CIP 2015 : C12N 15/62 : Secuencias de ADN que codifican proteínas de fusión.

CIP2015CC12C12NC12N 15/00C12N 15/62[3] › Secuencias de ADN que codifican proteínas de fusión.

Notas[t] desde C01 hasta C14: QUIMICA
Notas[n] de C12N 15/62:
  • En el presente grupo, la expresión siguiente tiene el significado indicado a continuación:
    • "fusión" significa la fusión de dos proteínas diferentes.  

C SECCION C — QUIMICA; METALURGIA.

C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.

C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN (biocidas, productos que repelen o atraen a los animales nocivos, o reguladores del crecimiento de los vegetales, que contienen microorganismos virus, hongos microscópicos, enzimas, productos de fermentación o sustancias obtenidas por o extraídas de microorganismos o sustancias animales A01N 63/00; preparaciones de uso médico A61K; fertilizantes C05F ); PROPAGACION,CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00).

C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K).

C12N 15/62 · · · Secuencias de ADN que codifican proteínas de fusión.

CIP2015: Invenciones publicadas en esta sección.

Modulocinas basadas en el dominio sushi de IL-15 e IL-15r-alfa.

(19/11/2018) Inmunocitocina que comprende: a) un conjugado, y b) un anticuerpo inmunomodulador, o un fragmento del mismo que puede reaccionar con el mismo antígeno que su homólogo de anticuerpo, unido directa o indirectamente mediante covalencia a dicho conjugado, en el que dicho anticuerpo inmunomodulador o fragmento del mismo a. inhibe un receptor inmunosupresor y se selecciona del grupo que comprende antagonistas de CTL-A4, antagonistas de KIR inhibidores, antagonistas de BTLA, antagonistas de LAG3, antagonistas de HAVCR2, antagonistas de ADORA2A y antagonistas de PD-1, o b. estimula un receptor coestimulador y se selecciona del grupo que comprende agonistas de CD40, agonistas de CD137, agonistas de CD134 y agonistas…

Proteínas de fusión que se unen a factores de crecimiento.

(05/11/2018). Solicitante/s: Aprogen, Inc. Inventor/es: KIM,HAK-ZOO, KOH,YOUNG JUN, KIM,HO-MIN, JUNG,KEEHOON, JEON,CHOONJOO, KOH,GOU YOUNG.

Una molécula de ácido nucleico aislada que comprende una secuencia de nucleótidos de la siguiente manera: (a) la secuencia de nucleótidos de DAAP núm. 1 representada por SEQ ID NO: 1; (b) la secuencia de nucleótidos de DAAP núm. 13 representada por SEQ ID NO: 13; (c) la secuencia de nucleótidos de DAAP núm. 14 representada por SEQ ID NO: 15; (d) la secuencia de nucleótidos de DAAP núm. 15 representada por SEQ ID NO: 17; o (e) una secuencia de nucleótidos que, como resultado de la degeneración del código genético, difiere de la secuencia de nucleótidos de (a), (b), (c) y (d), pero que codifica una secuencia de aminoácidos idéntica a la expresada a partir de la misma.

PDF original: ES-2688623_T3.pdf

Antígeno de gliadina desamidada recombinante.

(31/10/2018). Solicitante/s: BIO-RAD LABORATORIES, INC.. Inventor/es: SHAN,DAMING, WALKER,ROGER, LU,YABIN, DESAI,URVEE.

Un antígeno para detectar la enfermedad celíaca que comprende una proteína gliadina desamidada recombinante o sintética que comprende un hexámero de péptidos, en el que cada péptido tiene la secuencia de SEQ ID NO: 1.

PDF original: ES-2688268_T3.pdf

Proteína de fusión saxatilina-Fc y utilización de la misma.

(30/10/2018). Solicitante/s: Industry-Academic Cooperation Foundation Yonsei University. Inventor/es: KIM, YOUNG DAE, HEO,JI HOE, KWON,IL, HONG,SUNG YU, KIM,DONG IK, JANG,YANG SOO.

Derivado de saxatilina que comprende saxatilina, que está compuesto por la secuencia de aminoácidos de la SEC ID nº: 2, que se conjuga a una región de inmunoglobulina Fc.

