CIP 2015 : A61K 39/145 : Orthomyxoviridae, p. ej. virus de la influenza.

CIP2015AA61A61KA61K 39/00A61K 39/145[2] › Orthomyxoviridae, p. ej. virus de la influenza.

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

A61K 39/145 · · Orthomyxoviridae, p. ej. virus de la influenza.

CIP2015: Invenciones publicadas en esta sección.

VIRUS DE LA GRIPE ATENUADO Y SU USO COMO VACUNA.

(21/02/2019). Solicitante/s: CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS (CSIC). Inventor/es: FALCÓN,Ana, NIETO,Amelia, VASILIJEVIC,Jasmina.

Virus de la gripe atenuado y su uso como vacuna. La invención se refiere a un polinucleótido aislado que comprende una secuencia de nucleótidos que codifica una proteína de polimerasa 2 básica (PB2) de virus de la gripe A que comprende (a) una secuencia de aminoácidos que comprende una identidad de secuencia de, al menos, el 75% con SEQ ID NO: 2, y (b) una sustitución de aminoácidos en la posición A221T correspondiente a la posición 221 de la SEQ ID NO: 2 determinada por el alineamiento óptimo de ambas secuencias. La invención también se refiere a la célula y al virus que comprende dicho polinucleótido, así como a su uso como vacuna en el tratamiento profiláctico y terapéutico de la infección por el virus de la gripe.

PDF original: ES-2701376_A1.pdf

Fabricación de una emulsión de aceite en agua que comprende escualeno.

(06/02/2019). Solicitante/s: NOVARTIS AG. Inventor/es: HORA,MANINDER.

Un procedimiento para la fabricación de una emulsión de aceite en agua que comprende un componente acuoso, escualeno y polisorbato 80 del 0,01 al 2% en peso, el procedimiento comprendiendo: (i) preparar escualeno a partir de una composición que comprende escualeno de una fuente animal por un proceso que comprende las etapas de: (a) una destilación de purificación llevada a cabo a una temperatura T1 ; y (b) una destilación desnaturalizante llevada a cabo a una temperatura T2; en donde las etapas (a) y (b) se pueden realizar en cualquier orden; T1 y T2 son suficientes para hacer hervir el escualeno; T2 > T1; y T 2 ≥ 200º° C; y (ii) preparar una emulsión usando el escualeno preparado en la etapa (i).

PDF original: ES-2717266_T3.pdf

Fabricación de vacunas contra virus de la gripe sin usar huevos.

(27/12/2018). Solicitante/s: Seqirus UK Limited. Inventor/es: TSAI,THEODORE F, TRUSHEIM,HEIDI.

Un método para aislar un virus de la gripe de una muestra de un paciente, que comprende un paso en el que la muestra de paciente se incuba con células MDCK, que crecen en un cultivo en suspensión libre de suero.

PDF original: ES-2694805_T3.pdf

Virus de la gripe porcina modificado por ingeniería genética y usos de los mismos.

(18/12/2018). Solicitante/s: Icahn School of Medicine at Mount Sinai. Inventor/es: PALESE, PETER, GARCIA-SASTRE,ADOLFO, WEBSTER,ROBERT, LAGER,KELLY M, RICHT,JUERGEN A, WEBBY,RICHARD J.

Un virus de la gripe porcina atenuado, modificado por ingeniería genética, en donde el virus comprende un gen de NS1 de virus de la gripe porcina con una mutación que produce una proteína NS1 de virus de la gripe porcina que tiene una deleción de exactamente 90 restos de aminoácido del carboxi terminal de NS1, en donde el gen de NS1 de virus de la gripe porcina es de A/Porcino/Texas/4199-2/98.

PDF original: ES-2694123_T3.pdf

Método para protección contra enfermedad causada por patógenos secundarios.

(26/10/2018). Solicitante/s: INTERVET INTERNATIONAL B.V. Inventor/es: LAKSHMANAN,NALLAKANNU P, WASMOEN,TERRI LEE, DESHPANDE,MURALIDHAR S, JAYAPPA,HUCHAPPA GOWDA.

Una vacuna que consiste en un virus de la gripe canina inactivado y, opcionalmente, un adyuvante para su uso en la proteccion de un canido contra Streptococcus equi.

