CIP 2015 : A61K 39/00 : Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

CIP2015AA61A61KA61K 39/00[m] › Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".
Notas[n] de A61K 39/00:
  • La preparación de composiciones que contienen antígenos o anticuerpos se clasifican igualmente en la subclase C12N, si la etapa del cultivo del microorganismo tiene interés.
  • Los grupos A61K 39/002 - A61K 39/12   cubren las preparaciones que contienen protozoos, bacterias, virus, o sus partes elementales, p. ej. partes de membranas.

A61K 39/002 · Antígenos de protozoos.

A61K 39/005 · · Antígenos de Tripanosoma.

A61K 39/008 · · Antígenos de Leishmania.

A61K 39/012 · · Antígenos de Coccidia.

A61K 39/015 · · Antígenos de Hemosporidia, p. ej. antígenos de Plasmodium.

A61K 39/018 · · · Antígenos de Babesia, p. ej. antígenos de Theileria.

A61K 39/02 · Antígenos bacterianos.

A61K 39/04 · · Mycobacterium, p. ej. Mycobacterium tuberculosis.

A61K 39/05 · · Corynebacterium; Propionibacterium.

A61K 39/07 · · Bacillus.

A61K 39/08 · · Clostridium, p. ej. Clostridium tetani.

A61K 39/085 · · Staphylococcus.

A61K 39/09 · · Streptococcus.

A61K 39/095 · · Neisseria.

A61K 39/10 · · Brucella; Bordetella, p. ej. Bordetella pertussis.

A61K 39/102 · · Pasteurella; Haemophilus.

A61K 39/104 · · Pseudomonas.

A61K 39/106 · · Vibrio; Campylobacter.

A61K 39/108 · · Escherichia; Klebsiella.

A61K 39/112 · · Salmonella; Shigella.

A61K 39/114 · · Fusobacterium.

A61K 39/116 · · Antígenos bacterianos polivalentes.

A61K 39/118 · Chlamydiaceae, p. ej. Chlamydia trachomatis o Chlamydia psittaci.

A61K 39/12 · Antígenos virales.

A61K 39/125 · · Picornaviridae, p. ej. Calicivirus.

A61K 39/13 · · · Virus de la poliomielitis.

A61K 39/135 · · · Virus de la fiebre aftosa.

A61K 39/145 · · Orthomyxoviridae, p. ej. virus de la influenza.

A61K 39/15 · · Reoviridae, p. ej. virus de la diarrea de la ternera.

A61K 39/155 · · Paramyxoviridae, p. ej. virus de la parainfluenza.

A61K 39/165 · · · Virus de la parotiditis o del sarampión.

A61K 39/17 · · · Virus de la enfermedad de Newcastle.

A61K 39/175 · · · Virus del moquillo canino.

A61K 39/187 · · Virus de la peste porcina.

A61K 39/193 · · Virus de encefalomielitis equina.

A61K 39/20 · · Virus de la rubeola.

A61K 39/205 · · Rhabdoviridae, p. ej. virus de la rabia.

A61K 39/21 · · Retroviridae, p. ej. virus de la anemia infecciosa equina.

A61K 39/215 · · Coronaviridae, p. ej. virus de la bronquitis infecciosa aviar.

A61K 39/225 · · · Virus de la gastroenteritis transmisible del cerdo.

A61K 39/23 · · Parvoviridae, p. ej. virus de la leucemia felina.

A61K 39/235 · · Adenoviridae.

A61K 39/245 · · Herpetoviridae, p. ej. virus del herpes simple.

A61K 39/25 · · · Herpesvirus varicellae.

A61K 39/255 · · · Virus de la enfermedad de Marek.

A61K 39/265 · · · Virus de la rinotraqueítis infecciosa.

A61K 39/27 · · · Virus de la rinoneumonía equina.

A61K 39/275 · · Poxviridae, p. ej. avipoxvirus.

