CIP 2015 : G01N 33/574 : para el cáncer.

CIP2015GG01G01NG01N 33/00G01N 33/574[4] › para el cáncer.

Notas[t] desde G01 hasta G12: INSTRUMENTOS
Notas[n] desde G01N 33/52 hasta G01N 33/98:
  • En los grupos G01N 33/52 - G01N 33/98 se aplica la regla del último lugar, es decir, en cada nivel jerárquico, salvo que se indique lo contario, una invención se clasifica en el último lugar apropiado.

G SECCION G — FISICA.

G01 METROLOGIA; ENSAYOS.

G01N INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION DE SUS PROPIEDADES QUIMICAS O FISICAS (procedimientos de medida, de investigación o de análisis diferentes de los ensayos inmunológicos, en los que intervienen enzimas o microorganismos C12M, C12Q).

G01N 33/00 Investigación o análisis de materiales por métodos específicos no cubiertos por los grupos G01N 1/00 - G01N 31/00.

G01N 33/574 · · · · para el cáncer.

CIP2015: Invenciones publicadas en esta sección.

Biomarcadores para progresión de enfermedad en melanoma.

(02/01/2019). Solicitante/s: AMLO Biosciences Limited. Inventor/es: ELLIS,ROBERT, LABUS,MARIE, LOVAT,PENNY.

Un método in vitro para determinar si un sujeto con melanoma tiene un mayor riesgo de metástasis, el método comprende: (i) determinar la expresión de Ambra-1 y Loricrina en una muestra de tejido obtenida del sujeto, en donde la muestra de tejido comprende tejido que recubre un melanoma primario; y (ii) comparar la expresión obtenida en (i) con un tejido de referencia o los niveles obtenidos a partir del mismo, en donde una disminución en la expresión de Ambra-1 y Loricrina en la muestra de tejido en comparación con el tejido o los niveles de referencia, o una pérdida de expresión de Ambra-1 y Loricrina en la muestra de tejido, es indicativo de un mayor riesgo de metástasis.

PDF original: ES-2705614_T3.pdf

Análisis automatizado de células tumorales circulantes.

(02/01/2019) Un procedimiento de análisis de una muestra que contiene células tumorales circulantes (CTC) usando un instrumento automatizado, que comprende: depositar una muestra de un sujeto con cáncer de próstata sobre un sustrato configurado para su uso con el instrumento automatizado, fijar la muestra con formol al 0,4 % durante 1 a 5 minutos seguido de formol tamponado neutro (FTN) al 10 % durante 5 a 15 minutos y metanol durante 1 a 5 minutos, permeabilizar la muestra con Tween 20 al 0,2 % en solución salina tamponada con fosfato (PBS), retener al menos un 90 % de las CTC en la muestra sobre el sustrato tras la fijación y permeabilización, disponer el sustrato en el instrumento automatizado, recuperar las dianas de moléculas de proteína y ácido nucleico en la…

Estructuras para controlar la interacción de luz con dispositivos microfluídicos.

(28/12/2018) Un dispositivo fluídico que comprende: un artículo que incluye el primer y el segundo lados opuestos, donde el artículo es una única pieza integrada de material sin capas unidas; primeros y segundos segmentos de canal microfluídicos, cada uno integrado en el primer lado del artículo; y una parte intermedia que no forma un canal colocada entre los segmentos de canal microfluídicos primero y segundo, donde un primer elemento óptico está integrado con el segundo lado del artículo y está colocado entre los segmentos de canal primero y segundo y opuesto a la parte intermedia, y donde el primer elemento óptico está adaptado…

Smoothened mutante y métodos de uso de la misma.

(27/12/2018). Solicitante/s: GENENTECH, INC.. Inventor/es: DE SAUVAGE, FREDERIC, J., YAUCH,ROBERT,L, DIJKRAAF,GERRIT J.P, SHARPE,HAYLEY.

Una molécula de ácido nucleico aislada que codifica una proteína SMO mutante que comprende una secuencia de aminoácidos que es idéntica en al menos el 95 % a la SEQ ID NO: 1 en donde la secuencia de aminoácidos comprende un aminoácido distinto del triptófano en la posición de aminoácido que corresponde a la posición 281 de la SEQ ID NO: 1.

