CIP 2015 : A61K 38/04 : Péptidos que tienen hasta 20 aminoácidos en una secuencia totalmente determinada;

Sus derivados (gastrinas A61K 38/16, somatostatinas A61K 38/31, melanotropinas A61K 38/34).

CIP2015AA61A61KA61K 38/00A61K 38/04[1] › Péptidos que tienen hasta 20 aminoácidos en una secuencia totalmente determinada; Sus derivados (gastrinas A61K 38/16, somatostatinas A61K 38/31, melanotropinas A61K 38/34).

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).

A61K 38/04 · Péptidos que tienen hasta 20 aminoácidos en una secuencia totalmente determinada; Sus derivados (gastrinas A61K 38/16, somatostatinas A61K 38/31, melanotropinas A61K 38/34).

CIP2015: Invenciones publicadas en esta sección.

Uso del péptido qbp1 para la prevención o el tratamiento del trastorno del estrés postraumático, el síndrome de estrés agudo y/o el síndrome de adaptación general.

(08/04/2020). Solicitante/s: CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS. Inventor/es: CARRION VAZQUEZ,MARIANO SIXTO, HERVÁS MILÁN,RUBÉN.

Una composición que comprende un péptido que consiste en una secuencia de aminoácidos con al menos un 70% de identidad con la SEQ ID NO: 1, o que consiste en SEQ ID NO: 1 o SEQ ID NO: 2, para su uso en la prevención o tratamiento del Trastorno de Estrés Postraumático, el Síndrome del Estrés Agudo y/o el Síndrome de Adaptación General.

PDF original: ES-2800073_T3.pdf

Péptidos capaces de reactivar mutantes de p53.

(18/03/2020). Solicitante/s: YEDA RESEARCH AND DEVELOPMENT CO. LTD.. Inventor/es: ROTTER,VARDA, OREN,MOSHE, TAL,PERRY.

Un péptido recombinante o sintético que comprende una secuencia de aminoácidos expuesta en la SEQ ID NO: 314, en donde dicho péptido reactiva al menos parcialmente una proteína mutante p53 in vitro; y en donde dicho péptido tiene una longitud de 6-15 aminoácidos.

PDF original: ES-2795982_T3.pdf

Péptidos de diseño corto que poseen acciones selectivas contra bacterias y células cancerosas.

(26/02/2020). Solicitante/s: THE UNIVERSITY OF MANCHESTER. Inventor/es: LU,JIAN R, ZHAO,XIUBO, PAN,FANG, YASEEN,MOHAMMED.

Un péptido con la fórmula I o II que se muestra a continuación **(Ver fórmula)** en donde: A1v se selecciona de G, GKI o GIK en donde G es glicina, K es lisina e I es isoleucina; A2w es II o VV, en donde I es isoleucina y V es valina; A3x es KK u OO en donde K es lisina y O es ornitina; y es 2, 3, o 4; A4 está ausente o es un aminoácido que se selecciona de isoleucina (I), leucina (L), valina (V) y lisina (K); z es 0, 1, 2 o 3; R1 es un sustituyente terminal que se selecciona de OH, NH2, (1-18C)alquilo, N[(1-18C) alquilo]2 o NH(1- 18C)alquilo; y R2 y R3 ambos se seleccionan independientemente de H, (1-18C)alquilo o (2-18C)acilo; o una sal de este; en donde el péptido comprende de 12 a 20 aminoácidos.

PDF original: ES-2776992_T3.pdf

Compuestos para su uso en el tratamiento y/o prevención de una infección de mycoplasma sp.

(31/01/2020). Solicitante/s: CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS (CSIC). Inventor/es: QUEROL MURILLO,ENRIQUE, PINOL RIBAS,Jaume, FITA RODRIGUEZ,Ignacio, APARICIO ALARCON,David, TORRES PUIG,Sergi, QUIJADA PICH,Oscar.