A61K 39/285 · · · Virus de la viruela o virus de la varicela.

A61K 39/29 · · Virus de la hepatitis.

A61K 39/295 · · Antígenos virales polivalentes (virus de la viruela o de la varicela A61K 39/285 ); Mezclas de antígenos virales y bacterianos.

A61K 39/35 · Alergenos.

A61K 39/36 · · del polen.

A61K 39/38 · Antígenos de serpientes.

A61K 39/385 · Haptenos o antígenos, unidos a soportes.

A61K 39/39 · caracterizados por los aditivos inmunoestimulantes, p. ej. por los adyuvantes químicos.

A61K 39/395 · Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario.

A61K 39/40 · · bacterianos.

A61K 39/42 · · virales.

A61K 39/44 · · Anticuerpos unidos a sus soportes.

CIP2015: Invenciones publicadas en esta sección.

Tratamiento para la caquexia.

(02/01/2019). Solicitante/s: XBIOTECH, INC. Inventor/es: SIMARD,JOHN.

Una composición farmacéutica para su uso en un método para tratar la caquexia asociada al cáncer en un sujeto humano, comprendiendo dicha composición farmacéutica un portador farmacéuticamente aceptable y una cantidad eficaz de un Ab anti-IL-1α.

PDF original: ES-2695102_T3.pdf

Epitopos de antígeno de superficie receptor de factor de crecimiento epidérmico y uso de los mismos.

(26/12/2018). Solicitante/s: GREEN CROSS CORPORATION. Inventor/es: KIM, SE HO, KIM, MIN-SOO, CHANG,KI HWAN, HONG,KWANG-WON, WON,JONG-HWA, HUR,MIN-KYU, LEE,MI-JUNG, CHO,HYUN-SOO, YOO,JI-HO.

Epítopo de un receptor de factor de crecimiento epidérmico (EGFR) que consiste en la secuencia de aminoácidos de RGDSFTH (SEQ ID NO: 2) o RGDSFTHTP (SEQ ID NO: 3).

PDF original: ES-2694679_T3.pdf

Clones de ADN infeccioso quimérico de circovirus porcino y uso de los mismos.

(21/12/2018) Una vacuna para su uso en la protección de un lechón contra circovirus porcino (PCV) de tipo 2 o síndrome de desmedro multisistémico post-destete (PMWS) provocado por PCV2, en el que el lechón tiene anticuerpos maternos de PCV2 y en el que la vacuna comprende una cantidad inmunogénica de un miembro seleccionado entre el grupo que consiste en: (a) una molécula de ácido nucleico quimérico de circovirus porcino (PCV1-2) que comprende una molécula de ácido nucleico que codifica un PCV1 no patógeno, que contiene el gen de la cápside del marco abierto de lectura 2 (ORF2) de un PCV2 patógeno en lugar del gen de la cápside del ORF2 de la molécula de ácido nucleico de PCV1; (b) un plásmido o vector viral que contiene la molécula de ácido nucleico…

Polipéptidos de interleucina-2 mutantes.

(21/12/2018) Un inmunoconjugado que comprende un polipéptido de IL-2 mutante y un resto de unión a antígeno, en el que dicho polipéptido de IL-2 mutante comprende la secuencia de SEQ ID NO: 19; y en el que dicho resto de unión a antígeno es una molécula de inmunoglobulina de subclase IgG1 específica para la proteína de activación de fibroblastos (FAP), que comprende (i) la secuencia de la región variable de la cadena pesada de SEQ ID NO: 41 y la secuencia de la región variable de la cadena ligera de SEQ ID NO: 39; (ii) la secuencia de la región variable de la cadena pesada de SEQ ID NO: 51 y la secuencia de la región variable de la cadena ligera de SEQ ID NO: 49; (iii) la secuencia de la región variable de la cadena pesada de SEQ ID NO: 111 y la secuencia de la región variable de la cadena…

NanobodiesTM mejorados para el tratamiento de trastornos mediados por agregación.