PDF original: ES-2694857_T3.pdf

Anticuerpos específicos del Tgf-1 y métodos y usos de los mismos.

(19/12/2018). Solicitante/s: Ludwig Institute for Cancer Research Limited. Inventor/es: BOON, THIERRY, VAN SNICK, JACQUES, UYTTENHOVE, CATHERINE.

Una molécula de anticuerpo aislado o fragmento del mismo que reconoce el factor de crecimiento transformante beta 1 (TGF-ß1) humano y de ratón, no reacciona con el TGF-ß2 o TGF-ß3, y neutraliza la actividad del TGF-ß1; y que comprende una región variable de cadena pesada que comprende las secuencias de dominio CDR CDR1 GYTFTNYW (SEQ ID NO: 11)_o GYTFTNYWMH (SEQ ID NO: 3), CDR2 IYPGNSDT (SEQ ID NO: 12) o TIYPGNSDTN (SEQ ID NO: 4)_ y CDR3 EDSRSLYYNGWDYFDY (SEQ ID NO: 5) y una región variable de cadena ligera que comprende las secuencias de dominio CDR CDR1 ESVDNYGISF (SEQ ID NO: 6), CDR2 YAAS (SEQ ID NO: 7) y CDR3 QQSKEVPRT (SEQ ID NO: 8).

PDF original: ES-2694203_T3.pdf

SONDAS DUALES PARA CITOMETRÍA DE FLUJO Y CITOMETRÍA DE MASAS.

(13/12/2018). Solicitante/s: UNIVERSIDAD DE GRANADA. Inventor/es: ORTE GUTIÉRREZ,Ángel, DÍAZ MOCHÓN,Juan José, SÁNCHEZ MARTÍN,Rosario María, DELGADO GONZÁLEZ,Antonio, VALERO GRIÑÁN,María Teresa, GARCÍA FERNÁNDEZ,Emilio.

La invención describe sondas basadas en nanopartículas entrecruzadas fluorescentes y funcionalizadas con metales que actúan como sondas duales, sirviendo tanto para la citometría de flujo (FACS) como la citometría de masas (CyTOF). Estas sondasse pueden aplicar para realizar codificación por código de barras de células vivas o para llevar a cabo estudios in vivo de diferentes linajes celulares a través de co-cultivos celulares.

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(12/12/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Anticuerpo apto para unirse a cMet, o uno de sus fragmentos divalentes de unión a antígeno caracterizado por que el anticuerpo comprende una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 4, 5 y 6; y una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 13, 11 y 14.

PDF original: ES-2693542_T3.pdf

Mutaciones en el dominio extracelular III del gen del receptor del factor de crecimiento epidérmico.

(07/12/2018). Solicitante/s: Fundació Institut Mar d'Investigacions Mèdiques (IMIM). Inventor/es: BARDELLI,ALBERTO, MONTAGUT VILADOT,CLARA, ALBANELL MESTRES,JOAN, ROVIRA GUERIN,ANA, BELLOSILLO PARICIO,BEATRIZ, DALMASES MASSEGÚ,ALBA, ARENA,SABRINA.

Una secuencia peptídica con una longitud de entre 17 y 100 aminoácidos y que comprende la secuencia SEQ ID NO: 13 X1SLKEISDGDVIIX4X5NX2, en la que X1 se selecciona entre R y C; X4 se selecciona entre S y L; X5 se selecciona entre G y R; X2 se selecciona entre K y T; y en la que al menos uno de X1, X4, X5 y X2 es, respectivamente, C, L, R o T.

PDF original: ES-2693080_T3.pdf

Métodos para determinar la probabilidad de supervivencia y para predecir la probabilidad de metástasis en el cáncer.

(05/12/2018) Un método (i) para identificar sujetos con cáncer HER2-positivo que deben ser objeto de cribado respecto a metástasis cerebral; (ii) para identificar pacientes con cáncer HER2-positivo que deben recibir tratamiento con un agente que actúe sobre HER2 y una segunda forma de tratamiento para el cáncer; (iii) para determinar el tiempo previsto hasta la aparición de metástasis cerebral (TTBM) en un sujeto con cáncer HER2-positivo; (iv) para determinar la probabilidad relativa de que un sujeto con un cáncer HER2- positivo tenga riesgo de desarrollar metástasis cerebral; y/o (v) para determinar si un sujeto con cáncer HER2-positivo forma parte de un subconjunto de sujetos con cáncer HER2-positivo que deben ser cribados respecto a metástasis cerebral, comprendiendo: …

Inhibidor de RET.

