CIP 2015 : A61K 38/12 : Péptidos cíclicos.

CIP2015AA61A61KA61K 38/00A61K 38/12[2] › Péptidos cíclicos.

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).

A61K 38/12 · · Péptidos cíclicos.

CIP2015: Invenciones publicadas en esta sección.

Tratamiento de glucogenosis de tipo II.

(19/02/2019). Solicitante/s: DUKE UNIVERSITY. Inventor/es: CHEN,YUAN-TSONG.

α-Glucosidasa ácida (GAA) humana recombinante producida en un cultivo celular de ovario de hámster chino para uso en un método de tratamiento de la glucogenosis de tipo II en un ser humano que es CRIM-(material inmunológico de reacción cruzada)-negativo para la GAA endógena, en donde dicha α-glucosidasa ácida humana recombinante se administra en combinación con un régimen inmunosupresor o inmunoterapéutico, y en donde el régimen inmunosupresor o inmunoterapéutico se administra antes de la primera administración de dicha α- glucosidasa ácida humana recombinante.

PDF original: ES-2700865_T3.pdf

Tratamiento de cánceres y metástasis con suspensiones de Cilengitide en portador.

(16/01/2019) Composición farmacéutica para uso en el tratamiento del cáncer y metástasis del mismo en un sujeto humano, en donde dicha composición comprende a) 7 a 80 % de ciclo-(Arg-Gly-Asp-DPhe-NMeVal) sólido en una forma polimórfica que tiene una unidad cristalográfica con los parámetros reticulares a = 9,8 ± 0,1 Å, b = 19,5 ± 0,5 Å, 5 y c = 15,4 ± 0,1 Å, b) 0,01 a 60 % de uno o más compuestos anfifílicos que tienen un peso molar en el rango de 200 g/mol a 2000 g/mol y que comprenden un resto hidrófilo, en donde en dicho resto hidrófilo comprende un resto de etanolamina, un resto de colina, un resto fosfatidilo y/o un resto sulfatidilo, y/o una sal del mismo, y opcionalmente c) 0 a 89 % de agua, con la condición de que la suma de a), b) y c) sume hasta el 40 % o más de la composición total, y con la…

Composición de anidulafungina.

(21/12/2018). Solicitante/s: Selectchemie AG. Inventor/es: DOSER, KARLHEINZ, VAN BOVEN, MARINUS, YUAN,JIANDONG.

Procedimiento para preparar una formulación farmacéutica liofilizada que comprende las etapas de (i) preparar una disolución acuosa que comprende anidulafungina, un agente solubilizante, un agente estabilizante, un agente de carga, un amortiguador, y (ii) liofilizar la disolución de la etapa (i), en el que la anidulafungina se utiliza en forma de un polvo que no contiene partículas que presentan un tamaño superior a 400 μm.

PDF original: ES-2694561_T3.pdf

Composiciones de péptidos.

(13/12/2018) Un polipéptido aislado seleccionado de: Ac-Arg-ciclo[Cys-D-Ala-Asn-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 7); Ac-Arg-ciclo[Cys-D-Ala-Gln-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 8); Ac-Arg-ciclo[Cys-D-Ala-Pro-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 2); Ac-Arg-ciclo[hCys-D-Gln-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 51); Ac-Arg-ciclo[hCys-Ala-D-Phe-Arg-Trp-Pen]-NH2 (SEQ ID NO: 52); Ac-Arg-ciclo[Cys-Val-Gln-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 57); Ac-Arg-ciclo[Cys-D-Val-Gln-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 11); Ac-TzAla-ciclo[Cys-Ala-Gln-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 59); Ac-Arg-ciclo[Cys-D-Ala-Trp-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 9); Ac-Arg-ciclo[Cys-D-Ala-Tyr-D-Phe-Arg-Trp-Cys]-NH2 (SEQ ID NO: 39); Ac-Arg-ciclo[Cys-D-Ala-Pro-D-Phe(p-F)-Arg-Trp-Cys]-NH2…

Peptidomiméticos en horquilla beta.