(19/12/2018). Solicitante/s: ABLYNX N.V. Inventor/es: SILENCE,KAREN.

Proteína o polipéptido, que comprende dos VHH, dominios VHH humanizados o dominios VH camelizados, en el que dichos VHH, dominios VHH humanizados o dominios VH camelizados están dirigidos contra factor de von Willebrand (vWF), y dichos VHH, dominios VHH humanizados o dominios VH camelizados consisten en 4 regiones de entramado (FR1 a FR4 respectivamente) y 3 regiones determinantes de complementariedad (CDR1 a CDR3 respectivamente), en el que: i) CDR1 comprende o consiste en la secuencia de aminoácidos YNPMG [SEQ ID NO: 22]; y en el que: ii) CDR2 comprende o consiste en una secuencia de aminoácidos elegida del grupo que consiste en: AISRTGGSTYYPDSVEG [SEQ ID NO: 32], y AISRTGGSTYYARSVEG [SEQ ID NO: 31]; y en el que: iii) CDR3 comprende o consiste en una secuencia de aminoácidos elegida del grupo que consiste en: AGVRAEDGRVRTLPSEYTF [SEQ ID NO: 42], AGVRAEDGRVRSLPSEYTF [SEQ ID NO: 43], y AGVRAEDGRVRTLPSEYNF [SEQ ID NO: 41].

PDF original: ES-2694247_T3.pdf

Anticuerpos específicos del Tgf-1 y métodos y usos de los mismos.

(19/12/2018). Solicitante/s: Ludwig Institute for Cancer Research Limited. Inventor/es: BOON, THIERRY, VAN SNICK, JACQUES, UYTTENHOVE, CATHERINE.

Una molécula de anticuerpo aislado o fragmento del mismo que reconoce el factor de crecimiento transformante beta 1 (TGF-ß1) humano y de ratón, no reacciona con el TGF-ß2 o TGF-ß3, y neutraliza la actividad del TGF-ß1; y que comprende una región variable de cadena pesada que comprende las secuencias de dominio CDR CDR1 GYTFTNYW (SEQ ID NO: 11)_o GYTFTNYWMH (SEQ ID NO: 3), CDR2 IYPGNSDT (SEQ ID NO: 12) o TIYPGNSDTN (SEQ ID NO: 4)_ y CDR3 EDSRSLYYNGWDYFDY (SEQ ID NO: 5) y una región variable de cadena ligera que comprende las secuencias de dominio CDR CDR1 ESVDNYGISF (SEQ ID NO: 6), CDR2 YAAS (SEQ ID NO: 7) y CDR3 QQSKEVPRT (SEQ ID NO: 8).

PDF original: ES-2694203_T3.pdf

Virus de la gripe porcina modificado por ingeniería genética y usos de los mismos.

(18/12/2018). Solicitante/s: Icahn School of Medicine at Mount Sinai. Inventor/es: PALESE, PETER, GARCIA-SASTRE,ADOLFO, WEBSTER,ROBERT, LAGER,KELLY M, RICHT,JUERGEN A, WEBBY,RICHARD J.

Un virus de la gripe porcina atenuado, modificado por ingeniería genética, en donde el virus comprende un gen de NS1 de virus de la gripe porcina con una mutación que produce una proteína NS1 de virus de la gripe porcina que tiene una deleción de exactamente 90 restos de aminoácido del carboxi terminal de NS1, en donde el gen de NS1 de virus de la gripe porcina es de A/Porcino/Texas/4199-2/98.

PDF original: ES-2694123_T3.pdf

Vehículo para distribuir un compuesto en una membrana mucosa y composiciones, procedimientos y sistemas relacionados.

(18/12/2018). Solicitante/s: CALIFORNIA INSTITUTE OF TECHNOLOGY. Inventor/es: MAZMANIAN,SARKIS K, SHEN,YUE.

