento intranasal para vacunación de refuerzo de un paciente contra tos ferina, difteria y tétanos, comprendiendo dicho medicamento un antígeno de difteria (D), un antígeno de tétanos (T) y un antígeno de pertussis acelular.

  27. 27.-

    SECUENCIAS GENOMICAS DE NEISSERIA Y PROCEDIMIENTOS DE USO

    (07/2009)
    Ver ilustración. Solicitante/s: CHIRON CORPORATION THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C12Q1/68, C12N15/11, C07K14/22.

    Una proteína constituida por la secuencia de aminoácidos codificada por los nucleótidos 1363680 a 1364114 de la SEC DE ID Nº: 1.

  28. 28.-

    COMPOSICIONES QUE COMPRENDEN ANTIGENOS DE NEISSERIA MENINGITIDIS DE LOS SEROGRUPOS B Y C ASI COMO OTRO ANTIGENO

    (06/2009)
    Ver ilustración. Solicitante/s: NOVARTIS VACCINES AND DIAGNOSTICS S.R.L.. Clasificación: A61K39/095.

    Una composición inmunogénica que comprende: (a) oligosacárido de NmC; (b) vesículas proteoliposómicas de la membrana externa de NmB; y (c) una proteína que comprende (i) una secuencia de aminoácidos seleccionada de las SEC ID Nº 1, 2 ó 3, (ii) un fragmento inmunogénico de dicha secuencia, o (iii) una secuencia que tiene una identidad de secuencia de al menos un 80% con dichas SEC ID Nº: 1, 2 ó 3.

  29. 29.-

    ANTIGENOS Y COMPOSICIONES DE NEISSERIA MENINGITIDIS

    (09/2008)
    Ver ilustración. Solicitante/s: CHIRON CORPORATION THE INSTITUTE FOR GENOMIC RESEARCH. Clasificación: C12N15/31, C12Q1/68, G01N33/50, C07K16/12, A61K39/095, C07K14/22.

    Una proteína que comprende: * la secuencia de aminoácidos SEQ ID Nº: 2: * una secuencia de aminoácidos que tiene identidad de secuencia mayor del 50% con la secuencia de aminoácidos SEQ ID Nº: 2; o * un fragmento de una secuencia de aminoácidos SEQ ID Nº: 2, en el que dicho fragmento comprende 7 ó más aminoácidos consecutivos de dicha secuencia.

  30. 30.-

    MEDIO DE CULTIVO CON EXTRACTO DE SOJA COMO FUENTE DE AMINOACIDOS PERO SIN COMPLEJOS PROTEINICOS DE ORIGEN ANIMAL

    (03/2008)
    Ver ilustración. Solicitante/s: NOVARTIS VACCINES AND DIAGNOSTICS S.R.L.. Clasificación: A61K39/00, A61K39/02, C12N1/20, A61K39/08, A61P31/04, A61K39/095, A61K39/05, A61K39/10.

    Un procedimiento para la preparación de un factor inmunógeno de una bacteria patógeno que comprende las etapas de: a) cultivo de Haemuphilus influenzae en un medio que comprende al menos 20% en peso seco de un material proteináceo de origen no animal, y el cual no comprende material proteináceo de origen animal, en el que el material proteináceo de origen no animal es una composición de proteína procedente de soja; y b) opcionalmente, la purificación del factor inmunógeno a partir del medio.

  31. 31.-

    MUTANTES DESTOXIFICADOS INMUNOGENICOS DE LAS TOXINAS DEL COLERA

    (08/2007)
    Ver ilustración. Solicitante/s: CHIRON S.P.A.. Clasificación: C12N15/31, C07K14/245, C07K14/28, A61K39/106.

    UNA PROTEINA DETOXIFICADA INMUNOGENICA QUE CONTIENE LA SECUENCIA AMINOACIDICA DE LA SUBUNIDAD A DE LA TOXINA DEL COLERA (CT - A) O UN FRAGMENTO DE LA MISMA O LA SECUENCIA AMINOACIDICA DE LA SUBUNIDAD A DE UNA TOXINA LABIL AL CALOR DE ESCHERICHIA COLI (LT - A) O UN FRAGMENTO DE LA MISMA EN LA QUE LOS AMINOACIDOS EN LAS POSICIONES QUE SE CORRESPONDEN CON SER - 63 Y ARG - 192 ESTAN REEMPLAZADOS POR OTRO AMINOACIDO. LA PROTEINA DETOXIFICADA INMUNOGENICA ES UTIL COMO VACUNA PARA VIBRIO CHOLERAE O COMO UNA CEPA ENTEROTOXIGENICA DE ESCHERICHIA COLI, Y SE PRODUCE MEDIANTE DNA RECOMBINANTE POR MUTAGENESIS DIRIGIDA A SITIO.

  32. 32.-

    MUTANTES DESTOXIFICADOS INMUNOGENOS DE TOXINA DEL COLERAY DE LA TOXINA LT, SU PREPARACION Y USO EN LA PREPARACION DE VACUNAS

    (07/2007)
    Ver ilustración. Solicitante/s: CHIRON S.R.L. Clasificación: C12N5/10, C12N15/09, C12N15/31, A61P31/04, C12N1/19, A61K38/00, C12P21/02, C12N1/21, C07K14/195, A61K39/108, C12N1/15, C07K14/245, C07K14/41, C07K14/28, A61K39/106.

    Una proteína inmunógena destoxificada que comprende la secuencia de aminoácidos de la subunidad A de una toxina de cólera (CT - A) o un fragmento de la misma o la secuencia de aminoácidos de la subunidad A de una toxina lábil al calor de Escherichia coli (LT - A) o un fragmento de la misma, en la que el aminoácido en, o en la posición correspondiente al Val - 53, Val - 97 ó Tyr - 104 se reemplaza por otro aminoácido.

1 · >>