(29/11/2018). Solicitante/s: Polyphor AG. Inventor/es: OBRECHT, DANIEL, LUTHER,ANATOL, BERNARDINI,FRANCESCA, ZBINDEN,PETER.

Un compuesto de la fórmula general (I), ciclo[P1-P2-P3-P4-P5-P6-P7-P8-P9-P10-P11-P12-T1-T2] (I) en donde los elementos individuales T o P están conectados en cualquier dirección desde el punto de anclaje del carbonilo (C≥O) al nitrógeno (N) del siguiente elemento y en donde T1 es DPro; T2 es Pro; o Pro((3S)OH); P1 es Leu; Ile; Val; Nva; o Trp; P2 es His; Trp; o Tyr; P3 es Leu; Cha; tBuGly; Trp; Tyr; o Tyr(Me); P4 es Dab; P5 es Orn; o Lys; P6 es Dab; DDab; o Pip; P7 es Dab; P8 es Trp; P9 es Hse; o Dab; P10 es tBuGly; Ile; Val; Nva; Cha; Chg; o Trp; P11 es Ala; Val; Alb; Ser; Asn; o Tyr; y P12 es Val; Ser; o aloThr; o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2691895_T3.pdf

Composiciones de lipopéptidos y métodos relacionados.

(17/10/2018). Solicitante/s: Cubist Pharmaceuticals LLC. Inventor/es: O\'CONNOR,SANDRA, SUN,SOPHIE, NAIK,GAAURI.

Una composición de daptomicina sólida, en donde dicha composición se prepara liofilizando una solución de daptomicina líquida acuosa que comprende al menos un excipiente seleccionado entre un azúcar y glicina, en donde dicha solución de daptomicina líquida acuosa tiene un pH de 6,5 a 7,5.

PDF original: ES-2686331_T3.pdf

Nueva variante de Streptomyces filamentosus y método para producir daptomicina utilizando dicha variante.

(10/10/2018). Solicitante/s: Dong Kook Pharm. Co., Ltd. Inventor/es: LEE,KANG-HEE, CHA,KYUNG-HOI, LEE,KYE WAN.

Cepa de streptomyces filamentosus con número de acceso KCTC12267BP, donde la cepa de streptomyces filamentosus tiene productividad de daptomicina.

PDF original: ES-2685645_T3.pdf

Ciclótidos como agentes inmunosupresores.

(16/05/2018). Solicitante/s: MEDIZINISCHE UNIVERSITAT WIEN. Inventor/es: GRUBER,CHRISTIAN WERNER, GRUENDEMANN,CARSTEN.

Una composición farmacéutica que comprende un ciclótido de tipo kalata B no injertado, siendo dicho ciclótido un péptido ciclado de cabeza a cola cuya cadena ciclotídica incluye seis restos de cisteína conservados capaces de formar tres enlaces disulfuro dispuestos en un motivo de nudo de cistina cíclica (CCK), para su uso en el tratamiento o en la prevención de un trastorno autoinmune o una inflamación mediada por linfocitos mediante inmunosupresión.

PDF original: ES-2677895_T3.pdf

Inhibidores macrocíclicos de la serina proteasa de la hepatitis C.

(02/05/2018). Solicitante/s: ENANTA PHARMACEUTICALS, INC. Inventor/es: OR, YAT SUN, SUN, YING, GRIEME, TIM, KEMPF, DALE J., GAI,YONGHUA, CHEN,HUI-JU, GRAMPOVNIK,DAVID,J, SHANLEY,JASON P, MCDANIEL,Keith,F, SHEIKH,Ahmad, MEI,JIANZHANG, KU,YIYIN, LIU,DONG, WAGAW,SABLE H, ENGSTROM,KEN.