Compuestos para su uso en el tratamiento y/o prevención de una infección de mycoplasma sp. La presente invención hace referencia a compuestos con capacidad para inhibir la adhesión celular de Mycoplasma sp. a la célula hospedadora para su uso en el tratamiento y/o prevención de una infección de Mycoplasma sp. o una enfermedad asociada a una infección de Mycoplasma sp. en un sujeto, que incluye análogos de olisacáridos sialilados, péptidos que comprenden la secuencia Ser-Phe-ser y/o la secuencia Pro-Ser-Pro-Asn (SEQ ID NO: 2) y anticuerpos contra dichos péptidos. La presente invención también proporciona un método para el cribado de compuestos útiles en el tratamiento y/o prevención de una infección por Mycoplasma sp., en particular, M. genitalium.

PDF original: ES-2739434_A1.pdf

Composiciones para unir módulos de dedos de cinc.

(15/01/2020) Una proteína de dedos de cinc de múltiples dedos que se une específicamente a un sitio diana, comprendiendo la proteína de dedos de cinc de múltiples dedos módulos de dedos de cinc de origen no natural, en donde cada módulo de dedos de cinc se une a un subsitio diana y al menos dos de los módulos de unión a ADN de dedos de cinc de origen no natural que se unen a subsitios diana separados por 1 o 2 pares de bases se unen mediante una secuencia de enlazador de aminoácidos de 5 a 20 restos de aminoácidos entre el último resto del módulo de dedos de cinc N-terminal y el primer resto del módulo de dedos de cinc C-terminal, comprendiendo el enlazador de aminoácidos un resto de aminoácido N-terminal adyacente al módulo de dedos de cinc N-terminal, un resto de aminoácido C-terminal adyacente…

Análogos de compstatina de acción prolongada y composiciones y métodos relacionados.

(08/01/2020) Un análogo de compstatina de acción prolongada que comprende un resto reductor de la eliminación unido con dos restos análogos de compstatina, en donde cada resto análogo de compstatina comprende un péptido cíclico extendido por un residuo de lisina o una secuencia que comprende un residuo de lisina en el extremo N, extremo C o ambos, en donde el residuo de lisina está separado de la parte cíclica del péptido por un espaciador rígido o flexible que comprende un resto de oligo(etilenglicol); el resto reductor de la eliminación comprende un polímero, en donde cada extremo del polímero está unido con uno de los restos análogos de compstatina por medio de un carbamato o una amida; y el espaciador comprende ácido 8-amino-3,6-dioxaoctanoico (AEEAc) o ácido 11-amino-3,6,9-trioxaundecanoico. …

Péptidos, dispositivos y procedimientos para la detección de anticuerpos de Anaplasma.

(20/11/2019) Una composición que comprende una población de péptidos aislados, comprendiendo dicha población tres o más péptidos diferentes, en la que cada péptido en la población comprende una secuencia de: (i) SEQ ID NO: 3, en la que X5 es un aminoácido seleccionado del grupo que consiste en V o A, X7 es un aminoácido seleccionado del grupo que consiste en G, I o H, X11 es un aminoácido seleccionado del grupo que consiste en E, N o Q, X18 es un aminoácido seleccionado del grupo que consiste en D o N, X21 es un aminoácido seleccionado del grupo que consiste en R, D o N, X25 es un aminoácido seleccionado del grupo que consiste en Q, D o E, X28 es un aminoácido seleccionado del grupo que consiste en E o N, X31 es un aminoácido seleccionado del grupo que consiste en L o V, X45 es un aminoácido seleccionado del…

Terapias de antibióticos peptídicos derivados del búfalo de agua.

(20/11/2019). Solicitante/s: Centaur, Inc. Inventor/es: GARCIA,LUIS TONATIUH MELGAREJO, LINDE,ANNIKA, LUSHINGTON,GERALD HENRY.

Una composición antibiótica que comprende un péptido antibiótico, en donde el péptido comprende una secuencia aminoacídica sintética que tiene la secuencia de SEQ ID NO: 4103: Gly-X1-X2-X3-X1-X1-X1-Arg-X4-X1-X5-X6-X6-Gly en donde X1 se selecciona del grupo de Leu o Ile, X2 se selecciona del grupo de Ala, Val, Leu o Ile, X3 se selecciona del grupo de Arg o Trp, X4 se selecciona del grupo de Trp, Ile o Leu X5 se selecciona del grupo de Phe o Trp, y X6 se selecciona del grupo de Phe, Trp o Arg.