PDF original: ES-2687702_T3.pdf

Vacuna para inducir una reacción inmune mejorada.

(10/10/2018). Solicitante/s: Eyegene, Inc. Inventor/es: LEE, NA-GYONG, CHO, YANG, JE, YOO,WON IL, JANG,JIN-WOOK, KIM,KWANG SUNG.

Una composición de vacuna farmacéutica para uso en vacunación contra un virus de influenza, que comprende: (a) antígeno del virus de la influenza; (b) un lipooligosacárido (LOS), donde el LOS se define como un LPS (lipopolisacárido) modificado de bajo peso molecular que tiene glicocadenas más cortas que los LPS naturales y que tienen un peso molecular en un intervalo de 5,000-10,000 Da antes de la desacilación, donde LOS se deriva de Escherichia coli que tiene un peso molecular en el intervalo de 2.000-4.000 Da después de la desacilación, que se desacila mediante la eliminación de LOS de un ácido graso unido a la glucosamina del lípido A a través de un enlace -C(O)O- que da como resultado una reducción significativa de citotoxicidad en comparación con LOS; y (c) un inmunoadyuvante que es hidróxido de aluminio; (d) un transportador farmacéuticamente aceptable.

PDF original: ES-2685585_T3.pdf

Vacuna de péptido modificado derivada de M2 de influenza.

(24/09/2018). Solicitante/s: The Chemo-Sero-Therapeutic Research Institute. Inventor/es: NISHIYAMA, KIYOTO, NOZAKI, CHIKATERU, KAMINAKA,KAZUYOSHI, MATSUDA,JUNICHI.

Un péptido modificado que se prepara insertando uno o varios residuos de cisteína en un péptido que consiste en una secuencia de aminoácidos de las posiciones Núm. 2 a Núm. 24 de la proteína matriz 2 en el virus de la influenza (M2e), en donde dichos uno o varios residuos de cisteína se insertan una posición entre la Núm. 20 y la Núm. 21 de M2e, o en una combinación de dos o más posiciones entre la Núm. 15 y la Núm. 16, entre la Núm. 20 y la Núm. 21, entre la Núm. 21 y la Núm. 22, entre la Núm. 22 y la Núm. 23 y entre la Núm. 23 y la Núm. 24 de M2e.

PDF original: ES-2682998_T3.pdf

Proteínas de hemaglutinina del virus de la gripe y método de uso de las mismas.

(24/09/2018). Solicitante/s: Avatar Medical, LLC. Inventor/es: MARSHALL,CHRISTOPHER PATRICK, ALFF,PETER JOSEPH, BERTUCCIOLI,CLAUDIO, YONDOLA,MARK ANDREW.

Un polipéptido, proteína o complejo de proteínas de hemaglutinina (HA) del virus de la gripe, que comprende un dominio de tallo de la HA que comprende una secuencia de aminoácidos que tiene una identidad de secuencia de al menos 65% con los restos de aminoácidos 229 a 519 de la SEQ ID NO: 1, en donde la secuencia de aminoácidos comprende una mutación puntual a tirosina en una o más de las posiciones de aminoácidos 403, 406, 429, 432, 433 y 435, o un resto de aminoácido que corresponde a las mismas por alineamiento con la SEQ ID NO: 1.

PDF original: ES-2682981_T3.pdf

Vacuna.

(23/05/2018). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS SA. Inventor/es: HANON,Emmanuel Jules, BALLOU JR,WILLIAM RIPLEY.

Una composición inmunogénica que comprende un PhtD neumocócico no conjugado y una neumolisina neumocócica no conjugada, y una composición coadyuvante que consiste en una emulsión de aceite en agua, en donde dicha emulsión de aceite en agua consiste en 2 - 3 mg de aceite metabolizable, 1-3 mg de tocol y 0,1 - 4 mg de agente emulsionante por dosis para seres humanos y el aceite y el agente emulsionante están en un vehículo acuoso, en donde el volumen de la composición de vacuna dosis está entre 0,4 y 1,5 ml.

PDF original: ES-2678694_T3.pdf

Producción de vacunas contra el virus de la gripe.

(16/05/2018). Solicitante/s: Ology Bioservices, Inc. Inventor/es: BARRETT, NOEL, KISTNER, OTFRIED, DR., FALKNER,FALKO-GUENTER, ERLICH,HARTMUT.