PDF original: ES-2687992_T3.pdf

Conjugados para administración ósea y procedimiento de uso de estos para dirigir proteínas al hueso.

(29/10/2018) Una molécula de ácido nucleico aislada que comprende una secuencia de polinucleótidos seleccionada del grupo que consiste en: a. Un polinucleótido que comprende la secuencia de nucleótidos como se presenta en la SEQ ID NO: 7; b. Un polinucleótido codificante de un polipéptido que comprende una secuencia de aminoácidos como se presenta en la SEQ ID NO: 8; c. Una secuencia de nucleótidos completamente complementaria con cualquiera de las secuencias de nucleótidos en a) o b); y d. Una secuencia de nucleótidos que se puede hibridar en condiciones de rigurosidad elevada con la secuencia de nucleótidos…

Proteínas de fusión bifuncionales para inhibir la angiogénesis en el microambiente tumoral y para activar las respuestas inmunitarias adaptativas y los genes y usos de las mismas.

(23/10/2018). Solicitante/s: China Pharmaceutical University. Inventor/es: WANG,SHUZHEN, CHEN,YIJUN, HE,DONGYANG, LIU,NAN, MA,CHAO, GAO,ZHENYUE.

Una proteína recombinante bifuncional que posee las actividades de tumstatina y CD137L, caracterizada porque la proteína comprende las secuencias de aminoácidos de los fragmentos activos de tumstatina y la región extracelular de CD137L, en la que las secuencias de tumstatina y CD137L se fusionan a través de un enlazador peptídico flexible, en la que la secuencia de aminoácidos del fragmento activo de tumstatina se selecciona de la SEQ ID NO.65 a la SEQ ID NO.68, en la que la secuencia de aminoácidos del enlazador peptídico se selecciona de la SEQ ID NO.69 a la SEQ ID NO.76, en la que la secuencia de aminoácidos del dominio extracelular de CD137L se selecciona de la SEQ ID NO.77 a la SEQ ID NO.80.

PDF original: ES-2686968_T3.pdf

Nuevo método de preparación de antibióticos y sistema de plataforma basado en el mismo.

(17/10/2018) Un método de preparación de antibióticos, que comprende las siguientes etapas: determinar dianas seleccionadas de células procariotas, células eucariotas y virus con membranas de bicapa fosfolipídica como estructura básica de su membrana celular o envoltura; diseñar una estructura molecular de dicho antibiótico nuevo de acuerdo con la siguiente fórmula general:**Fórmula** en la que R es la región de reconocimiento, que reconoce específicamente dichas dianas o se combina con dichas dianas y F es la región efectora, que produce efectos farmacéuticos en dichas dianas, causando dichos efectos farmacéuticos la muerte; establecer una biblioteca de estructura molecular de la región de reconocimiento, que comprende preparar de manera artificial sustancias artificiales que reconocen específicamente dichas dianas así como…

Polipéptidos de fusión inmunogénicos.

(15/10/2018). Solicitante/s: PFIZER INC.. Inventor/es: RUPPEN,MARK,EDWARD, JANSEN,KATHRIN UTE, MORAN,JUSTIN KEITH, VIDUNAS,EUGENE JOSEPH, ANDERSON,ANNALIESA SYBIL, DILTS,DEBORAH ANN.

Un polipéptido aislado que comprende la secuencia de un polipéptido transportador, en el que el polipéptido transportador es un citolisoide, ligado operativamente a la secuencia de aminoácidos de un polipéptido ORF2086 no lipidado y en el que el polipéptido ORF2086 comprende la secuencia de aminoácidos de SEQ ID NO: 19.

PDF original: ES-2685894_T3.pdf

Proteína de fusión que comprende AXL y composición para tratar el cáncer que comprende la misma.

(03/10/2018). Solicitante/s: Macrogen, Inc. Inventor/es: SEO,JEONG-SUN, KIM,YOUNG-TAE, JU,YOUNG-SEOK, KIM,EUN-HEE, KANG,JIN-HYOUNG.