Una composición bacteriana para su uso como medicamento, que comprende una vesícula de membrana externa formada por una membrana lipídica que encierra un ambiente acuoso, comprendiendo la vesícula polisacárido A (PSA), en la que la membrana lipídica es de la membrana externa de Bacteroides fragilis.

PDF original: ES-2694100_T3.pdf

Polipéptido que comprende una región Fc de IgG1 humana variante.

(17/12/2018). Solicitante/s: GENENTECH, INC.. Inventor/es: PRESTA, LEONARD, G..

Una variante de un polipéptido original que comprende una región Fc de IgG1 humana, variante que se une a un receptor gamma de Fc III (FcγRIII) con mejor afinidad que el polipéptido original, y donde la variante comprende una región Fc de IgG1 humana variante con al menos una modificación de aminoácido en una cualquiera o más de las posiciones de aminoácido 256, 290, 298, 312, 326, 330, 333, 334, 360 o 430 de la región Fc, donde la numeración de los residuos de la región Fc corresponde al índice EU de Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed., Public Health Service, National Institutes of Health, Bethesda, MD.

PDF original: ES-2694002_T3.pdf

Anticuerpo que se une a CD3 humano.

(12/12/2018). Solicitante/s: Merus N.V. Inventor/es: BAKKER,ALEXANDER,BERTHOLD,HENDRIK, VAN LOO,PIETER FOKKO.

Un anticuerpo que se une a CD3 humano cuyo anticuerpo comprende una cadena pesada y una cadena ligera en donde dicha cadena pesada comprende una región variable que comprende la secuencia de aminoácidos:**Fórmula** con 0-5 sustituciones de aminoácidos en una o más posiciones distintas de la posición indicada por X1X2 y distintas de las regiones CDR; en donde X1 ≥ N y X2 ≥ A; X1 ≥ N y X2 ≥ T; X1 ≥ H y X2 ≥ G; X1 ≥ D y X2 ≥ G; o X1 ≥ H y X2 ≥ A; y dicha cadena ligera comprende la región variable de la cadena ligera O12/IgVκ 1-39 de la figura 23A con 0-5 sustituciones de aminoácidos.

PDF original: ES-2693596_T3.pdf

Vacuna peptídica de PCSK9.

(12/12/2018). Solicitante/s: AFFIRIS AG. Inventor/es: BRUNNER,SYLVIA, STAFFLER,GÜNTHER, BILCIKOVA,ERIKA, JUNO,CLAUDIA, LINZMAYER-HIRT,POLA, SCHUH,BIRGIT, GALABOVA,GERGANA, WINSAUER,GABRIELE.

Vacuna que comprende por lo menos un péptido seleccionado de entre el grupo SIPWSLERIT (SEC ID nº 21), VIPWNLERIL (SEC ID nº 55) y SVPWNLERIQ (SEC ID nº 60), en la que dicho por lo menos un péptido se acopla o fusiona con un portador farmacéuticamente aceptable.

PDF original: ES-2693572_T3.pdf

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(12/12/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Anticuerpo apto para unirse a cMet, o uno de sus fragmentos divalentes de unión a antígeno caracterizado por que el anticuerpo comprende una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 4, 5 y 6; y una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 13, 11 y 14.

PDF original: ES-2693542_T3.pdf

Síntesis de ent-progesterona e intermedios de la misma.

(10/12/2018). Solicitante/s: The Florida State University Research Foundation, Incorporated. Inventor/es: CRAN,JOHN W, HAN,YINGLIN, ZHANG,FALIANG.

Un procedimiento para preparar ent-progesterona que comprende la etapa de hacer reaccionar un compuesto de fórmula:**Fórmula** con un catalizador de rutenio y un agente oxidante para preparar ent-progesterona.

PDF original: ES-2693259_T3.pdf

Tratamientos para la fibrosis.

(05/12/2018). Solicitante/s: Singapore Health Services Pte Ltd. Inventor/es: COOK,STUART ALEXANDER, SCHAEFER,SEBASTIAN.