Una composición antigénica de virus de la gripe reagrupado que comprende: segmentos génicos internos PB1, PB2, PA, M, NP y NS de una primera cepa del virus de la gripe A del subtipo H5N1 y genes de la hemaglutinina (HA) y de la neuraminidasa (NA) de una segunda cepa del virus de la gripe A del subtipo H5N1, siendo la primera cepa y la segunda cepa cepas diferentes y en la que el gen de la HA está modificado en un sitio de escisión polibásico para producir un virus atenuado.

PDF original: ES-2675771_T3.pdf

Partículas pseudovíricas quiméricas de influenza que comprenden hemaglutinina.

(28/03/2018) Un ácido nucleico que puede expresarse en un huésped vegetal que comprende una o más regiones reguladoras operativas en una planta, y unido operativamente a una secuencia que codifica un polipéptido quimérico de hemaglutinina (HA) de influenza que comprende un grupo de dominio del tallo (SDC), un grupo de dominio de la cabeza (HDC) y un clúster de dominio transmembrana (TDC), comprendiendo una o más regiones reguladoras un promotor y una 5'UTR, 3'UTR o 5'UTR y 3'UTR, y en donde a) el SDC comprende un subdominio F'1, F'2 y F; b) el HDC comprende un subdominio de unión a receptor (RB), E1 y E2; c)…

Virus quiméricos de la enfermedad de Newcastle que presentan proteínas de superficie no naturales y sus usos.

(14/02/2018). Solicitante/s: Icahn School of Medicine at Mount Sinai. Inventor/es: PALESE, PETER, GARCIA-SASTRE,ADOLFO.

Un virus quimérico de la enfermedad de Newcastle (NDV), que comprende un genoma empaquetado que comprende una secuencia de nucleótidos que codifica una proteína de fusión F que tiene los dominios transmembrana y citoplásmico de una proteína F y al menos un epítopo de un ectodominio de un antígeno protector de un agente infeccioso o un antígeno asociado con una enfermedad que está anclado por el extremo C, de modo que la proteína de fusión F se expresa e incorpora en el NDV quimérico, en el que el antígeno no se deriva de un paramixovirus, y en el que la función de la proteína F es suministrada por la proteína de fusión F o por la proteína F nativa.

PDF original: ES-2668018_T3.pdf

Virus quiméricos de la enfermedad de Newcastle que presentan proteínas de superficie no naturales y sus usos.

(14/02/2018). Solicitante/s: Icahn School of Medicine at Mount Sinai. Inventor/es: PALESE, PETER, GARCIA-SASTRE,ADOLFO.

Un virus quimérico de la enfermedad de Newcastle (NDV), que comprende un genoma empaquetado que comprende una secuencia de nucleótidos que codifica una proteína de fusión HN que tiene los dominios transmembrana y citoplasmático de una proteína HN y al menos un epítopo de un ectodominio de un antígeno protector de un agente infeccioso o un antígeno asociado con una enfermedad que está anclado por el extremo N, de modo que la proteína de fusión HN se expresa e incorpora en el NDV quimérico, en el que el antígeno no se deriva de un paramixovirus, y en el que la función de la proteína HN es suministrada por la proteína de fusión HN o por la proteína HN nativa.

PDF original: ES-2668464_T3.pdf

Expresión de proteínas virales en las plantas.

(14/02/2018). Solicitante/s: UNIVERSITY OF CAPE TOWN. Inventor/es: RYBICKI,EDWARD,PETER, WILLIAMSON,ANNA-LISE, MACLEAN,James Malcolm, BECKER-HITZEROTH,Inga Isabel.

Un método para producir un polipéptido H5 del virus de influenza en una planta que comprende las etapas de: i) clonar un gen del virus de influenza H5 o ácido nucleico que codifica un polipéptido H5 en un vector adaptado para dirigir un componente presente en la planta, en el que el componente de la planta es el retículo endoplasmático; ii) infiltrar al menos una porción de la planta con el vector o transformar el tejido vegetal con el vector para expresar de forma transitoria el polipéptido del virus de influenza H5; y iii) recuperar el polipéptido H5 del virus de influenza expresado por la planta.

PDF original: ES-2662118_T3.pdf

Vacunas encapsuladas para la vacunación oral y de refuerzo de peces y otros animales.