Una proteína de fusión AXL-MBIP, que comprende un fragmento de proteína tirosina cinasa receptora AXL (AXL) en la parte N terminal y un fragmento de proteína 1 inhibidora de unión a MAP3K12 (MBIP) en la parte C terminal, que se unen entre sí, en la que el fragmento de proteína AXL comprende una secuencia de aminoácidos codificada por una secuencia de nucleótidos del 1º exón al 244º nucleótido del exón 20 de NM_021913 o NM_001699, y el fragmento de proteína MBIP comprende una secuencia de aminoácidos codificada por una secuencia de nucleótidos del exón 4 al último exón de NM_016586 o NM_001144891.

PDF original: ES-2684548_T3.pdf

Péptido que contiene múltiples sequones de glicosilación ligada a N.

(01/10/2018). Solicitante/s: THE GOVERNORS OF THE UNIVERSITY OF ALBERTA. Inventor/es: SZYMANSKI,CHRISTINE, NOTHAFT,HARALD.

Un péptido que comprende por lo menos dos repeticiones, preferiblemente nueve repeticiones, de la secuencia de aminoácidos como se establece en la SEQ ID NO: 1, en el que las repeticiones de la secuencia de aminoácidos como se establece en la SEQ ID 5 NO: 1 son contiguas o separadas por no más de 6 aminoácidos, en el que el péptido se glicosila en por lo menos una de las repeticiones de la secuencia de aminoácidos como se establece en la SEQ ID NO: 1.

PDF original: ES-2684087_T3.pdf

UNA SECUENCIA PEPTÍDICA DE UNA PROTEÍNA GUÍA PARA LA PRODUCCIÓN DE UN PÉPTIDO DE INTERÉS; UN VECTOR DE EXPRESIÓN; UNA CÉLULA HUÉSPED; UN PROCESO PARA PARA LA PRODUCCIÓN DE UN PÉPTIDO DE INTERÉS.

(05/07/2018). Solicitante/s: UNIVERSIDAD DE CHILE. Inventor/es: ASENJO DE LEUZE,Juan Adolfo, ANDREWS FARROW,Bárbara Anne, RODRÍGEZ GALLARDO,Vida.

Una secuencia peptídica de una proteína guía para la producción de un péptido de interés; Una secuencia peptídica que posee una similitud de al menos 90% con la anterior; Una secuencia nucleotídica que codifica para dicha proteína guía; Un vector de expresión que comprende dicha secuencia nucleotídica; Una célula huésped que expresa una proteína de fusión que comprende un péptido de interés; Un proceso para producir un péptido de interés, que comprende las etapas de A) construir un vector de expresión; B) insertar el vector de expresión en una célula huésped; C) expresar la proteína de fusión, cultivando la célula huésped en un medio de cultivo; D) recuperar la proteína de fusión acumulada en la célula huésped; E) escindir la proteína de fusión; F) purificar el péptido de interés.

CEPA RECOMBINANTE, MÉTODO DE PRODUCCIÓN DE PROTEASAS ASPÁRTICAS DE GALIUM VERUM Y USO EN LA INDUSTRIA LÁCTEA.

(28/06/2018). Solicitante/s: UNIVERSIDADE DE SANTIAGO DE COMPOSTELA. Inventor/es: GONZALEZ VILLA,TOMAS, FEIJOO SIOTA,Lucía, RODRÍGUEZ RAMA,José Luis, DE MIGUEL BOUZAS,Trinidad.

Cepa recombinante, método de producción de proteasas aspárticas de Galium verum y uso en la industria láctea. Construcción de una cepa recombinante que sobreexpresa proteasas aspárticas vegetales de la especie Galium verum usadas como coagulantes vegetales, procedimiento para su obtención y uso de estos coagulantes en la industria de los productos lácteos.

Cepa recombinante, método de producción de proteasas aspárticas de Galium verum y uso en la industria láctea.

(25/06/2018). Solicitante/s: UNIVERSIDADE DE SANTIAGO DE COMPOSTELA. Inventor/es: GONZALEZ VILLA,TOMAS, FEIJOO SIOTA,Lucía, RODRÍGUEZ RAMA,José Luis, DE MIGUEL BOUZAS,Trinidad.