(04/12/2018). Solicitante/s: CHUGAI SEIYAKU KABUSHIKI KAISHA. Inventor/es: SAKAMOTO, HIROSHI, KODAMA,TATSUSHI, TSUKAGUCHI,TOSHIYUKI.

Un agente terapéutico y/o profiláctico para su uso en el tratamiento de un tumor con una mutación en RET y para su uso en el tratamiento de una metástasis del tumor, que comprende un compuesto representado por la fórmula (I), una sal del mismo o un solvato del mismo como ingrediente activo: **Fórmula** donde R1 es un grupo alquilo C1-6.

PDF original: ES-2692664_T3.pdf

Procedimiento de análisis de la prodefensina-A6 para el diagnóstico in vitro del cáncer colorrectal.

(03/12/2018). Solicitante/s: BIOMERIEUX. Inventor/es: CHOQUET-KASTYLEVSKY, GENEVIEVE, CHARRIER, JEAN-PHILIPPE, ATAMAN-ONAL,Yasemin, BEAULIEU,CORINNE, ROLLAND,DOMINIQUE, BUSSERET,SANDRINE.

Procedimiento de diagnóstico in vitro del cáncer colorrectal mediante la determinación del aumento de la concentración, con respecto a los valores de referencia determinados para los sujetos sanos, del marcador proteico Prodefensina-A6 en una muestra biológica procedente de un paciente sospechoso de estar afectado de cáncer colorrectal, que utiliza un anticuerpo monoclonal específico de la Prodefensina-A6 que reconoce el epítopo 1 de SEQ ID nº6.

PDF original: ES-2692354_T3.pdf

Tratamiento de cánceres utilizando moduladores de isoformas de PI3 cinasa.

(28/11/2018). Solicitante/s: INFINITY PHARMACEUTICALS, INC. Inventor/es: STERN,HOWARD M, KUTOK,JEFFERY L.

Un compuesto que tiene la siguiente estructura:**Fórmula** o una sal, solvato, hidrato, cocristal, clatrato o forma polimórfica del mismo, farmacéuticamente aceptable, para su uso en el tratamiento de una neoplasia maligna hemática en un sujeto, en el que el compuesto se formula para administrarse a partir de 25 mg 2VD a 75 mg 2VD.

PDF original: ES-2691742_T3.pdf

Anticuerpo anti-FOLR1.

(28/11/2018) Anticuerpo monoclonal o fragmento de anticuerpo del mismo que compite con un anticuerpo seleccionado de entre los (a) a (c) siguientes para reconocer específicamente el FOLR1 humano y que se une a un epítopo idéntico al epítopo sobre el FOLR1 humano al que se une el anticuerpo que se encuentra en las posiciones 55 a 62 en la secuencia de aminoácidos de FOLR1 humano representada por la SEC ID nº 1 y que muestra asimismo una actividad antitumoral: (a) un anticuerpo en el que las regiones determinantes de complementariedad (a las que se hace referencia en adelante como CDR) 1 a 3 de cadena pesada (a la que se hace referencia en adelante como cadena H) del anticuerpo comprenden las secuencias de aminoácidos representadas por las SEC ID…

Tratamiento de cáncer.

(26/11/2018). Solicitante/s: PFIZER INC.. Inventor/es: MARTINI,JEAN-FRANCOIS ANDRE, TARAZI,JAMAL CHRISTO, WILLIAMS,JAMES ANDREW.

Un procedimiento de identificación de un tumor que es sensible al tratamiento con axitinib, que comprende: (a) medir el nivel de expresión de polipéptido CD68 en una muestra de tejido de un tumor obtenido de un paciente humano que está siendo considerado para el tratamiento con axitinib; y (b) comparar el nivel de expresión de CD68 de la etapa (a) frente a un nivel de expresión de CD68 umbral determinado midiendo la expresión de polipéptido CD68 en muestras de tejido de tumores obtenidas de pacientes humanos tratados previamente con axitinib y que han demostrado ser resistentes a axitinib y de pacientes humanos tratados previamente con axitinib y que han demostrado ser sensibles a axitinib, en el que un nivel de expresión de CD68 por encima del nivel umbral indica que el tumor es sensible al tratamiento con axitinib.