Un anticuerpo que es capaz de unirse a la interleucina 11 (IL-11) o al receptor α de IL-11 (IL-11Rα) y de inhibir la señalización mediada por IL-11, para su uso en un método de tratamiento o de prevención de la fibrosis en un ser humano.

PDF original: ES-2692773_T3.pdf

Nueva cepa del PRRSV europea.

(05/12/2018). Solicitante/s: BOEHRINGER INGELHEIM VETMEDICA GMBH. Inventor/es: ROOF, MICHAEL, B., OHLINGER, VOLKER, PESCH,STEFAN, ORVEILLON,FRANCOIS-XAVIER, BURGARD,KIM, KROLL,JEREMY, PIONTKOWSKI,MICHAEL DENNIS, UTLEY,PHILIP, VAUGHN,ERIC MARTIN, LAYTON,SARAH.

Una composición que comprende virus del síndrome reproductor y respiratorio porcino (PRRSV) de un tipo europeo, que es de la cepa depositada en la Colección Europea de Cultivos Celulares (ECACC) con el número de acceso ECACC 11012502.

PDF original: ES-2692809_T3.pdf

Método para tratar trastornos metabólicos.

(04/12/2018) Una composición que comprende un anticuerpo antagonista que se une a ActRIIB para uso en el tratamiento de un trastorno metabólico en un sujeto, en la que el anticuerpo anti-ActRIIB aumenta el tejido adiposo marrón sin aumentar los niveles de glóbulos rojos en dicho sujeto y en el que el anticuerpo anti-ActRIIB comprende una CDR1 de la región variable de la cadena pesada de la SEQ ID NO: 9; una CDR2 de la región variable de la cadena pesada de la SEQ ID NO: 23; una CDR3 de la región variable de la cadena pesada de la SEQ ID NO: 37; una CDR1 de la región variable de la cadena ligera de la SEQ ID NO: 51; una CDR2 de la región variable…

Composiciones para inhibición de quiescina sulfhidrilo oxidasa (QSOX1) y usos de las mismas.

(29/11/2018). Solicitante/s: YEDA RESEARCH AND DEVELOPMENT CO. LTD.. Inventor/es: FASS,DEBORAH, GROSSMAN,IRIS, ILANI,TAL, ALON,ASSAF.

Una cantidad terapéuticamente eficaz de un anticuerpo anti-QSOX1 que inhibe la actividad de QSOX1, para su uso en el tratamiento de un tumor o tumor sólido metastásico.

PDF original: ES-2691931_T3.pdf

Vacuna de toxinas bacterianas.

(29/11/2018) Una proteína híbrida que comprende dos proteínas toxinas seleccionadas del grupo que consiste en proteína toxina Shiga (Stx), proteína toxina del cólera (CT) y proteína toxina lábil al calor de Escherichia coli (LT), en donde dichas proteínas toxinas se unen en tándem a través de un péptido que tiene las siguientes características (A), (B), (C), (D), (E), y (F), y el péptido se añade al extremo carboxi de la proteína híbrida: (A) un número de aminoácidos es de 12 a 30, más preferiblemente de 12 a 22; (B) un contenido en prolina es del 20 al 35%, más preferiblemente del 20 al 27%; y (C) la prolina se distribuye cada dos o tres aminoácidos; (D) el contenido total de alanina, metionina y ácido glutámico en los aminoácidos diferentes…

Polipéptidos de enrollamiento al azar de prolina/alanina biosintéticos y sus usos.

(28/11/2018). Solicitante/s: XL-protein GmbH. Inventor/es: SKERRA, ARNE, SCHLAPSCHY,Martin, BINDER,ULI.