Cepa recombinante, método de producción de proteasas aspárticas de Galium verum y uso en la industria láctea. Construcción de una cepa recombinante que sobreexpresa proteasas aspárticas vegetales de la especie Galium verum usadas como coagulantes vegetales, procedimiento para su obtención y uso de estos coagulantes en la industria de los productos lácteos.

PDF original: ES-2673702_A1.pdf

Proteínas de fusión terapéuticas dirigidas de enzima lisosómica y usos de las mismas.

(30/05/2018). Solicitante/s: BIOMARIN PHARMACEUTICAL INC. Inventor/es: WENDT, DANIEL, J., LEBOWITZ,JONATHAN, AOYAGI-SCHARBER,MIKA, LONG,SHINONG, DVORAK-EWELL,MELITA, CHRISTIANSON,TERESA MARGARET, GOLD,DANIEL SOLOMON.

Una proteína de fusión terapéutica dirigida que comprende (a) una enzima lisosómica, (b) un marcador peptídico que tiene una secuencia de aminoácidos al menos un 70% idéntica a los aminoácidos 8-67 de IGF-II humano maduro y (c) un péptido espaciador entre la enzima lisosómica y el marcador peptídico de IGF-II, en donde el péptido espaciador comprende la secuencia de aminoácidos GGGPS (SEQ ID NO: 14).

PDF original: ES-2679374_T3.pdf

Proteínas de fusión dirigidas/inmunomoduladoras y métodos de preparación de las mismas.

(30/05/2018). Solicitante/s: BIOCON LIMITED. Inventor/es: GOVINDAPPA,NAGARAJ, SASTRY,KEDARNATH, SOARES,MARIA MELINA.

Una proteína de fusión quimérica que consiste en un resto de direccionamiento para dirigir a una célula cancerosa, un resto inmunomodulador que contrarresta la tolerancia inmunitaria, y un espaciador de aminoácidos, en la que el resto de direccionamiento y el resto inmunomodulador están unidos por un espaciador de aminoácidos de longitud suficiente de restos de aminoácidos de manera que ambos restos puedan unirse satisfactoriamente a su diana individual, en la que el resto inmunomodulador es TGF-ßRII que consiste en la secuencia de aminoácidos de SEQ ID NO: 4; en la que el espaciador de aminoácidos es SEQ ID NO: 3 o SEQ ID NO:11; y en la que el resto de direccionamiento es anti-EGFR1 que consiste en la cadena pesada SEQ ID NO: 5 y la cadena ligera SEQ ID NO: 6; en la que SEQ ID NO: 4 está unida mediante el espaciador de aminoácidos al extremo C de SEQ ID NO: 5 o SEQ ID NO: 6 de anti-EGFR1.

PDF original: ES-2678696_T3.pdf

Opsonina obtenida por ingeniería genética para la detección y el tratamiento de microorganismos patógenos.

(30/05/2018). Solicitante/s: PRESIDENT AND FELLOWS OF HARVARD COLLEGE. Inventor/es: SUPER,Michael, INGBER,DONALD E, WAY,JEFFREY CHARLES.

Proteína de fusión de opsonina recombinante que comprende: un dominio de reconocimiento de carbohidrato de una lectina de unión a manosa (MBL) en donde el dominio de reconocimiento de carbohidrato permite la unión a manosa en la superficie de un microbio condensado a una porción Fc de una inmunoglobulina, en donde la proteína de fusión de opsonina recombinante excluye un dominio funcional de la opsonina que se une a una serina proteasa asociada a lectina de unión a manano (MASP).

PDF original: ES-2678143_T3.pdf

Proteína de fusión que tiene actividad de factor IX.

(16/05/2018). Solicitante/s: TiumBio Co., Ltd. Inventor/es: LEE, BONG YONG, KIM, HUN, TAEK,, PARK,MAHN-HOON, LIM,YUN JUNG, LEE,MIN SUN.

Una proteína de fusión que comprende factor IX (FIX) y transferrina de origen humano, en donde dicho factor IX es factor IX de origen humano y en donde dicha proteína de fusión comprende un enlazador representado por una cualquiera de las secuencias de aminoácidos de SEQ ID NO: 9 u 11 entre FIX y transferrina.

PDF original: ES-2676549_T3.pdf

Plaguicidas.