(17/01/2018) Una composición microparticulada para la administración oral a un animal para el suministro intestinal de un principio farmacéuticamente activo, comprendiendo dicha composición: a) al menos un polímero bioadhesivo seleccionado del grupo que consiste en quitosano, guar catiónico, ácido hialurónico y combinaciones de los mismos, en el que el polímero bioadhesivo está presente a una concentración de entre el 1 y el 10 % en peso; b) al menos un oligosacárido que tiene propiedades de intensificación de la respuesta inmunógena, seleccionado del grupo que consiste en inulina, fructooligosacárido y dextrina, en donde el oligosacárido está presente a una concentración de entre el 1 y el 50 % en peso; c) al menos un compuesto mediador que tiene propiedades hidrófilas…

Proteínas de fusión y vacunas de combinación que comprenden la Proteína E y Pilina A de Haemophilus influenzae.

(20/12/2017). Solicitante/s: GLAXOSMITHKLINE BIOLOGICALS S.A.. Inventor/es: POOLMAN, JAN, BLAIS,NORMAND, LABBE,STEVE.

Una proteína de fusión de fórmula I: (X)m-(R1)n-A-(Y)o-B-(Z)p (fórmula I) en la que X es un péptido señal o MHHHHHH (SEQ ID NO. 2); m es 0 o 1; R1 es un aminoácido; n es 0, 1, 2, 3, 4, 5 o 6; A es un fragmento inmunogénico de la Proteína E seleccionado de SEQ ID NO. 122, SEQ ID NO. 123, SEQ ID NO. 124, SEQ ID NO. 125, SEQ ID NO. 126, SEQ ID NO. 179 o SEQ ID NO. 180 o una secuencia que tiene al menos un 95 % de identidad de secuencia con una cualquiera de SEQ ID NO. 122, SEQ ID NO. 123, SEQ ID NO. 124, SEQ ID NO. 125, SEQ ID NO. 126, SEQ ID NO. 179 o SEQ ID NO. 180; Y se selecciona del grupo que consiste en GG, SG, SS, GGG y (G)h en el que h es 4, 5, 6, 7, 8, 9 o 10; o es 0 o 1; B es un fragmento inmunogénico de PilA, al menos un 95 % idéntico a los aminoácidos 40-149 de cualquiera de SEQ ID NO. 58 a SEQ ID NO. 121; Z es GGHHHHHH (SEQ ID NO. 3); y p es 0 o 1.

PDF original: ES-2658512_T3.pdf

Virus de la gripe con segmento génico PB2 mutante como vacunas vivas atenuadas.

(06/12/2017) Una vacuna comprendiendo una cantidad efectiva de un virus de la gripe aislado biológicamente contenido, comprendiendo: i) 8 segmentos génicos distintos, incluyendo un segmento génico viral PA, un segmento génico viral PB1, un segmento génico viral PB2 mutante, un segmento génico viral HA, un segmento génico viral NA, un segmento génico viral NP, un segmento génico viral M (M1 y M2), y un segmento génico viral NS (NS1 y NS2), ii) 8 segmentos génicos virales distintos, incluyendo un segmento génico viral PA, un segmento génico viral PB1, un segmento génico viral PB2 mutante, un segmento génico viral HA, un segmento génico viral NA (NA y NB), un segmento génico…

Vacunas atenuadas de la gripe porcina y procedimientos de fabricación y uso de las mismas.

(06/12/2017). Solicitante/s: MERIAL, INC.. Inventor/es: HAUSE,BENJAMIN M.

Cepa atenuada de la gripe porcina capaz de proporcionar una respuesta inmunitaria segura y eficaz en animales porcinos contra la gripe o enfermedades causadas por la gripe, que codifica un gen de HA que tiene al menos 4 sitios de glicosilación adicionales en relación a una cepa parental virulenta, en la que los sitios de glicosilación se seleccionan de S71N, K90N, L173T, P287T y K294T, y en la que la localización del cambio o cambios de aminoácidos se basa en el gen de HA codificada por la cepa parental virulenta que tiene la secuencia tal como se expone en la SEQ ID NO: 18.

PDF original: ES-2662022_T3.pdf

Partículas tipo virus que comprenden una proteína de la matriz de un virus encapsulado de plantas y usos de las mismas.