Una composición farmacéutica, que comprende: (2R,6S,13aS,14aR,16aS,Z)-N-(ciclopropilsulfonil)-6-(5 -metilpirazino-2-carboxamido)-5,16-dioxo-2-(fenantridin-6- iloxi)-1,2,3,5,6,7,8,9,10,11,13a,14,14a,15,16,16a-hexadecahidrociclopropa[e]pirrolo[1,2- a][1,4]diazaciclopentadecino-14a-carboxamida o una sal aceptable farmacéuticamente de esta en combinación con un portador o excipiente aceptable farmacéuticamente; y (a) un agente antiviral o una sal aceptable farmacéuticamente de este; o (b) un inhibidor de la citocromo P450 monooxigenasa o una sal aceptable farmacéuticamente de este; en donde: el agente antiviral comprende uno o más inhibidores de un objetivo en el ciclo de vida del VHC seleccionado del grupo que consiste en helicasa, polimerasa, metaloproteasa, CD81, ciclofilina NS5A y el sitio interno de entrada al ribosoma; y el inhibidor de la citocromo P450 monooxigenasa es ritonavir.

PDF original: ES-2677644_T3.pdf

Péptidos de unión a FOXP3 y usos de los mismos.

(26/04/2018) Péptidos de unión a FOXP3 y usos de los mismos. La presente invención proporciona péptidos de fórmula general (I) y sales de los mismos, en los que: R1 y R2, tomados en conjunto, forman un conector birradicalario; y R2' es hidrógeno: o, alternativamente, R1 se selecciona entre hidrógeno -C(=O)-CH2-NH-C(=O)-(C1-C5)alquilo, y -C(=O)-(C1-C20)alquilo: uno de R2, y R2' es hidrógeno y el otro se selecciona entre -C(=O)NR3R4, y -C(=O)OH; y R3 y R4 son iguales o diferentes y se seleccionan entre hidrógeno y (C1-C10)alquilo. Estos péptidos son altamente eficaces para unirse e inhibir FoxP3, siendo eficaces en la inhibición y bloqueo…

Regulación de MELK para el tratamiento de cáncer de mama.

(11/04/2018). Solicitante/s: NOVARTIS AG. Inventor/es: HUANG,XIZHONG, ZHAO,JEAN J, MIN,JUNXIA, WANG,YUBAO.

Una cantidad eficaz de un inhibidor de MELK, comprendiendo el inhibidor de MELK un ARNhp que tiene una secuencia de nucleótidos diana de MELK seleccionada del grupo que consiste en SEQ. ID. NO: 1, SEQ. ID. NO: 2, SEQ. ID. NO: 3, SEQ. ID. NO: 4 y combinaciones de las mismas; para su uso en un sujeto en necesidad del mismo para inhibir el crecimiento o la proliferación de células de cáncer de mama; en la que las células de cáncer de mama son receptor de estrógeno (ER) negativo y receptor de progesterona (PR) negativo.

PDF original: ES-2669450_T3.pdf

Miméticos sintéticos de apelina para el tratamiento de la insuficiencia cardíaca.

(28/02/2018). Solicitante/s: NOVARTIS AG. Inventor/es: ZHAO, HONGJUAN, PARKER, DAVID, THOMAS, ZECRI,FREDERIC, GROSCHE,PHILIPP, YASOSHIMA,Kayo, IMASE,Hidetomo, HU,QI-YING, GOLOSOV,ANDREI.

Un polipéptido que tiene la siguiente fórmula II: X1-R-P-R-X5-X6-X7-X8-X9-P-X11-X12-X13 X1 está ausente o es pE, R, Q o Isn; X5 es L o Cha; X7 es H, Aib, F, K (Lauroílo) o K (Palmitoílo); X8 es K, F o 4-amino-Isn; X9 es G o Aib; X11 es Nle o Cha; X13 está ausente o es F, f, K (Lauroílo), K (Palmitoílo); X6 y X12 son independientemente un aminoácido natural o no natural seleccionado entre C, c, hC, D-hC, en los que las cadenas laterales de X6 y X12 están unidas entre sí a través de un enlace covalente formando un disulfuro; y en la que el extremo N y el extremo C forman opcionalmente un anillo junto con 1, 2, 3 o 4 aminoácidos glicina; o una amida, un éster o una sal del polipéptido; en la que Nle es L-norleucina; D-hC es D-homocisteína; hC es L-homocisteína; Aib es el ácido α-aminoisobutírico; Cha es (S)-ß-ciclohexilalanina; Isn es isonipecotinoílo; y pE es ácido L-piroglutámico.