Conjugado de fármaco que comprende (i) un polipéptido de enrollamiento al azar biosintético o segmento de polipéptido que comprende una secuencia de aminoácidos que consiste únicamente en residuos de aminoácido de prolina y alanina, en el que dicha secuencia de aminoácidos consiste en al menos 50 residuos de aminoácido de prolina (Pro) y alanina (Ala), y (ii) un fármaco seleccionado del grupo que consiste en (a) una proteína biológicamente activa o un polipéptido que comprende o que es una secuencia de aminoácidos que tiene o media en una actividad biológica y (b) un fármaco de molécula pequeña.

PDF original: ES-2691642_T3.pdf

Anticuerpo anti-FOLR1.

(28/11/2018) Anticuerpo monoclonal o fragmento de anticuerpo del mismo que compite con un anticuerpo seleccionado de entre los (a) a (c) siguientes para reconocer específicamente el FOLR1 humano y que se une a un epítopo idéntico al epítopo sobre el FOLR1 humano al que se une el anticuerpo que se encuentra en las posiciones 55 a 62 en la secuencia de aminoácidos de FOLR1 humano representada por la SEC ID nº 1 y que muestra asimismo una actividad antitumoral: (a) un anticuerpo en el que las regiones determinantes de complementariedad (a las que se hace referencia en adelante como CDR) 1 a 3 de cadena pesada (a la que se hace referencia en adelante como cadena H) del anticuerpo comprenden las secuencias de aminoácidos representadas por las SEC ID…

Detección en tiempo real del virus de la gripe.

(28/11/2018) Un método de realización de un análisis de tendencia sobre la concentración de partículas del virus de la gripe en una pluralidad de muestras de fluido corporal obtenidas a partir de un sujeto, que comprende: a) recibir un cartucho en un conjunto lector, conteniendo dicho cartucho una muestra de fluido corporal y comprendiendo un conjunto de inmunoensayo, conteniendo dicho conjunto de inmunoensayo un primer reactivo de anticuerpo para inmunoensayo y un segundo reactivo de anticuerpo para inmunoensayo, y comprendiendo dicho conjunto lector un conjunto de detección; b) permitir que dicha muestra de fluido corporal que se sospecha que contiene una partícula del virus de la gripe reaccione con dicho primer reactivo de anticuerpo para inmunoensayo y dicho segundo reactivo de anticuerpo para inmunoensayo, en donde dicho…

Vacunación por medio de levadura recombinante mediante generación de una respuesta inmunitaria humoral protectora contra antígenos definidos.

(22/11/2018). Solicitante/s: Martin-Luther-Universität Halle-Wittenberg. Inventor/es: BEHRENS, SVEN-ERIK, BREUNIG,KARIN.

Levadura recombinante de la especie Kluyveromyces lactis, que como gen exógeno porta un gen, que codifica para un antígeno VP2 del virus de la bursitis infecciosa (IBDV), que está integrado en el genoma de la levadura, y que permite la expresión del antígeno VP2 del virus de la bursitis infecciosa (IBDV) como proteína exógena, caracterizada por que esta cepa de Kluyveromyces lactis se selecciona de: Kluyveromyces lactis DSM 25405, Kluyveromyces lactis DSM 25406, y Kluyveromyces lactis DSM 25407.

PDF original: ES-2690792_T3.pdf

Composiciones inmunogénicas.

(21/11/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS S.A.. Inventor/es: GRANDI, GUIDO, MARGARIT Y ROS, IMMACULADA, CONTORNI,MARIO, Maione,Domenico.

Una composición inmunogénica que comprende i) un conjugado que es un sacárido capsular del serotipo Ia del Estreptococo del Grupo B (GBS) conjugado con una proteína transportadora, ii) un conjugado que es un sacárido capsular del serotipo Ib del GBS conjugado con una proteína transportadora, iii) un conjugado que es un sacárido capsular del serotipo III del GBS conjugado con una proteína transportadora, iv) un toxoide diftérico, v) un toxoide tetánico y vi) un antígeno acelular de la tosferina y opcionalmente vii) un antígeno de poliovirus inactivado, en donde el iv) toxoide diftérico y v) toxoide tetánico no están conjugados.

