CIP 2015 : A61K 45/00 : Preparaciones medicinales que contienen ingredientes activos no previstos en los grupos A61K 31/00 - A61K 41/00.

CIP2015AA61A61KA61K 45/00[m] › Preparaciones medicinales que contienen ingredientes activos no previstos en los grupos A61K 31/00 - A61K 41/00.

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A61K 45/06 · Mezclas de ingredientes activos sin caracterización química, p. ej. compuestos antiflojísticos y para el corazón.

A61K 45/08 · Mezclas de un ingrediente activo y de una sustancia auxiliar, no estando ninguno químicamente caracterizado, p. ej. antihistamínico y agente tensio-activo.

CIP2015: Invenciones publicadas en esta sección.

Composiciones lubricantes que producen calor y no irritantes.

(21/06/2017). Solicitante/s: Reckitt Benckiser (Brands) Limited. Inventor/es: SUN, YING, LIN, SHUN Y, AHMAD,NAWAZ.

Una composición que comprende: de aproximadamente el 80 % a aproximadamente el 98 % en peso de dos alcoholes polihídricos seleccionados entre el grupo que consiste en: glicerina, alquilenglicol, polietilenglicol; de aproximadamente el 1 % a aproximadamente el 5 % en peso de agente aislante que comprende miel o ésteres de alcohol isopropílico y ácidos grasos saturados de alto peso molecular; y menos de aproximadamente el 5 % en peso de agua.

PDF original: ES-2640745_T3.pdf

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona: métodos de uso y composiciones del mismo.

(07/06/2017). Solicitante/s: CELGENE CORPORATION. Inventor/es: MULLER, GEORGE, W., MAN, HON-WAH, SCHAFER,PETER,H, GE,CHUANSHENG.

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona, o un polimorfo, sal, solvato o hidrato del mismo farmacéuticamente aceptable, para usar en un método para tratar o prevenir la artritis reumatoide.

PDF original: ES-2637509_T3.pdf

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona: métodos de uso y composiciones del mismo.

(07/06/2017). Solicitante/s: CELGENE CORPORATION. Inventor/es: MULLER, GEORGE, W., MAN, HON-WAH, SCHAFER,PETER,H, GE,CHUANSHENG.

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona, o un polimorfo, sal, solvato o hidrato del mismo farmacéuticamente aceptable, para usar en un método para tratar o prevenir la espondilitis reumatoide u osteoartritis.

PDF original: ES-2637547_T3.pdf

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona: métodos de uso y composiciones del mismo.

(17/05/2017). Solicitante/s: CELGENE CORPORATION. Inventor/es: MULLER, GEORGE, W., MAN, HON-WAH, SCHAFER,PETER,H, GE,CHUANSHENG.

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona, o un polimorfo, sal, solvato o hidrato farmacéuticamente aceptable del mismo, para usar en un método para tratar o prevenir una enfermedad autoinmune.

PDF original: ES-2635361_T3.pdf

Agente inductor de inmunidad y método para la detección del cáncer.

(10/05/2017) Agente para su uso en un método para la terapia y/o la profilaxis del cáncer de mama y/o la leucemia, en donde dicho agente comprende como principio activo al menos un polipéptido seleccionado entre los polipéptidos (a) a (c) a continuación, teniendo dicho polipéptido una(s) actividad(es) inductora(s) de la inmunidad o como principio(s) activo(s) un/unos vectore(s) recombinante(s) que comprende(n) un/unos polinucleótido(s) que codifica(n) dicho(s) polipéptido(s) y que es/son capaz/capaces de expresar dicho(s) polipéptido(s) in vivo: (a) un polipéptido que consiste en una cualquiera de las secuencias de aminoácidos mostradas en las ID con número impar de las SEQ ID NO: 3 a 95; (b) un polipéptido que consiste en la secuencia de aminoácidos mostrada en la SEQ ID NO: 108, la SEQ ID NO: 109,…

Diagnóstico de enfermedades infecciosas del tracto respiratorio usando muestras de orina.