(29/11/2017). Solicitante/s: FRAUNHOFER, USA, INC. Inventor/es: YUSIBOV,VIDADI, PROKHNEVSKY,ALEXEI.

Una partícula tipo virus que comprende una proteína de la matriz de un primer rhabdovirus de plantas y un polipéptido de superficie, en la que el polipéptido de superficie comprende (a) una parte expuesta a la superficie de un polipéptido diana, en la que el polipéptido diana es de un virus animal, bacteria, parásito u hongo y en la que la parte expuesta a la superficie del polipéptido de superficie es antigénica (b) un dominio transmembrana, y (c) una cola citosólica de una proteína transmembrana de un segundo rhabdovirus de plantas.

PDF original: ES-2657875_T3.pdf

Anticuerpos monoclonales humanizados y métodos de uso.

(01/11/2017). Solicitante/s: DANA-FARBER CANCER INSTITUTE, INC.. Inventor/es: SUI,JIANHUA, AVNIR,YUVAL, MARASCO,WAYNE.

Un anticuerpo monoclonal G6 murino humanizado aislado que se une específicamente a la región variable de la cadena pesada de la inmunoglobulina humana codificada por el gen VH1-69 de la línea germinal o un fragmento de este, en donde dicho anticuerpo o dicho fragmento comprende: a) una región variable de cadena pesada que comprende la secuencia de aminoácidos:**Fórmula** una región variable de cadena ligera que comprende la secuencia de aminoácidos:**Fórmula** b) una región variable de cadena pesada que comprende la secuencia de aminoácidos:**Fórmula** una región variable de cadena ligera que comprende la secuencia de aminoácidos:**Fórmula**.

PDF original: ES-2648885_T3.pdf

Virus de la gripe atenuados con actividad antagonista de interferón alterada para uso como vacunas y productos farmacéuticos.

(18/10/2017). Solicitante/s: Icahn School of Medicine at Mount Sinai. Inventor/es: PALESE, PETER, MUSTER, THOMAS, GARCIA-SASTRE,ADOLFO.

Un virus de la gripe quimérico atenuado modificado por ingeniería genética, cuyo genoma: (i) comprende una secuencia heteróloga, que codifica para un segmento de gen de virus de la gripe, y (ii) codifica una proteína NS1 truncada que consiste en 99 aminoácidos N-terminales de la proteína NS1 de una cepa de virus de la gripe, donde el virus de la gripe quimérico atenuado modificado por ingeniería genética tiene un fenotipo antagonista del interferón dañado.

PDF original: ES-2653557_T3.pdf

Virus atenuados con cadena de polaridad negativa con actividad antagonista de interferón alterada para uso como vacunas y productos farmacéuticos.

(11/10/2017). Solicitante/s: Icahn School of Medicine at Mount Sinai. Inventor/es: PALESE, PETER, MUSTER, THOMAS, GARCIA-SASTRE,ADOLFO.

Un virus de la gripe atenuado modificado por ingeniería genética, cuyo genoma codifica una proteína NS1 truncada que consiste en 99 aminoácidos N-terminales de la proteína NS1 de una cepa de virus de la gripe, donde el virus de la gripe atenuado modificado por ingeniería genética tiene un fenotipo antagonista del interferón dañado.

PDF original: ES-2650500_T3.pdf

Vectores del alfavirus para las vacunas del virus de la gripe.

(16/08/2017). Solicitante/s: NOVARTIS VACCINES AND DIAGNOSTICS, INC.. Inventor/es: PERRI,SILVIA, GREER,CATHERINE, POLO,JOHN, UEMATSU,YASUSHI.

Una composición inmunogénica que comprende: (a) un vector replicón de alfavirus que comprende (i) un primer ácido nucleico heterólogo que codifica una proteína de virus de la gripe, y (ii) una segunda secuencia de ácido nucleico heterólogo que codifica una proteína de virus de la gripe, en el que dicha segunda secuencia de ácido nucleico heterólogo es diferente de dicha primera secuencia de ácido nucleico heterólogo; y (b) un vehículo, diluyente, o excipiente farmacéuticamente.

PDF original: ES-2647491_T3.pdf

Vectores de vacuna y métodos para potenciar las respuestas inmunitarias.