PDF original: ES-2691213_T3.pdf

PÉPTIDOS DERIVADOS DEL RECEPTOR DE SOMATOSTATINA TRUNCADO SST5TMD4 COMO BIOMARCADORES Y DIANAS TERAPÉUTICAS EN PATOLOGÍAS TUMORALES.

(22/11/2018). Solicitante/s: UNIVERSIDAD DE CORDOBA. Inventor/es: CASTAÑO FUENTES,Justo P, GAHETE ORTIZ,Manuel D, DEL RIO MORENO,Mercedes, ALORS PEREZ,Emilia, LUQUE HUERTAS,Raúl.

La presente invención se refiere a la utilización de los péptidos derivados del extremo extracelular del receptor truncado sst5TMD4 como marcadores en un método de diagnóstico y/o pronóstico del cáncer en un paciente, y al kit o dispositivo de diagnóstico. La presente invención también se refiere a la utilización de los péptidos derivados del extremo extracelular del receptor truncado sst5TMD4 como diana terapéutica en cáncer.

Biomarcador de enfermedad renal crónica.

(21/11/2018). Solicitante/s: Randox Teoranta. Inventor/es: FITZGERALD, STEPHEN PETER, MCCONNELL,IVAN, LAMONT,JOHN, RICHARDSON,CIARAN.

Un método para detectar la enfermedad renal crónica en un sujeto, que comprende medir la cantidad de un biomarcador en una muestra obtenida del sujeto, y determinar si la cantidad del biomarcador está alterada en comparación con un control normal, en donde el biomarcador es MIP 1α.

PDF original: ES-2690486_T3.pdf

Marcador para predecir el pronóstico de cáncer de estómago y procedimiento para predecir el pronóstico de cáncer de estómago.

(16/11/2018). Solicitante/s: Samsung Life Public Welfare Foundation. Inventor/es: KANG, WON, KI, PAIK,SOON MYUNG, KIM,SUNG, LEE,JEE YUN, BAE,JAE MOON, SOHN,TAE SUNG, NOH,JAE HYUNG, CHOI,MIN GEW, PARK,YOUNG SUK, PARK,JOON OH, PARK,SE HOON, LIM,HO YEONG, JUNG,SIN HO.

Utilización de un marcador para la predicción del pronóstico del cáncer gástrico, en el que el marcador es una combinación de todos los genes C20orf103 (marco de lectura abierto 103 del cromosoma 20), MATN3 (matrilina 3), CLIP4 (familia de proteínas enlazadoras que contienen un dominio CAP-GLY, miembro 4), NOX4 (NADPH oxidasa 4), ADRA2C (receptor alfa-2C-adrenérgico), CSK (tirosina quinasa c-src), FZD9 (receptor 9 de la familia Frizzled), GALR1 (receptor de galanina 1), GRM6 (receptor metabotrópico de glutamato 6), INSR (receptor de insulina), LPHN1 (latrofilina 1), LYN (homólogo de oncogén relacionado viral v-yes-1 del sarcoma de Yamaguchi) y MRGPRX3 (GPR relacionado con MAS, miembro X3).

PDF original: ES-2689958_T3.pdf

La terapia anti-EMP2 reduce las células madre cancerosas.

(13/11/2018) Un anticuerpo para uso en la reducción de células madre cancerosas que expresan EMP2 en un paciente que tiene cáncer y que se ha identificado previamente que comprende células madre cancerosas que expresan EMP2 y uno o más marcadores seleccionados del grupo que consiste en CD44, CD 133 ABCG2 y ALDH, en donde: a) el anticuerpo comprende una cadena pesada que tiene la secuencia de aminoácidos: MAQVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRD NSKNTLYLQMNSLRAEDTAVYYCARDRRGRKSAGIDYWGQGTLVTVSS, y una cadena ligera que tiene la secuencia de aminoácidos:**Fórmula** b) el anticuerpo comprende una cadena…

Productos génicos de expresión diferencial en tumores y su uso.