PDF original: ES-2670832_T3.pdf

Aparato de perfusión extracorpórea.

(21/02/2018) Un aparato de perfusión extracorpóreo que comprende un circuito de sangre extracorpóreo para transportar sangre, un circuito de filtrado para transportar plasma sanguíneo, y un controlador , en el que el circuito de filtrado está conectado al circuito de sangre extracorpóreo por medio de un filtro , en el que el filtro tiene un coeficiente de cribado del 5% para sustancias que tienen una masa molar de 340.000 g/mol (masa molecular relativa de 340 kDa), y en el que un agente de agotamiento que comprende un primer portador (107a, 207a, 307a, 407a, 507a, 607a, 707a) que tiene una superficie no iónica, hidrófoba está dispuesto en el circuito de filtrado, caracterizado porque el aparato de perfusión comprende…

Inhibidores macrocíclicos de virus Flaviviridae.

(07/02/2018) Un compuesto de Fórmula I:**Fórmula** o una sal, un isótopo, un estereoisómero, una mezcla de estereoisómeros, un tautómero o un éster del mismo farmacéuticamente aceptables, en donde: A es un grupo alquileno (C1-C2); A1 es alquileno (C1-C5), alquenileno (C2-C5), alquinileno (C2-C5), arileno, heteroarileno, cicloalquileno, heterocicloalquileno, aril-alquileno (C1-C2), heteroarilalquileno (C1-C2), cicloalquilalquileno (C1-C2) o heterocicloalquilalquileno (C1-C2), en donde un átomo de carbono sp3 de A1 está opcionalmente reemplazado por -O-, -S(O)n-, -NH- o -N(alquilo (C1-C4))-, y en donde un átomo de carbono sp3 o sp2 de A1 está opcionalmente sustituido con uno o más grupos seleccionados entre el grupo que consiste…

4-Oxoquinolizinas antimicrobianas.

(20/12/2017) Una composición farmacéutica que comprende Polimixina B y un compuesto de 4-oxoquinolizina de fórmula IIIc: **(Ver fórmula)** o una sal farmacéuticamente aceptable del mismo, en la que R1 es hidrógeno, halógeno, ciano, alquilo C1-8, haloalquilo C1-8, -ORX, -N(RX)2, -C(O)RX, -C(O)ORX, o -C(O)N(RX)2, en la que cada RX es independientemente hidrógeno, alquilo C1-8, o haloalquilo C1-8; y Y es arilo, o heteroarilo, cada uno sustituido con uno a cinco grupos que son - N(RY1)2 o -alquil C1-8-RY donde RY es - N(RY1)2 y adicionalmente sustituido opcionalmente con uno a cuatro grupos que son cada uno independientemente halógeno, alquilo C1-8, haloalquilo C1-8, cicloalquilo C3-8, heterociclilo, arilo, heteroarilo,…

Procedimiento para la prevención y para el tratamiento de una hiperpermeabilidad.

(15/11/2017). Solicitante/s: APEPTICO FORSCHUNG UND ENTWICKLUNG GMBH. Inventor/es: FISCHER, BERNHARD, LUCAS,RUDOLF.

Péptido, que se compone de 7-17 aminoácidos adyacentes y que comprende el hexámero TX1EX2X3E, en donde X1, X2 y X3 pueden ser cualquier aminoácido natural o no natural, en donde el péptido no presenta actividad de unión de receptor de TNF y está ciclado, para la aplicación para la prevención de edemas mediante disminución de la hiperpermeabilidad, basándose en lesiones de las capas endotelial y epitelial.

PDF original: ES-2657445_T3.pdf

Agentes antifúngicos y sus usos.

(09/08/2017). Solicitante/s: CIDARA THERAPEUTICS, INC. Inventor/es: RADHAKRISHNAN,BALASINGHAM, JAMES,KENNETH DUKE JR, LAUDEMAN,CHRISTOPHER PATRICK, MALKAR,NAVDEEP BALKRISHNA.