(09/08/2017). Solicitante/s: THE BOARD OF TRUSTEES OF THE UNIVERSITY OF ARKANSAS. Inventor/es: BOTTJE,WALTER, HARGIS,BILLY, BERGHMAN,LUC, LAYTON,SHERRYLL.

Un vector de vacuna que es un vector bacteriano, vírico o a base de liposomas, comprendiendo el vector un polipéptido antigénico y un polipéptido HMGB1 comprendidos cada uno dentro de una proteína transmembrana, en donde el polipéptido antigénico y el polipéptido HMGB1 están presentes en la superficie del vector de vacuna, en donde el polipéptido antigénico es opcionalmente un polipéptido del virus de la gripe y el polipéptido del virus de la gripe se selecciona opcionalmente de un polipéptido del virus de la gripe M2e, HA o NP en donde el polipéptido HMGB1 se selecciona de las SEQ ID NO: 18, SEQ ID NO: 29, SEQ ID NO: 30 y un homólogo del mismo que tiene al menos el 95 % de identidad de secuencia con al menos una de las SEQ ID NO: 18, 29 o 30.

PDF original: ES-2643646_T3.pdf

Agente terapéutico inmunológico de acción rápida y prolongada.

(09/08/2017). Solicitante/s: Altimmune Inc. Inventor/es: TANG,DE-CHU C.

Un adenovirus con E1 y E3 eliminados para su uso en un método de inducción de una respuesta protectora contra patógenos respiratorios en un sujeto mamífero que lo necesita, que comprende administrar por vía intranasal, 1 o 2 días antes de la exposición al patógeno respiratorio, una cantidad eficaz del adenovirus con E1 y E3 eliminados, con o sin la codificación de un antígeno derivado del patógeno.

PDF original: ES-2645156_T3.pdf

Secuencias y composiciones de péptidos.

(12/07/2017). Solicitante/s: PEPTCELL LIMITED. Inventor/es: CAPARROS-WANDERLEY,WILSON,ROMERO, STOLOFF,Gregory,Alan.

Una composición de vacuna contra la gripe, que comprende un polipéptido y opcionalmente un excipiente o adyuvante apropiado: en la que el polipéptido es SEQ ID1 o una o secuencia que tienen al menos 85% de homología con la secuencia de 32 aminoácidos de la SEQ ID 1: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP y en la que, el polipéptido es inmunogénico en un vertebrado que expresa un alelo del complejo de histocompatibilidad mayor (MHC), y es inmunogénico para una pluralidad de cepas del virus de la gripe.

PDF original: ES-2635590_T3.pdf

VACUNA CONTRA ISAV CON DICHO VIRUS INACTIVADO Y UN ADYUVANTE BASADO EN CUERPOS CELULARES LA QUE POTENCIA LA RESPUESTA INMUNE.

(29/06/2017). Solicitante/s: UNIVERSIDAD DE SANTIAGO DE CHILE. Inventor/es: CORTEZ SAN MARTÍN,Marcelo, TORO ASCUY,Daniela, ACUÑA CASTILLO,Claudio, MONTOYA KUNSTING,Margarita, VASQUEZ MARTINEZ,Yesseny, SANTIBAÑEZ VARGAS,Alvaro Eugenio, GONZALEZ CATRILELBUN,Sebastian Alberto, SANDOVAL ASTUDILLO,Nicolas Pablo, COTTET BUSTAMANTE,Luis Eduardo.

La presente invención se relaciona con vacunas dirigidas a la acuicultura. Particularmente, en el cultivo de salmones. Específicamente, la presente invención se refiere a un adyuvante de vacuna basado en cuerpos celulares y a la vacuna que comprende dicho adyuvante para potenciar la respuesta inmune de peces, 5 preferentemente, salmónidos - frente a la infección por Virus de la Anemia Infecciosa de Salmón (ISAV).

Formulación de péptidos unidos a fluorocarburo.

(28/06/2017). Solicitante/s: ALTIMMUNE UK LIMITED. Inventor/es: BROWN,CARLTON BRADLEY, GEORGES,BERTRAND VICTOR GILBERT, THABURET,JEAN FRANCOIS.