(26/04/2017). Solicitante/s: MOCHIDA PHARMACEUTICAL CO., LTD.. Inventor/es: SHIRAKAWA,KAMON.

Un procedimiento para detectar infección respiratoria asociada con infección bacteriana, que comprende: medir sCD14-ST en una muestra de orina obtenida de un sujeto.

PDF original: ES-2628868_T3.pdf

Diagnóstico de enfermedad infecciosa del tracto respiratorio usando muestras de sangre.

(26/04/2017). Solicitante/s: MOCHIDA PHARMACEUTICAL CO., LTD.. Inventor/es: SHIRAKAWA,KAMON.

Un procedimiento de detección de infección respiratoria asociada con infección bacteriana, que comprende: medir sCD14-ST en una muestra de sangre obtenida de un sujeto.

PDF original: ES-2634458_T3.pdf

Métodos y composiciones basados en la neurregulina para el tratamiento de las enfermedades cardiovasculares.

(22/03/2017). Solicitante/s: Zensun (Shanghai) Science & Technology, Co., Ltd. Inventor/es: ZHOU,MINGDONG.

Una composición para uso en un método para prevenir, tratar o retrasar una enfermedad o trastorno cardiovascular en los mamíferos, en donde la composición comprende una proteína neurregulina o un fragmento funcional de la misma que comprende un dominio de tipo factor de crecimiento epidérmico, o un ácido nucleico que codifica una proteína neurregulina o un fragmento funcional de la misma que comprende un dominio de tipo factor de crecimiento epidérmico, y en donde dicho método comprende la administración de dicha proteína neurregulina durante 21 días, o menos de 21 días, en una pauta posológica total que es igual o menor que 3600 U/kg.

PDF original: ES-2627547_T3.pdf

Derivado de tetrahidrocarbolina.

(08/03/2017). Solicitante/s: ONO PHARMACEUTICAL CO., LTD.. Inventor/es: SUGIYAMA, TETSUYA, OHATA,AKIRA, NAKATANI,SHINGO, MORIMOTO,TAKASHI.

Acido cis-4-{2-[9-(3-fluorobencil)-5,6,8,9-tetrahidro-7H-pirido[4',3':4,5]pirrolo[2,3-b]piridin-7-il]-2- oxoetil}ciclohexanocarboxilico o una sal del mismo o un solvato del mismo.

PDF original: ES-2623286_T3.pdf

Moléculas de ácidos nucleicos inmunoestimuladoras que comprenden motivos GTCGTT.

(08/02/2017). Solicitante/s: UNIVERSITY OF IOWA RESEARCH FOUNDATION. Inventor/es: WEINER,GEORGE, KLINMAN,DENNIS, KRIEG,ARTHUR.

Un oligonucleótido inmunoestimulador aislado que tiene 13-30 bases de longitud que comprende dos o tres motivos GTCGTT, en donde el oligonucleótido inmunoestimulador empieza con TC o TG en el extremo 5', en donde el oligonucleótido es sintético, monocatenario y comprende al menos una modificación forotioato en la cadena principal.

PDF original: ES-2624859_T3.pdf

Uso de inhibidores de IL-18 para tratar o prevenir lesiones en el SNC.

(08/02/2017). Solicitante/s: ARES TRADING S.A.. Inventor/es: SHOHAMI,ESTHER.

Uso de un inhibidor de la IL-18, en donde el inhibidor de la IL-18 es una proteína que se liga a la IL-18 (IL-18 BP) para la producción de un medicamento para el tratamiento de las lesiones traumáticas del cerebro (lesión cerrada de la cabeza), administrándose la IL-18 BP en una única dosis a los tres días después de la lesión.

PDF original: ES-2617084_T3.pdf

Medicamento de tipo administración local para mejorar la disfagia.