(02/05/2018). Solicitante/s: UNIVERSITY OF DURHAM. Inventor/es: GATEHOUSE,JOHN A, FITCHES,ELAINE C.

Una proteína de fusión que comprende: (i) una toxina proteica ω-ACTX-Hv1a que comprende la secuencia de aminoácidos SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (SEQ ID NO: 1), o una variante de la misma que retiene sustancialmente la actividad biológica de la toxina proteica ω-ACTX-Hv1a, teniendo dicha variante una secuencia de aminoácidos que tiene al menos un 75 % de identidad con la SEQ ID NO: 1; unida operativamente a (ii) una proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado, en donde la proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado es una lectina vegetal seleccionada entre una cualquiera o más de las siguientes: lectina de galanto (GNA), lectina de ajo Allium sativum, lectina de guisante Pisum sativum (P-lec), lectina de cacahuete Arachis hypogaea, lectina de judía verde (PHA, Phytohaemagglutinin).

PDF original: ES-2674324_T3.pdf

Vacunas basadas en levadura como inmunoterapia.

(25/04/2018). Solicitante/s: GLOBEIMMUNE, INC. Inventor/es: FRANZUSOFF,ALEX, BELLGRAU,DONALD.

Una composición terapéutica que comprende: (a) un vehículo de levadura que es una levadura completa; y (b) una proteína de fusión expresada por el vehículo de levadura, donde la proteína de fusión comprende en cualquier orden: (i) un polipéptido que comprende un dominio inmunogénico que comprende las posiciones 2 - 165 de una proteína Ras de tipo salvaje, donde el aminoácido en la posición 12 está mutado por sustitución de glicina con valina, cisteína o ácido aspártico y donde el aminoácido en la posición 61 está mutado por sustitución de glutamina con arginina; y (ii) un polipéptido que comprende un dominio inmunogénico que comprende las posiciones 56 - 67 de una proteína Ras de tipo salvaje, donde el aminoácido en la posición 61 está mutado por sustitución de glutamina con leucina.

PDF original: ES-2676503_T3.pdf

Proteínas de fusión biespecíficas.

(25/04/2018) Una proteina de fusion biespecifica que comprende: (a) un dominio de direccionamiento que tiene una especificidad de union a una molecula diana asociada a una celula danada de un tejido, en donde la molecula diana es fosfatidilserina y en donde el dominio de direccionamiento se selecciona del grupo que consiste en anexina V, sinaptotagmina I, lactadherina, mucina 1 de inmunoglobulina de celulas T, mucina 4 de inmunoglobulina de celulas T y anticuerpo anti-fosfatidilserina; y (b) un dominio activador que tiene una especificidad de union a un receptor del factor de crecimiento asociado a una superficie de una celula en el tejido, en donde el dominio activador se selecciona entre el grupo que consiste en neuregulina-1, factor de crecimiento similar a la insulina, factor de…

Proteína de fusión de hormona trófica, método de preparación y aplicación de la misma.

(18/04/2018). Solicitante/s: Suzhou Alphamab Co., Ltd. Inventor/es: XU,TING, GUO,KANGPING, YUN,LIHONG.

Una proteína de fusión que comprende una proteína de hormona trófica y un fragmento Fc de un anticuerpo, en la que la subunidad ß de la proteína de hormona trófica está ligada al fragmento Fc directamente o indirectamente a través de un engarce y la subunidad α de la proteína de hormona trófica se une a la subunidad ß a través de interacciones intermoleculares entre la subunidad α- y la subunidad ß, y en la que la subunidad α de la hormona trófica no está covalentemente unida al fragmento Fc, y en la que la hormona trófica se selecciona del grupo que consiste en hormona luteotrópica, hormona estimulante del folículo, gonadotropina coriónica y hormona estimulante de la tiroides, preferentemente, hormona estimulante del folículo.

PDF original: ES-2673317_T3.pdf

Proteínas de fusión monoméricas solubles del receptor de tipo II de la hormona antimulleriana y usos de las mismas.

(11/04/2018). Solicitante/s: INSERM (INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE). Inventor/es: CATE,RICHARD, DI CLEMENTE,NATHALIE.