PDF original: ES-2690526_T3.pdf

Anticuerpos monoclonales anti-VAP-1 completamente humanos.

(20/11/2018). Solicitante/s: BIOTIE THERAPIES LTD. Inventor/es: SMITH, DAVID JOHN, VAINIO, PETRI, MIKKOLA,JARI, VUORIO,PÄIVI, VAINIO,JANI.

Un anticuerpo anti-VAP-1 o un fragmento de unión a VAP-1 del mismo, caracterizado porque es completamente humano y comprende i) tres CDR de polipéptido de cadena pesada representados en los SEQ ID NOs: 4 , 9 y 14, respectivamente, y tres CDR de polipéptido de cadena ligera representados en los SEQ ID NO: 27, 32 y 37, respectivamente; en donde el anticuerpo anti-VAP-1 o un fragmento de unión a VAP-1 del mismo tiene una KD inferior a la de un anticuerpo anti-VAP-1 quimérico denominado BTT-1002, habiéndose estimado KD con un ensayo de resonancia de plasmón superficial de Biacore.

PDF original: ES-2690307_T3.pdf

Nuevos epítopos inmunogénicos para inmunoterapia.

(16/11/2018). Solicitante/s: IMMATICS BIOTECHNOLOGIES GMBH. Inventor/es: WEINSCHENK,TONI, SINGH,HARPREET, WALTER,STEFFEN, LEWANDROWSKI,PETER, Trautwein,Claudia, SCHOOR,OLIVER, HILF,NORBERT.

Péptido seleccionado del grupo consistente en a) péptido consistente en la secuencia de aminoácidos conforme a SEQ ID N.º 16 (SLDPSSPQV), en que dicho péptido induce la reacción cruzada de linfocitos T con el citado péptido, b) el péptido de a), el cual incluye enlaces no peptídicos; y c) el péptido de a), en que dicho péptido forma parte de una proteína de fusión provista con los 80 aminoácidos N-terminales de la cadena invariable (Ii) asociada al antígeno HLA-DR.

PDF original: ES-2689851_T3.pdf

Nuevos epítopos inmunogénicos para inmunoterapia.

(15/11/2018). Solicitante/s: IMMATICS BIOTECHNOLOGIES GMBH. Inventor/es: WEINSCHENK,TONI, SINGH,HARPREET, WALTER,STEFFEN, LEWANDROWSKI,PETER, Trautwein,Claudia, SCHOOR,OLIVER, HILF,NORBERT.

Péptido que comprende una secuencia según la SEQ ID N.º 1, el cual induce la reacción cruzada de linfocitos T con dicho péptido, y en que dicho péptido tiene una longitud total de entre 9 y 16 aminoácidos, o un péptido mimético retroinverso del mismo.

PDF original: ES-2689725_T3.pdf

Vacuna de virus Sendai modificado y vector para la obtención de imágenes.

(15/11/2018). Solicitante/s: St. Jude Children's Research. Inventor/es: HURWITZ,JULIA LEA, TAKIMOTO,TORU, RUSSELL,CHARLES JOHN, PORTNER,ALLEN, SLOBOD,KAREN S.

Un vector de virus Sendai recombinante que comprende un vector de virus Sendai modificado, comprendiendo el vector de Sendai modificado: la secuencia polipeptídica de NP del virus Sendai SEQ ID NO: 5, la secuencia polipeptídica de P del virus Sendai SEQ ID NO: 7, la secuencia polipeptídica de M del virus Sendai SEQ ID NO: 11, la secuencia polipeptídica de F del virus Sendai SEQ ID NO: 13, 10 la secuencia polipeptídica de HN del virus Sendai SEQ ID NO: 15, y la secuencia polipeptídica de L del virus Sendai SEQ ID NO: 17.

PDF original: ES-2689797_T3.pdf

Formulaciones de vacunas particuladas.