PDF original: ES-2770705_T3.pdf

Composiciones y métodos para mejorar las respuestas inmunitarias a Eimeria.

(02/10/2019). Solicitante/s: THE BOARD OF TRUSTEES OF THE UNIVERSITY OF ARKANSAS. Inventor/es: KWON YOUNG-MIN, BOTTJE,WALTER, HARGIS,BILLY, BERGHMAN,LUC, COLE,KIMBERLY, COX,MANDY, LAYTON,SHERRYLL, EL-ASHRAM,SAEED, BARTA,JOHN, TELLEZ,GUILLERMO.

Una vacuna, que comprende una primera secuencia de polinucleótidos, que codifica un polipéptido TRAP o un fragmento inmunogénico del mismo, en donde el primer polinucleótido codifica un polipéptido TRAP, que se selecciona de la SEQ ID NO: 1, la SEQ ID NO: 3, y un fragmento inmunogénico de la SEQ ID NO:3.

PDF original: ES-2761693_T3.pdf

Nuevos péptidos y nueva combinación de péptidos para su uso en inmunoterapia contra el carcinoma hepatocelular (CHC) y otros tipos de cáncer.

(25/09/2019). Solicitante/s: IMMATICS BIOTECHNOLOGIES GMBH. Inventor/es: WEINSCHENK,TONI, FRITSCHE,JENS, MAHR,ANDREA, MÜLLER,PHILLIP, WIEBE,ANITA, MISSEL,SARAH.

Un péptido que comprende la secuencia de aminoácidos de SEQ ID NO. 53, y una sal farmacéuticamente aceptable del mismo, en que dicho péptido tiene una longitud total de 10 a 30 aminoácidos, en que dicho péptido tiene la capacidad de unirse a una molécula del complejo mayor de histocompatibilidad humano (MHC) de clase I, y en el que dicho péptido, cuando está unido al MHC, se puede reconocer por linfocitos T CD8.

PDF original: ES-2763911_T3.pdf

Administración intraarticular de pepstatina para la artrosis.

(28/08/2019). Solicitante/s: MERCK PATENT GMBH. Inventor/es: KLEIN,MARKUS, GUEHRING,HANS, LINDEMANN,SVEN, WODOPIA,RALF.

Preparación farmacéutica que contenga pepstatina y/o una de sus sales, solvatos y estereoisómeros fisiológicamente compatibles, incluidas sus mezclas en todas las proporciones, y otros vehículos y/o excipientes, para su uso como medicamento en el tratamiento y/o la profilaxis de estados fisiológicos y/o patofisiológicos seleccionados del grupo compuesto por artrosis, lesiones condrales traumáticas, artritis, dolor, alodinia o hiperalgesia, en los que la preparación farmacéutica se administra por vía intraarticular de la siguiente manera: a) desde semanalmente hasta anualmente, b) desde cada 14 días hasta semestralmente o c) desde mensualmente hasta trimestralmente.

PDF original: ES-2759060_T3.pdf

Tratamiento de biopelículas.

(21/08/2019) Un péptido lítico o peptidomimético lítico, en donde dicho péptido o peptidomimético a) tiene una carga neta de al menos más 2; b) tiene una longitud de 3 a 5 aminoácidos o es un peptidomimético de tamaño equivalente; c) es de naturaleza anfipática, teniendo uno o más grupos lipófilos, comprendiendo uno de dichos grupos lipófilos al menos 7 átomos no de hidrógeno, y en donde (i) dicho péptido lítico o peptidomimético lítico tiene 3 aminoácidos de longitud, en donde, en cualquier orden, 2 de dichos aminoácidos son aminoácidos catiónicos, y 1 de dichos aminoácidos es un aminoácido con un grupo R lipófilo, teniendo el grupo R, 14-27 átomos no de hidrógeno y conteniendo 2 o más grupos cíclicos que pueden estar fusionados o…

Compuestos citotóxicos y antimitóticos, y métodos de uso de los mismos.