Una proteína de fusión monomérica soluble del AMHRII que consiste en una primera cadena que tiene un dominio extracelular del AMHRII que comprende una secuencia de aminoácidos que tiene al menos el 80% de identidad con la secuencia de aminoácidos que varía desde el resto en la posición 18 hasta el resto en la posición 145 en la SEQ ID NO: 1 fusionado a un dominio Fc que comprende una secuencia de aminoácidos que varía desde el resto en la posición 104 hasta el resto en la posición 330 en la SEQ ID NO: 2 y una segunda cadena que consiste en un dominio Fc donde las cadenas están unidas por disulfuro dentro de su dominios Fc, en donde dicha proteína de fusión monomérica soluble del AMHRII es soluble en fluidos biológicos, tiene la capacidad de unirse a AMH escindida bioactiva.

PDF original: ES-2675040_T3.pdf

Clonación de alérgeno de abeja melífera.

(11/04/2018). Solicitante/s: PLS-DESIGN GMBH. Inventor/es: GRUNWALD,THOMAS.

Ácido nucleico que codifica un polipéptido capaz de unirse a IgE de sujetos alérgicos al veneno de un insecto del orden Hymenoptera, en el que el polipéptido tiene la secuencia de aminoácidos de SEQ ID NO: 2.

PDF original: ES-2677020_T3.pdf

Vacunas basadas en levadura como inmunoterapia.

(11/04/2018). Solicitante/s: GLOBEIMMUNE, INC. Inventor/es: FRANZUSOFF,ALEX, BELLGRAU,DONALD.

Una composición terapéutica que comprende: a) una levadura completa; y b) una proteína de fusión expresada por la levadura, comprendiendo la proteína de fusión: i) al menos un antígeno proteico o dominio inmunogénico del mismo seleccionado del grupo que consiste en: un antígeno de cáncer, un antígeno vírico y un antígeno bacteriano; y ii) un péptido unido al extremo N del antígeno proteico o dominio inmunogénico del mismo, consistiendo el péptido en una secuencia de aminoácidos de M-A-D-E-A-P (SEQ ID NO: 1).

PDF original: ES-2672319_T3.pdf

Polipéptidos de fusión que comprenden ligador de polipéptidos de dominio de mucina.

(04/04/2018) Una proteína de fusión que tiene bioactividad mejorada que comprende un primer socio de fusión de polipéptido y un segundo socio de fusión de polipéptido, en la que el primer socio de fusión se liga al segundo socio de fusión mediante un ligador de polipéptido de dominio de mucina, en el que la bioactividad de la proteína de fusión se mejora cuando se compara con la fusión del primer socio de fusión de polipéptido y el segundo socio de fusión de polipéptido en la ausencia del ligador de polipéptido de dominio de mucina, en el que; a) el ligador de polipéptido de dominio de mucina comprende todo o una porción de una secuencia de polipéptido de dominio de mucina codificada por un gen MUC seleccionado…

Composición que comprende una mezcla de isoformas CD95-Fc.

(28/03/2018) Una composición farmacéutica que comprende una mezcla de isoformas APG101, en la que APG101 no modificado está representado por SEQ ID NO: 1, comprendiendo dicha mezcla variantes APG101 truncadas en el extremo N y cuyo primer aminoácido es el aminoácido 17, 21 y 26 con respecto a SEQ ID NO: 1 y menos de 1% en moles de APG101 no modificado de acuerdo con la SEQ ID NO: 1 y que se distribuye dentro de un intervalo de pI de 4,0 - 8,5, y en el que dicha mezcla de isoformas APG101 se puede obtener mediante un método que comprende las etapas: (a) producir una mezcla de isoformas APG101 mediante un proceso de producción…

Ligandos modificados mediante permutación circular como agonistas y antagonistas.

(21/03/2018). Solicitante/s: Alkermes Pharma Ireland Limited. Inventor/es: ALVAREZ,JUAN, CHAMOUN,JEAN.

Un polipéptido de fusión que comprende los aminoácidos 1 a 303 de la SEQ ID NO: 26, o una secuencia de aminoácidos homóloga a la misma con al menos el 70 % de identidad de secuencia a nivel de aminoácidos que comprende una IL-2 permutada circularmente y tiene una 5 selectividad mejorada por IL-2Rßγ sobre IL-2Rαßγ en relación con la IL-2 de tipo silvestre.