(08/02/2017). Solicitante/s: MEIJI SEIKA PHARMA Co., LTD. Inventor/es: KITAMURA, KOICHI, KONDO,MAHO, SHIMOYAMA,KIYOSHI, KUROSAWA,TORU.

Un medicamento que comprende una sustancia que tiene una acción inhibitoria sobre una enzima convertidora de angiotensina como el único principio activo, para su uso en el tratamiento de la disfagia, donde el medicamento es para ser administrado por vía local en un sitio faringolaríngeo y donde dicho medicamento es para ser administrado por pulverización, nebulización o aplicación directa a la mucosa faríngea.

PDF original: ES-2616960_T3.pdf

Preparación no acuosa para absorción percutánea que contiene analgésico antiinflamatorio no esteroideo.

(25/01/2017). Solicitante/s: Lead Chemical Co., Ltd. Inventor/es: YAMA,SEIJIROU, MURAI,NAOKI.

Una preparación no acuosa para absorción percutánea preparada mediante laminación de una capa adhesiva que comprende un analgésico antiinflamatorio no esteroideo en una forma de sal de metal alcalino, y ácido fosfórico, junto con una base no acuosa, sobre un soporte.

PDF original: ES-2622403_T3.pdf

Liposoma transpulmonar para controlar la llegada del fármaco.

(25/01/2017). Solicitante/s: Takeuchi, Hirofumi. Inventor/es: TAKEUCHI, HIROFUMI, TOYOBUKU,Hidekazu, NAKANO,KOJI.

Un liposoma para su uso en fármaco terapéutico o administración génica por administración pulmonar, en el que la superficie del liposoma está modificada con un poli(alcohol vinílico) hidrofobizado terminal.

PDF original: ES-2618457_T3.pdf

Agonistas del receptor de guanilato ciclasa para el tratamiento de inflamación tisular y carcinogénesis.

(18/01/2017). Solicitante/s: SYNERGY PHARMACEUTICALS, INC. Inventor/es: JACOB, GARY, S., SHAILUBHAI,KUNWAR, NIKIFOROVICH,GREGORY.

Un péptido que consiste en SEC ID Nº: 20 cuyo péptido es un biciclo [4, 12; 7, 15] para su uso en terapia para potenciar la producción intracelular de GMPc.

PDF original: ES-2622468_T3.pdf

Sistemas de transporte de agentes biológicos de múltiples componentes.

(18/01/2017) Una composición que comprende un complejo de asociación no covalente de: (a) una cadena principal polimérica cargada positivamente que tiene unida covalentemente a la misma una pluralidad de secuencias de aminoácidos cargadas positivamente seleccionadas de -(gly)n1 -(arg)n2, en la que n1 es un número entero de 0 a 20 y n2 es un número entero impar de 5 a 25; (gly)p-RGRDDRRQRRR-(gly)q; (gly)p- YGRKKRRQRRR-(gly)q, en la que los subíndices p y q son cada uno, independientemente, un número entero de 0 a 20; o un dominio peptídico TAT de VIH cargado positivamente; y (b) al menos dos miembros seleccionados del grupo que consiste en: …

Derivado de octahidrotienoquinolina novedoso, composición farmacéutica que comprende el derivado, y uso de los mismos.

(14/12/2016) Un compuesto representado por la fórmula general (I):**Fórmula** o una de sus sales farmacéuticamente aceptables, en donde R1 es uno cualquiera de los siguientes a) a d): a) un grupo ciano, b) un grupo carbamoílo, c) un grupo alcoxicarbonilo C2-C7, o d) un grupo carboxi; R2 y R3 son cada uno independientemente un átomo de hidrógeno, un grupo alquilo C1-C6, un grupo acilo C1-C7, o un grupo alcoxi(C2-C7)carbonilo; R4 es un átomo de hidrógeno, un grupo alquilo C1-C6, o un grupo haloalquilo C1-C6; R5 es uno cualquiera de los siguientes a) a j): a) un grupo alquilo C1-C6, b) un grupo haloalquilo C1-C6, c) un grupo cicloalquilo, d) un grupo cicloalquilo benzofusionado, e) un grupo cicloalquilalquilo C1-C6, f) un grupo aralquilo, en donde el anillo del grupo aralquilo no está sustituido…

Inducción de omisión de exones en células eucarióticas.