(05/06/2019) Un compuesto que tiene la siguiente estructura (I):**Fórmula** o un estereoisómero o sal farmacéuticamente aceptable del mismo, donde: R1 y R2 se seleccionan independientemente de entre el grupo que consiste en: H y alquilo C1-6; o R2 y R5 se fusionan y forman un anillo; R3 y R4 se seleccionan independientemente de entre el grupo que consiste en: H y R; o R3 y R4 se unen para formar un anillo; R5 se selecciona de entre el grupo que consiste en: alquilo opcionalmente sustituido, alquilamino opcionalmente sustituido, cicloalquilo opcionalmente sustituido, arilo opcionalmente sustituido, heterociclilo opcionalmente sustituido y heteroarilo opcionalmente sustituido; o R5 y R2 se fusionan y forman un anillo; R6 es H; R7 y R8 se…

Péptidos y nanopartículas para el suministro intracelular de moléculas.

(01/05/2019). Solicitante/s: AADIGEN, LLC. Inventor/es: DESAI,Neil, DIVITA,GILLES.

Un péptido de origen no natural que comprende una secuencia de aminoácidos X1KWRSX2X3X4RWRLWRX5X6X7X8SR (SEQ ID NO: 1), en donde a) X1 es cualquier aminoácido o está ausente y en donde X2-X8 son cualquier aminoácido; o b) X1 es ßA, S o está ausente, X2 es A o V, X3 es G o L, X4 es W o Y, X5 es V o S, X6 es R, V o A, X7 es S o L y X8 es W o Y, opcionalmente en donde el péptido tiene 19 o 20 aminoácidos de longitud.

PDF original: ES-2743188_T3.pdf

Nuevo antígeno de cáncer EEF2.

(17/04/2019). Solicitante/s: INTERNATIONAL INSTITUTE OF CANCER IMMUNOLOGY, INC.. Inventor/es: SUGIYAMA, HARUO, OJI,Yusuke.

Una composición farmacéutica para su uso en el tratamiento o prevención de cánceres en un sujeto positivo para HLA-A*2402, en donde dicha composición farmacéutica comprende un péptido eEF2 que consiste en una secuencia de aminoácidos compuesta por aminoácidos contiguos derivados de una proteína eEF2, en donde la secuencia de aminoácidos se selecciona entre: (a) Ala Tyr Leu Pro Val Asn Glu Ser Phe(SEQ ID NO:7); y (b) una secuencia de aminoácidos que tiene una sustitución del aminoácido Tyr en la posición 2 por Phe, y/o una sustitución del aminoácido Phe en la posición 9 por Ile o Leu. en la secuencia de aminoácidos tal como se muestra en (a).

PDF original: ES-2728998_T3.pdf

Método para tratar trastornos asociados con el receptor de melanocortina-4 en portadores heterocigotos.

(03/04/2019). Solicitante/s: Rhythm Pharmaceuticals, Inc. Inventor/es: HENDERSON,BART, TARTAGLIA,LOUIS A.

Una composición para su uso en un método de tratamiento de un trastorno en un sujeto que lo necesite, en donde el método comprende administrar a dicho sujeto una cantidad eficaz de Ac-Arg-c(Cys-D-Ala-His-D-Phe-Arg-Trp- Cys)-NH2 (SEQ ID NO: 140) o una sal farmacéuticamente aceptable del mismo; en donde el anticuerpo es un portador heterocigoto de una mutación de MC4R.

PDF original: ES-2732077_T3.pdf

Péptidos derivados de neuropéptidos y.

(27/03/2019) Un péptido derivado del neuropéptido Y (NPY) (SEQ ID NO: 22), donde dicho péptido se selecciona del grupo que consiste en: un péptido que consiste en 32 residuos de aminoácidos contiguos que tienen la secuencia KPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY4-35, SEQ ID NO: 2) o KPDNPGEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos, un péptido que consiste en 27 residuos de aminoácidos contiguos que tienen la secuencia GEDAPAEDMARYYSALRHYINLITRQR (NPY9-35, SEQ ID NO: 7) o GEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos, un péptido que consiste en 26 residuos de aminoácidos contiguos que tienen la secuencia EDAPAEDMARYYSALRHYINLITRQR (NPY10-35, SEQ ID NO: 8) o EDAPAEDMARYYSALRHYINLITRQR con…

Dispositivo de inhalación.