Una formulación acuosa ácida que comprende ácido acético y un primer péptido unido a fluorocarburo, en la que: (i) el péptido unido al fluorocarburo tiene una longitud de al menos 20 restos de aminoácidos, comprende al menos 50 % de restos de aminoácidos hidrófobos y tiene un punto isoeléctrico mayor o igual que 7 y (ii) el péptido unido a fluorocarburo está presente en micelas.

PDF original: ES-2645017_T3.pdf

Vacuna con vector del herpesvirus de pavo contra la gripe aviar en aves de corral.

(07/06/2017). Solicitante/s: INTERVET INTERNATIONAL B.V. Inventor/es: SONDERMEIJER, PAULUS JACOBUS ANTONIUS, VERSTEGEN,IWAN.

Vector de herpesvirus de pavo (HVT) que comprende un ácido nucleico heterólogo que comprende una secuencia de nucleótidos que codifica una proteína hemaglutinina (HA) de virus de la gripe aviar (VGA), caracterizado por que dicha secuencia de nucleótidos está unida operativamente a un promotor génico de glucoproteína 5 B (gB) de un herpesvirus de mamífero.

PDF original: ES-2635019_T3.pdf

Composiciones de vacuna contra la gripe estables a temperatura de refrigerador.

(19/04/2017). Solicitante/s: MEDIMMUNE, LLC. Inventor/es: KEMBLE,GEORGE, TRAGER,GEORGE, SCHWARTZ,RICHARD M.

Una composición de virus de la gripe vivo estable a refrigerador que comprende al menos una cepa del virus de la gripe y comprende además un estabilizante, que consiste en: (a) sacarosa del 2 % al 8 % en peso/volumen (p/v); arginina del 0,75 % al 2 % p/v; glutamato del 0,02 % al 0,15 % p/v e hidrolizado de gelatina del 0,5 % al 2 % y un tampón; o (b) sacarosa del 2 % al 8 % p/v; arginina del 0,75 % al 2 % p/v, hidrolizado de gelatina del 0,5 % al 2 % y un tampón; en la que cada cantidad de cada uno de los componentes del estabilizante es la cantidad final en la composición del virus y la composición de virus exhibe una pérdida de potencia de menos de 1,0 log cuando se almacena durante un periodo de 3 meses a de 4 ºC a 8 ºC.

PDF original: ES-2633471_T3.pdf

VACUNA ORAL CONTRA ISAV, PROCESO DE PREPARACIÓN Y MÉTODO PARA TRATAR PECES Y ESTIMULAR RESPUESTA INMUNE.

(06/04/2017). Solicitante/s: UNIVERSIDAD DE SANTIAGO DE CHILE. Inventor/es: RIVAS ARAVENA,Andrea Aurora, SANDINO GARCIA,Ana Maria, SPENCER OSSA,Eugenio Germán.

Vacuna que comprende un adyuvante que capaz de aumentar la eficacia de protección de una vacuna contra infecciones de la Enfermedad de Anemia del Salmón (ISAV de sus siglas en inglés, Infectious Salmon Anemia Disease), proceso de preparación, método para tratar peces infectados y método para estimular la respuesta inmune en peces. En particular, la invención se refiere a una vacuna oral contra ISAV para ser administrada junto al alimento del pez y que comprende nanopartículas de quitosán que están asociadas a una virina del virus ISA y nanopartículas de quitosán asociadas a un adyuvante que consiste en un ADN que codifica para la replicasa/transcriptasa de un alfavirus de salmón (replicón).

Procedimiento de producción de una vacuna contra la gripe.

(05/04/2017) Un procedimiento de producción de una masa de virus fragmentados, inactivados, purificados, que comprende las etapas de: (i) propagación de un germen de trabajo en huevos de gallina fecundados, recogida y agrupación de los fluidos alantoideos infectados para obtener una masa de virus enteros crudos, (ii) purificación de la cepa viral que conduce a una masa de virus enteros purificados, (iii) fragmentación de la masa de virus enteros monovalentes purificados con desoxicolato sódico, dando como resultado una masa de virus fragmentados purificados, e (iv) inactivación de la masa de virus monovalentes fragmentados purificados en dos etapas mediante incubación con desoxicolato sódico y con formaldehído, seguida por ultrafiltración y filtración estéril con el fin de obtener la masa de virus fragmentados…

1 · · 3 · 4 · 5 · 6 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015