(31/10/2018) Composición farmacéutica para su uso en un método para el tratamiento de una enfermedad de cáncer que se distingue por la expresión de un antígeno asociado a un tumor, que comprende uno o varios componentes seleccionados del grupo formado por: (i) un antígeno asociado a un tumor o una parte del mismo, (ii) un ácido nucleico que codifica un antígeno asociado a un tumor o una parte del mismo, (iii) un anticuerpo que se une a un antígeno asociado a un tumor, (iv) un ácido nucleico no codificante que hibrida de forma específica con un ácido nucleico que codifica un antígeno asociado a un tumor y (v) una célula huésped que…

Medios y procedimientos de diagnóstico de la reaparición de cáncer de próstata después de prostatectomía.

(31/10/2018) Un procedimiento de diagnóstico in vitro de si un sujeto está o no en riesgo de carcinoma de próstata recurrente después de prostatectomía que comprende: (a) determinar la cantidad de al menos un metabolito seleccionado de la lista que consiste en 7-metilguanina, ácido 2-hidroxibehénico, pirofosfato de isopentenilo, ácido cerebrónico (2-OH-C24:0), ácido 14- metilhexadecanoico, ácido 2-aminoadipínico, ceramida (d18:1, C24:1), ácido eicosenoico (C20:cis[11]1), ácido tricosanoico (C23:0), ácido eicosadienoico (C20:2) Nº 02, arginina, ácido behénico (C22:0), beta-caroteno, colestenol Nº 02, citosina, DAG (C18:1, C18:2), dihidrocolesterol, eritro-dihidroesfingosina, ácido docosahexaenoico (C22:cis[4,7,10,13,16,19]6), dodecanol,…

Biomarcadores para pronosticar y evaluar la reactividad de sujetos con cáncer de endometrio a compuestos con lenvatinib.

(30/10/2018). Solicitante/s: EISAI R&D MANAGEMENT CO., LTD. Inventor/es: FUNAHASHI, YASUHIRO, KADOWAKI,TADASHI, SACHDEV,PALLAVI.

Un método para pronosticar la respuesta de un sujeto humano que padece, se presume que padece o está en riesgo de desarrollar un cáncer de endometrio, a un tratamiento que comprende lenvatinib o una sal farmacéuticamente aceptable de este, el método comprende: someter a ensayo una muestra biológica obtenida del sujeto humano y determinar que la concentración de la proteína Angiopoyetina 2 (Ang2) en la muestra biológica es baja, en comparación con un testigo; e identificar que el sujeto humano que tiene una concentración baja de la proteína Ang2 en la muestra biológica es probable que responda al tratamiento que comprende lenvatinib o una sal farmacéuticamente aceptable de este.

PDF original: ES-2687968_T3.pdf

Significación de la heterogeneidad de HER2 intratumoral en el cáncer de mama y usos de la misma.

(30/10/2018) Un procedimiento in vitro para predecir el grado de respuesta a un tratamiento dirigido a HER2 evaluando la heterogeneidad de HER2 en un tumor, comprendiendo el procedimiento: * poner en contacto una muestra de tumor con un anticuerpo que se una específicamente a la proteína HER2 y detectar la proteína HER2 en la muestra, * poner en contacto la muestra de tumor con una sonda de ácido nucleico que se una específicamente al ADN genómico de HER2 y detectar el estado de amplificación del gen HER2 en la muestra, * calificar a la proteína HER2 (IHQ) y al gen HER2 (DISH), en la que la calificación se clasifica como: • grupo A para muestras que presentan IHQ 3+ y DISH+, • grupo B para muestras que presentan IHQ 3+ y DISH-, • grupo C para muestras…

Biomarcadores del mesotelioma y usos de los mismos.

(30/10/2018). Solicitante/s: Somalogic, Inc. Inventor/es: BRODY,EDWARD N, OSTROFF,RACHEL M, STEWART,ALEX A. E, NIKRAD,MALTI, WILLIAMS,STEPHEN ALARIC, RIEL-MEHAN,MICHAEL.