Un compuesto que tiene la fórmula:**Fórmula** o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2645074_T3.pdf

Secado por pulverización de la vancomicina.

(02/08/2017). Solicitante/s: HOSPIRA, INC.. Inventor/es: FRAGALE,CYNTHIA, BRUECK,DANIEL.

Procedimiento para preparar una formulación farmacéutica de vancomicina en polvo para inyección, comprendiendo el procedimiento: proporcionar una disolución que comprende vancomicina HCl, polietilenglicol (PEG), y uno de entre manitol y amortiguador de citrato; y secar por pulverización la disolución para formar un polvo que se puede reconstituir y administrar mediante infusión IV.

PDF original: ES-2645769_T3.pdf

Secuencias y composiciones de péptidos.

(12/07/2017). Solicitante/s: PEPTCELL LIMITED. Inventor/es: CAPARROS-WANDERLEY,WILSON,ROMERO, STOLOFF,Gregory,Alan.

Una composición de vacuna contra la gripe, que comprende un polipéptido y opcionalmente un excipiente o adyuvante apropiado: en la que el polipéptido es SEQ ID1 o una o secuencia que tienen al menos 85% de homología con la secuencia de 32 aminoácidos de la SEQ ID 1: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP y en la que, el polipéptido es inmunogénico en un vertebrado que expresa un alelo del complejo de histocompatibilidad mayor (MHC), y es inmunogénico para una pluralidad de cepas del virus de la gripe.

PDF original: ES-2635590_T3.pdf

Terapia de combinación inyectable para trastornos oculares.

(28/06/2017) Primer y segundo agentes terapéuticos para su uso en el tratamiento de un trastorno ocular caracterizado por degeneración macular, neovascularización coroidal o neovascularización retiniana, en el que se administran cantidades eficaces del primer y el segundo agentes terapéuticos al ojo del sujeto, opcionalmente en un procedimiento individual; el primer agente terapéutico es un agente anti-VEGF seleccionado entre el grupo que consiste en anticuerpos o fragmentos de anticuerpo que se unen a VEGF, una proteína de fusión que contiene dominios extracelulares de dos receptores de VEGF conectados a la región Fc de un anticuerpo, y ácidos nucleicos que se unen a VEGF; y el segundo agente terapéutico se selecciona…

Combinaciones con un péptido de esqueleto ciclado.

(14/06/2017). Solicitante/s: Polyphor AG. Inventor/es: OBRECHT, DANIEL, DALE,GLENN E, BERNARDINI,FRANCESCA.

Una combinación que comprende un peptidomimético de horquilla-ß de fórmula cyclo(-Thr-Trp-Ile-Dab-Orn-DDab-Dab-Trp-Dab-Dab-Ala-Ser-DPro-Pro) (I), en donde Dab es ácido (S)-2,4-diaminobutanoico; DDab es ácido (R)-2,4-diaminobutanoico; Orn es ácido (S)-2,5-diaminopentanoico; y un compuesto adicional con una actividad antibiótica seleccionado entre ertapenemo, azitromicina, ciprofloxacina, o amikacina, o una sal farmacéuticamente aceptable de los mismos.

PDF original: ES-2640289_T3.pdf

Combinaciones con un péptido de esqueleto ciclado.

(31/05/2017). Solicitante/s: Polyphor AG. Inventor/es: OBRECHT, DANIEL, DALE,GLENN E, BERNARDINI,FRANCESCA.

Una combinación que comprende un peptidomimético de horquilla-ß de fórmula: ciclo(-Thr-Trp-Ile-Dab-Orn-DDab-Dab-Trp-Dab-Dab-Ala-Ser-DPro-Pro) (I), en la que Dab es ácido (S)-2,4-diaminobutanoico; DDab es ácido (R)-2,4-diaminobutanoico; Orn es ácido (S)-2,5-diaminopentanoico; y tigeciclina, o sus sales farmacéuticamente aceptables, o sus hidratos o solvatos.

PDF original: ES-2639165_T3.pdf

Derivados peptídicos, su preparación y sus usos como vectores.