(15/11/2018). Solicitante/s: PDS Biotechnology Corporation. Inventor/es: JACOBSON,ERIC, CONN,GREGORY, BEDU-ADDO,FRANK, MERCER,CAROL, JOHNSON,KENYA.

Formulación de vacuna que comprende una partícula de adyuvante de lípido catiónico y un ensamblaje de antígeno de proteína o péptido particulado de autoformación, en la que el ensamblaje de antígeno comprende una estructura micelar y en la que la estructura micelar se forma uniendo una molécula hidrófoba o secuencia a un residuo de aminoácido N-terminal de un antígeno de proteína o péptido a través de un enlazador.

PDF original: ES-2689799_T3.pdf

La terapia anti-EMP2 reduce las células madre cancerosas.

(13/11/2018) Un anticuerpo para uso en la reducción de células madre cancerosas que expresan EMP2 en un paciente que tiene cáncer y que se ha identificado previamente que comprende células madre cancerosas que expresan EMP2 y uno o más marcadores seleccionados del grupo que consiste en CD44, CD 133 ABCG2 y ALDH, en donde: a) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos: MAQVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAVYYCARDRRGRKSAGIDYWGQGTLVTVSS, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula** b) el anticuerpo comprende una cadena…

Terapia de combinación.

(13/11/2018). Solicitante/s: Biosceptre (Aust) Pty Ltd. Inventor/es: GIDLEY-BAIRD,ANGUS, BARDEN,JULIAN,ALEXANDER.

Un receptor P2X7 o fragmento del mismo para su uso en la inhibición de la progresión del cáncer en un individuo, en donde el individuo ha recibido un sitio de unión antigénico no propio para el tratamiento del cáncer, donde el fragmento de un receptor P2X7 es capaz de inducir una respuesta inmune frente a un receptor P2X7, y que incluye una secuencia de aminoácidos seleccionada del grupo que consiste en SEQ ID NO: 2, 3 y 4.

PDF original: ES-2689272_T3.pdf

Vacuna conjugada de péptido antigénico de WT1.

(07/11/2018) Un compuesto representado por la fórmula :**Fórmula** en donde Xa e Ya son cada uno un enlace sencillo, el péptido antigénico canceroso A es un péptido que consiste en cualquier secuencia de aminoácidos seleccionada entre las siguientes secuencias de aminoácidos: RMFPNAPYL (SEQ ID NO: 2), ALLPAVPSL (SEQ ID NO: 5), SLGEQQYSV (SEQ ID NO: 6) y RVPGVAPTL (SEQ ID NO: 7), un grupo amino de un aminoácido N-terminal del péptido antigénico canceroso A se une a Ya en la fórmula , y un grupo carbonilo de un aminoácido C-terminal del péptido antigénico canceroso A se une a un grupo hidroxilo en la fórmula , R1 es un péptido antigénico canceroso C, el péptido antigénico C tiene una secuencia diferente de la del péptido antigénico…

Composiciones antigénicas y métodos para el virus respiratorio sincicial.

(07/11/2018) Una película de polielectrolitos multicapa depositada sobre una micropartícula núcleo o una nanopartícula núcleo, o en forma de una microcápsula hueca o una nanocápsula hueca, en donde dicha película multicapa comprende un epítopo de la proteína M2 de RSV y un epítopo de la proteína G de RSV, consistiendo dichos epítopos en 3 a 120 aminoácidos, como parte de uno o más polipéptidos diseñados, en donde un polipéptido diseñado es un polipéptido que consiste en una o más regiones de absorción a superficie cargadas de al menos 8 aminoácidos unidos covalentemente al epítopo de la proteína M2 de RSV, el epítopo de la proteína G de RSV, o ambos, que tienen carga suficiente para la unión estable a una superficie cargada de forma opuesta, y en donde el polipéptido diseñado y las una o más regiones…

1 · · 3 · 6 · 11 · 22 · ››