Un procedimiento para diagnosticar mesotelioma en un individuo, comprendiendo el procedimiento: detectar proteinas biomarcadores en una muestra biologica del individuo para dar valores de biomarcadores que corresponden al biomarcador F9 (Factor de coagulacion IX) y al menos N biomarcadores adicionales seleccionados de la Tabla 1, en el que el mesotelioma se diagnostica basandose en dichos valores de biomarcadores y en el que N es 1.

PDF original: ES-2688048_T3.pdf

SPARC y métodos de uso de la misma.

(23/10/2018). Solicitante/s: ABRAXIS BIOSCIENCE, LLC. Inventor/es: DESAI, NEIL P., SOON-SHIONG, PATRICK, TRIEU,VUONG.

Agente quimioterápico para su uso en un método de tratamiento de un tumor de mama en un mamífero, comprendiendo el método una etapa de detección de la expresión de la proteína SPARC y la presencia de expresión de Her2 mediante inmunohistoquímica en una muestra biológica que se ha aislado del tumor, en el que el agente quimioterápico va a administrarse al mamífero si se identificó estado de Her2 positivo y expresión de SPARC positiva como tinción > 2+, y en el que el agente quimioterápico comprende partículas de paclitaxel unido a albúmina del cual más del 50% del paclitaxel está en forma de nanopartícula.

PDF original: ES-2687076_T3.pdf

Procedimientos para predecir la respuesta contra el cáncer.

(23/10/2018). Solicitante/s: CHILDREN'S MEDICAL CENTER CORPORATION. Inventor/es: WANG,ZHIGANG, SZALLASI,ZOLTAN, BIRKBAK,NICOLAI JUUL, SILVER,DANIEL, RICHARDSON,ANDREA, EKLUND,ARON.

Procedimiento in vitro para seleccionar una terapia que comprende platino para un sujeto humano que tiene cáncer, que comprende: someter una muestra biológica que comprende células tumorales tomadas del ser humano a análisis de desequilibrio alélico telomérico (tAl); detectar el número de tAls (NtAI); y seleccionar una terapia contra el cáncer que comprende platino para el sujeto cuando el NtAI está por encima de un valor de referencia; en el que el valor de referencia se determina a partir del NtAI obtenido de cánceres similares que se sabe que son resistentes al platino.

PDF original: ES-2687024_T3.pdf

Métodos de inmunoensayo mejorados.

(22/10/2018). Solicitante/s: ONCIMMUNE LIMITED. Inventor/es: MURRAY,ANDREA, HAMILTON-FAIRLEY,GEOFFREY NEIL, ALLEN,JARED.

Un método para detectar un anticuerpo en una muestra de prueba que comprende un fluido corporal de un sujeto mamífero, comprendiendo el método las etapas de: (a) poner en contacto dicha muestra de prueba con una pluralidad de diferentes cantidades de un antígeno específico para dicho anticuerpo; (b) detectar la cantidad de unión específica entre dicho anticuerpo y dicho antígeno; (c) trazar o calcular una curva de la cantidad de dicha unión específica frente a la cantidad de antígeno para cada cantidad de antígeno utilizada en la etapa (a); (d) calcular un parámetro de la curva secundario a partir de la curva trazada o calculada en la etapa (c); y (e) determinar la presencia o ausencia de dicho anticuerpo basándose en una combinación de: (i) la cantidad de unión específica entre dicho anticuerpo y dicho antígeno determinada en la etapa (b); y (ii) dicho parámetro de la curva secundario determinado en la etapa (d).

PDF original: ES-2686824_T3.pdf

Combinaciones de biomarcadores para su uso en la detección del cáncer de páncreas.

(19/10/2018). Solicitante/s: RANDOX LABORATORIES LTD.. Inventor/es: FITZGERALD,PETER, MCCONNELL,IVAN, HABERMAN,JENS, BUENGER,STEFANIE, VON EGGELING,FERDINAND, BRENNER,HERMANN, FREITAG-WOLF,SANDRA.

Un método para determinar si un paciente tiene, o está en riesgo de desarrollar cáncer de páncreas que comprende, i) determinar el nivel de proteína de los biomarcadores S100A11, M-CSF, C3adesArg y CD26 en una muestra de sangre ex vivo, plasma o suero tomada del paciente y, ii) establecer la significación estadística de la concentración de los biomarcadores.