(17/05/2017). Solicitante/s: Vect-Horus. Inventor/es: KHRESTCHATISKY,MICHEL, DAVID,MARION, MOLINO,YVES, VLIEGHE,PATRICK.

Péptido o seudopéptido, caracterizado por que responde a la siguiente fórmula general (I): A1-Met-A2-Arg-Leu-Arg-A3-Cys (I) en la que A1 indica cisteína (Cys) o uno de sus análogos o isósteros, A2 indica prolina (Pro) o uno de sus análogos o isósteros y A3 indica glicina (Gly) o uno de sus análogos o isósteros, siempre que el residuo A2 sea un análogo de prolina cuando el residuo A1 es una cisteína, y por que es capaz de unirse a un receptor humano de lipoproteínas de baja densidad (hLDLR).

PDF original: ES-2637265_T3.pdf

Análogos agonistas del receptor opioide mu de las endomorfinas.

(26/04/2017). Solicitante/s: THE ADMINISTRATORS OF THE TULANE EDUCATIONAL FUND. Inventor/es: ZADINA,JAMES E, HACKLER,LASZLO.

Un péptido cíclico de fórmula I: (I) H-Tyr-c[X1-X2-X3-X4]-X5, en la que X1 y X4 cada uno independientemente es un aminoácido ácido o un aminoácido básico; X2 es Trp; X3 es independientemente un aminoácido aromático; X5 es NHR, Ala-NHR, Arg-NHR, Asn-NHR, Asp-NHR, Cys-NHR, Glu-NHR, Gln-NHR, Gly-NHR, His-NHR, Ile- NHR, Leu-NHR, Met-NHR, Orn-NHR, Phe-NHR, Pro-NHR, Ser-NHR, Thr-NHR, Trp-NHR, Tyr-NHR, o Val- NHR, en la que R es H o un grupo alquilo; y existe un enlace amida entre un grupo amino y un grupo ácido carboxílico en las cadenas laterales de aminoácidos X1 y X4; con la condición de que cuando X1 es un aminoácido ácido, entonces X4 es un aminoácido básico; y cuando X1 es un aminoácido básico, entonces X4 es un aminoácido ácido.

PDF original: ES-2632787_T3.pdf

Composiciones farmacéuticas y métodos de suministro relacionados.

(22/03/2017). Solicitante/s: Chiasma Inc. Inventor/es: SALAMA,PAUL, MAMLUK,RONI, MAROM,KAREN, WEINSTEIN,IRINA, TZABARI,MOSHE.

Una composición que comprende una suspensión que comprende una mezcla de un medio hidrófobo y una forma sólida, en la que la forma sólida comprende una cantidad terapéuticamente eficaz de un agente terapéutico y al menos una sal de un ácido graso de cadena media, y en la que la sal de ácido graso de cadena media está presente en la composición en una cantidad de 10 % o más en peso, en donde el agente terapéutico es octreótido.

PDF original: ES-2629131_T3.pdf

Agonistas del receptor de guanilato ciclasa para el tratamiento de inflamación tisular y carcinogénesis.

(18/01/2017). Solicitante/s: SYNERGY PHARMACEUTICALS, INC. Inventor/es: JACOB, GARY, S., SHAILUBHAI,KUNWAR, NIKIFOROVICH,GREGORY.

Un péptido que consiste en SEC ID Nº: 20 cuyo péptido es un biciclo [4, 12; 7, 15] para su uso en terapia para potenciar la producción intracelular de GMPc.

PDF original: ES-2622468_T3.pdf

Composición tópica que comprende un agente antibacteriano.

(21/12/2016). Solicitante/s: Buzzz Pharmaceuticals Limited. Inventor/es: GREEN,DARREN M, WALTERS,KENNETH A.

Una composición farmacéutica apropiada para aplicación tópica al cuerpo, comprendiendo dicha composición daptomicina o una sal farmacéuticamente aceptable de la misma que se disuelve y/o suspende dentro de un vehículo oleoso, en el que la daptomicina o sal farmacéuticamente aceptable de la misma está presente en una cantidad de 0.01 % en peso a 10% en peso de la composición total, y en el que el contenido de humedad de la composición es menor que el 1% en peso.