(14/12/2016). Solicitante/s: ACADEMISCH ZIEKENHUIS LEIDEN. Inventor/es: DEN DUNNEN, JOHANNES, THEODORUS, VAN OMMEN,GARRIT-JAN BOUDEWIJN, VAN DEUTEKOM,JUDITH CHRISTINA THEODORA.

Un oligonucleótido antisentido ARNmcapaz de inhibir una secuencia de reconocimiento exónico en el exón 51 del pre-ARNm de distrofina lo que facilita el enmascaramiento del exón por el aparato de empalme y la exclusión del exón del ARNm final, en donde el oligonucleótido es complementario a dicho exón o a parte del mismo, y tiene una longitud de 14-40 nucleótidos, en donde el oligonucleótido induce la omisión de dicho exón cuando dicho oligonucleótido antisentido está presente en una célula que tiene un pre-ARNm de distrofina que contiene dicho exón.

PDF original: ES-2609421_T3.pdf

P40 de interleuquina-12 de mamífero e interleuquina B30. Sus combinaciones. Anticuerpos. Usos en composiciones farmacéuticas.

(14/12/2016). Solicitante/s: MERCK SHARP & DOHME CORP. Inventor/es: DE WAAL MALEFYT, RENE, KASTELEIN, ROBERT, A., NARULA, SATWANT, K., RENNICK, DONNA M., OPPMANN,BIRGIT, WIEKOWSKI,MARIA,T, LIRA,SERGIO,A.

Una composición que comprende un complejo de: i) un polipéptido p40 de IL-12 humana, maduro y sustancialmente puro. ii) un polipéptido de la SEQ ID NO:2 maduro y sustancialmente puro.

PDF original: ES-2300276_T3.pdf

PDF original: ES-2300276_T5.pdf

Anticuerpo monoclonal para la proteina de union a osteoprotegerina.

(07/12/2016). Solicitante/s: AMGEN INC.. Inventor/es: BOYLE, WILLIAM, J., DESHPANDE,RAJENDRA,V, HITZ,ANNA, SULLIVAN,John,K.

Un anticuerpo monoclonal o un dominio de unión a antígeno del mismo que se une a una porción de la secuencia de aminoácidos: GGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP (SEQ ID NO: 76) desde el resto de aminoácido 212 hasta el resto de aminoácido 250 de OPGbp (proteína de unión a osteoprotegerina) humana, en donde el anticuerpo o el dominio de unión a antígeno del mismo inhibe la formación o la activación de osteoclastos mediada por OPGbp humana.

PDF original: ES-2612124_T3.pdf

Composición farmacológica para el tratamiento y/o la prevención del cáncer.

(07/12/2016). Solicitante/s: TORAY INDUSTRIES, INC.. Inventor/es: OKANO, FUMIYOSHI, SAITO,TAKANORI, KOBAYASHI,SHINICHI, MINAMIDA,YOSHITAKA.

Un anticuerpo o un fragmento del mismo que tienen reactividad inmunologica con una proteina CAPRIN-1, comprendiendo el anticuerpo o el fragmento del mismo una region variable de cadena pesada que comprende las regiones determinantes de complementariedad de SEQ ID NO: 5, 6 y 7 y una region variable de cadena ligera que comprende las regiones determinantes de complementariedad de SEQ ID NO: 9, 10 y 11.

PDF original: ES-2618026_T3.pdf

Novedosos polipéptidos que tienen similitud de secuencia con GDNFR y ácidos nucleicos que los codifican.

(30/11/2016). Solicitante/s: GENENTECH, INC.. Inventor/es: WOOD, WILLIAM, I., ZHANG, ZEMIN, GRIMALDI,CHRISTOPHER,J, SESHAGIRI,Somasekar, STINSON,JEREMY.