PDF original: ES-2686736_T3.pdf

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(19/10/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Anticuerpo, o fragmentos de unión a antígeno, divalentes, del mismo, apto(s) para unirse a cMet, caracterizado(s) por que el anticuerpo comprende una cadena pesada que comprende CDR-H1, CDR-H2 y CDR- H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 7, 8 y 9; y una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 15, 16 y 17.

PDF original: ES-2686693_T3.pdf

Nuevos anticuerpos que inhiben la dimerización de c-Met y sus utilizaciones.

(17/10/2018). Solicitante/s: PIERRE FABRE MEDICAMENT. Inventor/es: GOETSCH,LILIANE.

Procedimiento para seleccionar un anticuerpo anti-c-Met o fragmentos de unión a antígeno divalentes del mismo apto(s) para inhibir la activación dependiente de ligando e independiente de ligando de c-Met, comprendiendo dicho procedimiento: i) cribar los anticuerpos generados y seleccionar los anticuerpos que pueden unirse específicamente a c-Met; ii) evaluar in vitro los anticuerpos seleccionados en la etapa i) para la inhibición de la proliferación celular de BxPC3, que comprende las etapas de: a) poner en contacto dichos anticuerpos seleccionados en la etapa i) con las células BxPC3; b) medir la incorporación de [3H]timidina en las células de la etapa a); y c) seleccionar los anticuerpos que conducen a una reducción de la incorporación de [3H]timidina de por lo menos 50%; y iii) analizar los anticuerpos seleccionados de la etapa ii) y seleccionar los anticuerpos que pueden inhibir la dimerización de c-Met.

PDF original: ES-2686335_T3.pdf

Obtención de perfil de expresión génica en tejidos tumorales biopsiados.

(10/10/2018). Solicitante/s: GENOMIC HEALTH, INC.. Inventor/es: BAKER, JOFFRE, KIEFER, MICHAEL, C., SHAK,STEVE, CRONIN,MAUREEN,T, Walker,Michael G.

Un método para predecir la probabilidad de supervivencia a largo plazo de un paciente con cáncer de mama sin recidiva de cáncer de mama, después de la escisión quirúrgica del tumor primario, que comprende: determinar el nivel del transcrito de ARN de GSTM1 en una muestra de tejido de cáncer de mama obtenida del paciente, normalizada frente al nivel de expresión de todos los transcritos de ARN ensayados en la muestra, o frente a un conjunto de referencia de transcritos de ARN, en el que el nivel normalizado aumentado del transcrito de ARN de GSTM1 comparado con el nivel normalizado del transcrito de ARN de GSTM1 en un conjunto de referencia de tejido de cáncer de mama indica una mayor probabilidad de supervivencia a largo plazo sin recidiva de cáncer de mama.

PDF original: ES-2685702_T3.pdf

Productos génicos de expresión diferencial en tumores y su uso.

(05/10/2018). Solicitante/s: Ganymed Pharmaceuticals GmbH. Inventor/es: TURECI, OZLEM, SAHIN, UGUR, KOSLOWSKI,MICHAEL.

Anticuerpo que se une de forma selectiva a una proteína o un polipéptido, en donde la proteína o el polipéptido son codificados por un ácido nucleico que comprende una secuencia de ácido nucleico seleccionada del grupo formado por SEQ ID NO: 20, 21, 54, 55, 56 y 57.

PDF original: ES-2685053_T3.pdf

Microvesículas obtenidas a partir de células tumorales.

(26/09/2018) Un método para supervisar la progresión de un cáncer o la eficacia terapéutica de un tratamiento contra el cáncer en un sujeto, que comprende: a) aislar microvesículas a partir de una primera muestra de fluido corporal que se ha recogido a partir de un sujeto que tiene cáncer en un primer punto de tiempo y supervisar el estado de uno o varios sitios de fosforilación distintos de una proteína oncogénica o relacionada con el tumor en las microvesículas obtenidas a partir de la primera muestra de fluido corporal; y b) aislar las microvesículas a partir de una segunda muestra de fluido corporal que se ha recogido a partir del sujeto que tiene cáncer…

1 · · 3 · 6 · 12 · ››