PDF original: ES-2673275_T3.pdf

Derivados de carbamato de hexadecahidrociclopropa(e)pirrolo(1,2-a)(1,4)diazaciclopentadecinilo sustituidos con 9-metilo como inhibidores de la proteasa no estructural 3 (NS3) para el tratamiento de infecciones del virus de la hepatitis C.

(23/11/2016) Un compuesto seleccionado de: ((2R,6S,7R,9R,13aS,14aR,16aS,Z)-14a-(((1-(fluorometil)ciclopropil)sulfonil)carbamoil)-2-((3-(4-isopropoxifenil)-6-metoxiisoquinolin-1-il)oxi)-7,9-dimetil-5,16-dioxo-1,2,3,5,6,7,8,9,10,11,13a,14,14a,15,16,16a hexadecahidrociclopropa[e]pirrolo[1,2-a][1,4]diazaciclopentadecin-6-il)carbamato de (S)-3- (trifluorometil)tetrahidro-2H-piran-3-ilo; ((2R,6S,7R,9R,13aS,14aR,16aS,Z)-14a-(((1-(fluorometil)ciclopropil)sulfonil)carbamoil)-2-((3-(4-isopropoxifenil)-6- metoxiisoquinolin-1-il)oxi)-7,9-dimetil-5,16-dioxo-1,2,3,5,6,7,8,9,10,11,13a,14,14a,15,16,16a- hexadecahidrociclopropa[e]pirrolo[1,2-a][1,4]diazaciclopentadecin-6-il)carbamato…

Dicetopiperazinas para tratar la hiperpermeabilidad vascular.

(26/10/2016) Un principio activo que comprende una dicetopiperazina, o una sal farmacéuticamente aceptable de la misma, para su uso en la inhibición de la hiperpermeabilidad vascular en un animal que tiene una enfermedad o afección mediada por la hiperpermeabilidad vascular seleccionada entre el grupo que consiste en edema macular diabético, degeneración macular relacionada con la edad, edema miocárdico, fibrosis miocárdica, disfunción diastólica, miocardiopatía diabética, retraso del desarrollo de los pulmones en los fetos de madres diabéticas, hiperplasia vascular en el mesenterio, neuropatía diabética, nefropatía diabética, retinopatía…

Inhibidores del virus de la hepatitis C.

(19/10/2016) Un compuesto de formula (I):**Fórmula** o una sal farmaceuticamente aceptable del mismo, en la que p es 1 o 2; ---- es un enlace sencillo o doble; R1 se selecciona de**Fórmula** en las que R1 se une al resto de la molecula parental a traves de cualquier atomo de carbono sustituible en el grupo; m es 0, 1 o 2; n es 0, 1, 2, 3, 4, 5 o 6; X0 se selecciona de CH y N; X1 se selecciona de CH y N; X2 y X3 se selecciona independientemente de CH, C(Ra) y N; con la condicion de que al menos uno de X1, X2 y X3 sea distinto de N; Cada Ra se selecciona independientemente de alqueniloxi, alcoxi, alcoxialcoxi, alquilo, benzodioxanilo, carboxamido, carboxi, carboxialcoxi, ciano, cicloalquilalcoxi, cicloalquiloxi,…

Tratamiento de glucogenosis de tipo II.

(14/09/2016). Solicitante/s: DUKE UNIVERSITY. Inventor/es: CHEN,YUAN-TSONG.

α-Glucosidasa ácida (GAA) humana recombinante producida en un cultivo celular de ovario de hámster chino para uso en un método de tratamiento de la glucogenosis de tipo II en un ser humano, o en un método de tratamiento de la cardiomiopatía asociada con la glucogenosis de tipo II en un ser humano, donde el ser humano es CRIM-negativo para la α-glucosidasa ácida endógena y en donde dicha α-glucosidasa ácida humana recombinante se administra conjuntamente con un régimen inmunoterapéutico o inmunosupresor.

PDF original: ES-2599401_T3.pdf

1 · · 3 · 4 · 5 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015