(27/03/2019). Solicitante/s: Xellia Pharmaceuticals ApS. Inventor/es: BENCIC,NENAD.

Un dispositivo de administración pulmonar, que comprende una unidad de boquilla de pulverización y un cartucho que contiene una solución acuosa que comprende de 80 a 400 mg A/mL de una polimixina sulfometilada.

PDF original: ES-2721401_T3.pdf

Péptidos de la familia RFamida y métodos relacionados.

(22/02/2019). Solicitante/s: THE REGENTS OF THE UNIVERSITY OF MICHIGAN. Inventor/es: NICHOLS,RUTHANN.

Un péptido aislado que comprende la secuencia de aminoácidos: L-P-L-A-Famida en donde, dicho péptido modula la función cardíaca en un vertebrado; o una sal, amida o éster del mismo.

PDF original: ES-2701452_T3.pdf

Tratamiento.

(19/02/2019). Solicitante/s: Yaqrit Limited. Inventor/es: JALAN,RAJIV, SHAH,NAINA.

Un antagonista del receptor de tipo Toll 4 (TLR4) para su uso en un método de tratamiento o prevención de disfunción renal en un individuo que tiene insuficiencia hepática crónica agudizada (ACLF).

PDF original: ES-2700783_T3.pdf

Compuestos de balanol para su uso en el tratamiento de dolor.

(17/01/2019) Uso de un agente que tiene la fórmula I**Fórmula** en la que n es 1, 2 o 3; Z es N o CH; en la que X representa uno de los siguientes grupos funcionales:**Fórmula** en la que Y representa uno de los siguientes grupos funcionales:**Fórmula** en la que A representa grupos arilo o heteroarilo no sustituidos o sustituidos con uno o más grupos alquilo inferior, alcoxi inferior, hidroxi, alcoxi, amino, alquilamino o halógeno, de manera que, donde A es un grupo arilo o heteroarilo**Fórmula** Cuando Y es:**Fórmula** A es:**Fórmula** y Cuando Y es:**Fórmula** A es:**Fórmula** en la que R es hidrógeno, alquilo inferior,o amidino; en la que R1, R2, R4, R5 es independientemente…

Composiciones y procedimientos de transfección de polinucleótidos.

(12/12/2018). Solicitante/s: WASHINGTON UNIVERSITY. Inventor/es: WICKLINE, SAMUEL, A., HOU,KIRK.

Una composición farmacéutica que comprende un complejo péptido-polinucleótido, comprendiendo el complejo péptido-polinucleótido una relación molar de péptido:polinucleótido que es más de aproximadamente 50:1 y menos de aproximadamente 200:1, en el que el péptido es (a) no citotóxico y capaz de afectar a la liberación de un polinucleótido desde un endosoma de una célula, y (b) comprende una secuencia de aminoácidos con al menos un 80 % de identidad con la secuencia de aminoácidos de SEQ ID NO: 1.

PDF original: ES-2693518_T3.pdf

Uso de hepcidina para preparar un medicamento para tratar trastornos de la homeostasis del hierro.

(07/12/2018). Solicitante/s: INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM). Inventor/es: KAHN,AXEL, NICOLAS,GAEL, VAULONT,SOPHIE.

Polipéptido para su uso en un procedimiento de tratamiento para reducir la sobrecarga de hierro, en el que el polipéptido comprende una secuencia de 20 aminoácidos que tiene: - al menos 50% de identidad con la secuencia SEQ ID NO: 1; - residuos de cisteína en las posiciones 2, 5, 6, 8, 9, 14, 17 y 18; y en donde el polipéptido es capaz de reducir la absorción de hierro.

PDF original: ES-2693050_T3.pdf

Agentes para mejorar la administración de fármacos.