Una molecula de acido nucleico aislada que comprende una secuencia de nucleotidos que codifica un polipeptido que tiene: (a) la secuencia de los restos de aminoacido de 1 a 394 de la Figura 2 (SEQ ID NO: 2); o (b) los restos de aminoacido 1 a X de la Figura 2 (SEQ ID NO: 2), donde X es cualquier aminoacido de 347-377 de la Figura 2.

PDF original: ES-2616362_T3.pdf

Antagonistas de HMG1 para el tratamiento de afecciones inflamatorias.

(16/11/2016). Solicitante/s: THE FEINSTEIN INSTITUTE FOR MEDICAL RESEARCH. Inventor/es: TRACEY, KEVIN, J., WANG, HAICHAO.

El uso como se reivindica en la Reivindicación 10, en el que el antagonista es un anticuerpo que se une específicamente a una proteína HMG1 o a un fragmento de ésta.

PDF original: ES-2269118_T5.pdf

PDF original: ES-2269118_T3.pdf

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona: métodos de uso y composiciones del mismo.

(02/11/2016). Solicitante/s: CELGENE CORPORATION. Inventor/es: MULLER, GEORGE, W., MAN, HON-WAH, SCHAFER,PETER,H, GE,CHUANSHENG.

(+)-2-[1-(3-Etoxi-4-metoxifenil)-2-metilsulfoniletil]-4-acetilaminoisoindolin-1,3-diona, o un polimorfo, sal, solvato o hidrato farmacéuticamente aceptable del mismo, para usar en un método para tratar o prevenir afecciones artríticas.

PDF original: ES-2608495_T3.pdf

Agente preventivo y/o remedio para el síndrome mano-pie.

(26/10/2016). Solicitante/s: ONO PHARMACEUTICAL CO., LTD.. Inventor/es: ISHIZAKA,KAZUHIRO, NOMIZU,TADASHI, KITAO,AYA.

Un agente que comprende un compuesto con actividad anticolinérgica para su uso en la prevención y/o el tratamiento del síndrome mano-pie, con la condición de que se excluye una combinación de clonidina y el compuesto con actividad anticolinérgica.

PDF original: ES-2604705_T3.pdf

Anticuerpos IgM humanos con la capacidad de inducir remielinización y usos diagnósticos y terapéuticos de los mismos, particularmente en el sistema nervioso central.

(12/10/2016). Solicitante/s: MAYO FOUNDATION FOR MEDICAL EDUCATION AND RESEARCH. Inventor/es: RODRIGUEZ, MOSES, MILLER, DAVID, J., PEASE,Larry R.

Un anticuerpo humano, o una mezcla, monómero o fragmento activo del mismo que tiene: (i) un dominio variable de la cadena pesada que comprende las secuencias de la región CDR1, CDR2 y CDR3 como se expone en la Figura 39, y un domino variable de la cadena ligera que comprende las secuencias de la región CDR1, CDR2 y CDR3 como se expone en la Figura 40. (ii) un dominio variable de la cadena pesada que comprende las secuencias de la región CDR1, CDR2 y CDR3 como se expone en la Figura 41, y un domino variable de la cadena ligera que comprende las secuencias de la región CDR1, CDR2 y CDR3 como se expone en la Figura 42.

PDF original: ES-2609494_T3.pdf

Adhesinas complementadas por cadena donadora como inmunógeno contra Escherichia coli.