PDF original: ES-2675568_T3.pdf

Composición para prevenir o tratar el cáncer de cuello uterino con un potenciador de la inmunidad contra el virus de papiloma humano.

(28/02/2018). Solicitante/s: Genexine, Inc. Inventor/es: SUNG, YOUNG CHUL, SEO,SANG HWAN, SUH,YOU SUK.

Una proteína de fusión que comprende: la secuencia de aminoácidos codificada por la secuencia expuesta en la SEQ ID NO: 4.

PDF original: ES-2666720_T3.pdf

Vesículas de suministro terapéutico.

(21/02/2018). Solicitante/s: EVOX THERAPEUTICS LIMITED. Inventor/es: EL ANDALOUSSI,SAMIR, WIKLANDER OSCAR, NORDIN JOEL, SMITH EDVARD, GRINNEMO,KARL-HENRIK, SIMONSON OSCAR.

Un exosoma de suministro terapéutico que comprende unido a su membrana un constructo polipeptídico, en el que el constructo polipeptídico comprende al menos un polipéptido transportador fusionado a al menos un receptor señuelo del polipéptido terapéutico presente al menos parcialmente en el exterior del exosoma de suministro y en el que al menos un receptor señuelo del polipéptido terapéutico es incompetente para señalización.

PDF original: ES-2662326_T3.pdf

Composición inmunogénica.

(10/01/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Inventor/es: CASTADO,CINDY.

Un polipéptido que comprende un primer fragmento y un segundo fragmento, en el que (i) el primer fragmento es un fragmento del dominio de repetición de la toxina A y comprende al menos 100 aminoácidos; (ii) el segundo fragmento es un fragmento del dominio de repetición de la toxina B y comprende al menos 100 aminoácidos; (iii) el extremo proximal del primer fragmento está situado dentro de una primera porción de repetición; (iv) el extremo proximal del segundo fragmento está situado dentro de una segunda porción de repetición y en el que el primer fragmento y el segundo fragmento están separados por menos de o exactamente 5 aminoácidos en la estructura primaria, en el que el polipéptido provoca anticuerpos que neutralizan la toxina A y la toxina B y en el que la primera porción de repetición y la segunda porción de repetición tienen una identidad de secuencia entre sí superior al 50 %.

PDF original: ES-2660468_T3.pdf

Composiciones terapéuticas de nucleasa y métodos.

(10/01/2018). Solicitante/s: UNIVERSITY OF WASHINGTON. Inventor/es: LEDBETTER, JEFFREY A., HAYDEN-LEDBETTER,MARTHA, ELKON,KEITH, SUN,XIZHANG.

Una molécula de nucleasa híbrida que comprende una RNasa humana y un dominio Fc de IgG1 humano mutante, en la que la RNasa humana está acoplada operativamente al dominio Fc y en la que el dominio Fc incluye una mutación P238S y una mutación P331S y tiene citotoxicidad reducida en relación con una molécula de nucleasa híbrida que tiene un dominio Fc no modificado y en la que la molécula de nucleasa híbrida comprende: una secuencia de aminoácidos expuesta en las SEQ ID NO: 96, 92, 62 o 78; o una secuencia de aminoácidos expuesta en las SEQ ID NO: 98 o 94.

PDF original: ES-2666303_T3.pdf

Defensinas vegetales modificadas útiles como agentes antipatógenos.

(20/12/2017). Solicitante/s: Hexima Limited. Inventor/es: ANDERSON, MARILYN, ANNE, VAN DER WEERDEN,NICOLE.

Un polipéptido de defensina Clase II solanácea artificialmente modificada aislado con una región bucle (Bucle 1B) entre una primera cadena ß y una hélice β en su porción del extremo N-terminal y que tiene actividad antifúngica, y en el que dicho Bucle 1B está reemplazado por un Bucle 1B de otra defensina, teniendo dicho polipéptido una porción del extremo C-terminal con al menos una 70 % de similitud a SEQ ID NO:52 después de alineación óptima.

PDF original: ES-2660965_T3.pdf

1 · · 4 · 7 · 14 · ››