(21/11/2018) Un péptido que comprende una secuencia de acuerdo con la Fórmula 2 X5-X6-X7-X8 Fórmula 2 (Id. de Sec. nº: 2) en la que: X5 es cualquier porción de aminoácido; X6 es Tyr; X7 es Gln; y X8 es Tyr, De acuerdo con algunas realizaciones: X5 es un residuo de aminoácido cargado positivamente; X6 es Tyr; X7 es Gln, y X8 es Tyr; o que comprende una secuencia de acuerdo con la Fórmula 1: X4-X5-X6-X7-X8 Fórmula 1 (Id. de Sec. nº: 1) en la que: X4 es un residuo de aminoácido cargado negativamente, por ejemplo pTyr, Asp o Glu; X5 es un residuo de aminoácido hidrófobo pequeño, por ejemplo Val o Ala; X6 es un residuo de aminoácido cargado positivamente, por ejemplo Lys o Arg; X7 es un residuo de aminoácido hidrófilo, por ejemplo, Tyr, Phe, Thr o Ser; y X8 es un residuo de aminoácido…

Péptidos permeables celulares inhibidores de la ruta de transducción de la señal JNK para su uso en el tratamiento de enfermedades oculares inflamatorias.

(30/10/2018). Solicitante/s: Xigen Inflammation Ltd. Inventor/es: ABADIE,CLAIRE, COMBETTE,JEAN-MARC, DELOCHE,CATHERINE.

(Poli)péptido quimérico que comprende un (poli)péptido inhibidor de JNK para su uso en el tratamiento de la inflamación intraocular después de una cirugía ocular o de un traumatismo ocular, comprendiendo o consistiendo el (poli)péptido quimérico en toda la secuencia de D-aminoácidos de SEQ ID Nº: 11, o en un fragmento o una variante de la misma que comparte una identidad de secuencia de al menos un 90% con toda la secuencia de D-aminoácidos de SEQ ID Nº: 11.

PDF original: ES-2688030_T3.pdf

Análogos de péptidos gip.

(15/10/2018) Un péptido seleccionado del grupo que consiste en EGTFISDYSIAMX0aX0bIX1QQDFVNWLLAQX2 (GIP3-30; SEQ ID NO: 74), GTFISDYSIAMX0aX0bIX1QQDFVNWLLAQX2 (GIP4-30; SEQ ID NO: 75), TFISDYSIAMX0aX0bIX1QQDFVNWLLAQX2 (GIP5-30; SEQ ID NO: 76), donde X0a, X0b, X1 y X2 son de forma individual cualquier aminoácido, o una variante funcional de estos que tiene al menos el 75 % de identidad de secuencia con dicho péptido, donde dicha variante es un antagonista del receptor de GIP humano, para el uso en un procedimiento para inhibir o reducir uno o más de i) secreción de glucagón inducida por GIP, ii) secreción de insulina inducida por GIP, iii) secreción de somatostatina inducida por GIP, iv) absorción de glucosa inducida por GIP, v) síntesis de ácidos grasos y/o incorporación de ácidos grasos…

Inhibidor de cinasas basado en péptidos de permeación celular.

(09/10/2018) Una composición inhibidora de cinasa para su uso en un método de tratamiento de un trastorno inflamatorio con una fisiopatología que comprende la expresión inflamatoria de citocinas, comprendiendo la composición: (a) una cantidad terapéuticamente eficaz de un péptido inhibidor terapéutico, en donde la cantidad terapéuticamente eficaz del péptido inhibidor terapéutico inhibe al menos una enzima cinasa; en donde el péptido inhibidor terapéutico comprende un primer dominio y un segundo dominio; en donde el primer dominio comprende un dominio de transducción de proteína y está situado proximal al segundo dominio,…

Péptidos catiónicos cíclicos con actividad antimicrobiana.