(12/10/2016) Composición inmunogénica, caracterizada porque dicha composición es un complejo que comprende una secuencia de aminoácidos que codifica para un polipéptido antigénico completo o fragmento de polipéptido antigénico de adhesina de fimbria de Escherichia coli unido en el extremo C-terminal de dicha adhesina de fimbria a un ligador que está operativamente unido en el extremo-C terminal de dicho ligador a un polipéptido antigénico completo o fragmento de polipéptido antigénico de subunidad de fimbria estructural principal de Escherichia coli que comprende al menos los 12 primeros aminoácidos del motivo de cadena beta N-terminal de dicha subunidad de fimbria estructural principal de Escherichia coli, que comprende una cadena donadora que complementa la adhesina de fimbria y que confiere estabilidad conformacional y resistencia a proteasas a dicho polipéptido…

Anticuerpos que se unen inmunoespecíficamente a BLyS.

(12/10/2016) Un anticuerpo humano o humanizado que neutraliza se une a la Proteína Estimuladora de Linfocitos B o un fragmento funcional del mismo, en el que dicho anticuerpo es (a) un anticuerpo humano o humanizado que se une a la Proteína Estimuladora de Linfocitos B, en el que el anticuerpo comprende los restos de aminoácidos 26-35, 50-66, 99-112, 163-173, 189-195 y 228-238 de la SEQ ID NO: 2; (b) un anticuerpo monoclonal humano o humanizado que inhibe competitivamente la unión del anticuerpo producido por la línea celular que tiene el Número de Depósito ATCC PTA-3239 a la Proteína Estimuladora de Linfocitos B; o (c) un anticuerpo monoclonal humano o humanizado que reduce la unión del anticuerpo producido por la línea celular que…

Composición farmacéutica para el tratamiento y/o prevención del cáncer pancreático.

(05/10/2016). Solicitante/s: TORAY INDUSTRIES, INC.. Inventor/es: OKANO, FUMIYOSHI, SAITO,TAKANORI, MINAMIDA,YOSHITAKA.

Una composicion farmaceutica para su uso en un metodo de tratamiento del cancer pancreatico, que comprende, como principio activo, un anticuerpo o un fragmento del mismo que tienen reactividad inmunologica especifica con una proteina CAPRIN-1 o un fragmento de la misma que comprende de 7 a 12 o mas restos de aminoacidos consecutivos.

PDF original: ES-2609846_T3.pdf

Derivado de bicicloanilina.

(28/09/2016) Un compuesto de formula general (I):**Fórmula** en la que, A1 y A2 cada uno independientemente significan un atomo de nitrogeno, o significan un grupo metino opcionalmente sustituido con un atomo de halogeno, un grupo hidroxilo, un grupo ciano, un grupo alquilo C1-C6, un grupo alcoxi C1-C6 o un grupo hidroxi-alquilo C1-C6; el Anillo B es un anillo condensado con un anillo de formula (a):**Fórmula** seleccionado entre un grupo que consiste en una formula (b-1):**Fórmula** un grupo que consiste en una formula (b-2):**Fórmula** o un grupo que consiste en una formula (b-3):**Fórmula** en las que uno o dos o mas grupos metileno que constituyen dicho Anillo B pueden estar independientemente sustituidos con un atomo de oxigeno, un atomo de azufre, un grupo sulfinilo,…

Anticuerpos que se unen inmunoespecíficamente a BLyS.

(28/09/2016) Un anticuerpo humano o humanizado que neutraliza se une a la Proteína Estimuladora de Linfocitos B o un fragmento funcional del mismo, en el que dicho anticuerpo es (a) un anticuerpo humano que se une a la Proteína Estimuladora de Linfocitos B en el que el anticuerpo comprende los restos de aminoácidos 26-35, 50-66, 99-112, 163-173, 189-195 y 228-238 de la SEQ ID NO: 327; (b) un anticuerpo monoclonal humano o humanizado que inhibe competitivamente la unión del anticuerpo producido por la línea celular que tiene el Número de Depósito ATCC PTA-3240 a la Proteína Estimuladora de Linfocitos B; o (c) un anticuerpo monoclonal humano o humanizado que reduce la unión del anticuerpo producido por la línea celular que tiene el…

‹‹ · · 3 · · 5 · 6 · 7 · 8 · 9 · 10 · 11 · 12 · 13 · 14 · 15 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015