(26/09/2018) Péptido que consiste en una secuencia A-B-C-D-C'-B'-A', en donde: la unidad A consiste en 2 aminoácidos, y la unidad A' consiste en 1 aminoácido, ambas unidades B y B' son Cys, cada unidad C consiste independientemente en aminoácidos, seleccionados tanto del grupo (a) de aminoácidos hidrofóbicos, como del grupo (b) de aminoácidos básicos o aminoácidos formadores de enlaces de hidrógeno; la unidad D es -Arg-Gly-, en donde: (i) dichos aminoácidos hidrofóbicos se seleccionan de: Ala, Phe, Ileu, Leu, Pro, Tyr, Trp y Val; (ii) dichos aminoácidos básicos se seleccionan de: Lys, His, Arg; (iii) dichos aminoácidos formadores…

Ligandos de los receptores de la melanocortina.

(10/01/2018). Solicitante/s: IPSEN PHARMA. Inventor/es: DONG, ZHENG, XIN, MOREAU, JACQUES-PIERRE.

Un compuesto de acuerdo con la fórmula (I): (R2R3)-A1-c (A2-A3-A4-A5-A6-A7-A8-A9)-A10-R1 en donde A3 es D-Ala; A1 es D-Arg, Arg, hArg (homoarginina) o D-hArg; A2 es Cys o Asp; A4 es His; A5 es D-Phe o D-2-Nal (D-ß-(2-naftil)alanina); A6 es Arg; A7 es Trp; A8 está suprimido, Ala o Gaba (ácido 4-aminobutírico); A9 es Cys, Pen (penicillamina) o Lys; A10 está suprimido; en donde R1 es -NH2 o -OH; y R2 y R3 son, independientemente de cada aparición: H; o acilo seleccionado de acilo(C1-C30), aril(C1-C30)acilo, acilo(C1-C30) sustituido, o aril(C1-C30)acilo sustituido; con la condición que (I) cuando R2 es acilo(C1-C30), aril(C1-C30)acilo, acilo(C1-C30) sustituido o arilo(C1-C30)acilo sustituido, entonces R3 es H; (II) cuando A2 es Cys, entonces A9 es Cys o Pen; y (III) cuando A2 es Asp, entonces A9 es Lys; o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2663916_T3.pdf

Conjugados que contienen secuencias procedentes de factor de crecimiento placentario y su uso como componentes de biomateriales y en medicina.

(20/12/2017). Solicitante/s: ECOLE POLYTECHNIQUE FEDERALE DE LAUSANNE (EPFL). Inventor/es: HUBBELL, JEFFREY, A., MARTINO,MIKAËL, BRIQUEZ,PRISCILLA SUHASNA MAITHILI.

Un vehículo de aporte biológico que comprende una fusión molecular de un péptido y un agente biológico que comprende un primer dominio de unión a heparina, en donde el péptido comprende un segundo dominio de unión a heparina que comprende un péptido que comprende una secuencia elegida del grupo que consiste en SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 60, SEQ ID NO: 62, y subsecuencias de SEQ ID NO: 4 que tienen un truncamiento de no más de 7 residuos en un extremo N y/o un extremo C de SEQ ID NO: 4, exhibiendo dicho péptido unión específica a fibrinógeno.

PDF original: ES-2663230_T3.pdf

Péptidos derivados de eEF2 para el tratamiento o prevención de cánceres.

(15/11/2017). Solicitante/s: INTERNATIONAL INSTITUTE OF CANCER IMMUNOLOGY, INC.. Inventor/es: SUGIYAMA, HARUO, OJI,Yusuke.

Una composición farmacéutica para su uso en el tratamiento o prevención de cánceres en un sujeto positivo para HLA-A*0201, en donde dicha composición farmacéutica comprende un péptido eEF2 que consiste en una secuencia de aminoácidos compuesta por aminoácidos contiguos derivados de una proteína eEF2, en donde la secuencia de aminoácidos se selecciona entre: (a) Leu Ile Leu Asp Pro Ile Phe Lys Val (SEQ ID NO:14); y (b) la secuencia de aminoácidos Leu Ile Leu Asp Pro Ile Phe Lys Val (SEQ ID NO:14) que tiene una sustitución del aminoácido Ile en la posición 2 por Leu o Met, y/o una sustitución del aminoácido Val en la posición 9 por Leu.

PDF original: ES-2650337_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .