CIP-2021 : C12N 15/13 : Inmunoglobulinas.

CIP-2021CC12C12NC12N 15/00C12N 15/13[4] › Inmunoglobulinas.

Notas[t] desde C01 hasta C14: QUIMICA

C QUIMICA; METALURGIA.

C12 BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE; MICROBIOLOGIA; ENZIMOLOGIA; TECNICAS DE MUTACION O DE GENETICA.

C12N MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS CONTIENEN; PROPAGACION, CULTIVO O CONSERVACION DE MICROORGANISMOS; TECNICAS DE MUTACION O DE INGENIERIA GENETICA; MEDIOS DE CULTIVO (medios para ensayos microbiológicos C12Q 1/00).

C12N 15/00 Técnicas de mutación o de ingeniería genética; ADN o ARN relacionado con la ingeniería genética, vectores, p. ej. plásmidos, o su aislamiento, su preparación o su purificación; Utilización de huéspedes para ello (mutantes o microorganismos modificados por ingeniería genética C12N 1/00, C12N 5/00, C12N 7/00; nuevas plantas en sí A01H; reproducción de plantas por técnicas de cultivo de tejidos A01H 4/00; nuevas razas animales en sí A01K 67/00; utilización de preparaciones medicinales que contienen material genético que es introducido en células del cuerpo humano para tratar enfermedades genéticas, terapia génica A61K 48/00; péptidos en general C07K).

C12N 15/13 · · · · Inmunoglobulinas.

CIP2021: Invenciones publicadas en esta sección.

Anticuerpo biespecífico o mezcla de anticuerpos con cadenas ligeras comunes.

(15/07/2020). Solicitante/s: Jiangsu Alphamab Biopharmaceuticals Co., Ltd. Inventor/es: XU, TAO, HAN, LI, ZHANG,HUIMIN, XU,TING, WANG,XIAOXIAO, LI,QIAN, PANG,MINJIE, ZHANG,QINGQING.

Anticuerpo biespecífico o parte de unión a antígeno del mismo, en el que el anticuerpo biespecífico o la parte de unión a antígeno del mismo tiene una cadena ligera común, en el que dicha cadena ligera común se refiere a dos cadenas ligeras que tienen la misma secuencia, en el que dicha cadena ligera común se ensambla con una cadena pesada de Pertuzumab o la parte de unión a antígeno de la misma y una cadena pesada de Trastuzumab o la parte de unión a antígeno de la misma para formar un anticuerpo biespecífico o un Fab, respectivamente, en condiciones fisiológicas o durante la expresión de proteína in vitro; y en el que la región variable de dicha cadena ligera común comprende una secuencia seleccionada de las indicadas en las posiciones de aminoácidos 1 a 107 de SEQ ID NO: 1 - SEQ ID NO: 6.

PDF original: ES-2811267_T3.pdf

Anticuerpo de PDL-1, composición farmacéutica del mismo y sus usos.

(13/05/2020). Solicitante/s: Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. Inventor/es: WANG,JINGYI, LI,BAIYONG, XUE,TONGTONG, XIA,YU, WANG,ZHONGMIN MAXWELL, XIAO,LIANG, WANG,LICHUN.

Un anticuerpo monoclonal anti-PDL-1 o un fragmento de unión a antígeno del mismo, en donde, dicho anticuerpo monoclonal anti-PDL-1 tiene una región variable de cadena pesada que comprende una HCDR1 como se expone en SEQ ID NO: 15, una HCDR2 como se expone en SEQ ID NO: 16, y una HCDR3 como se expone en SEQ ID NO: 17, y tiene una región variable de cadena ligera que comprende una LCDR1 como se expone en SEQ ID NO: 18, una LCDR2 como se expone en SEQ ID NO: 19, y una LCDR3 como se expone en SEQ ID NO: 20.

PDF original: ES-2801873_T3.pdf

Polipéptidos biespecíficos de unión a antígeno.

(29/04/2020). Solicitante/s: X-Body, Inc. Inventor/es: CHEN, YAN, WAGNER,RICHARD,W, ZHANG,KEMING, RICHALET,PASCALE.

Un polipéptido biespecífico de unión a antígeno aislado desprovisto de cadenas ligeras de anticuerpo que comprende una cadena pesada de anticuerpo que comprende un primer dominio VH que se une específicamente a un primer antígeno, unido en el terminal C a un segundo dominio VH que se une específicamente a un segundo antígeno, en el que el primer y segundo antígeno se seleccionan independientemente del grupo que consiste en PDGFRβ y HER2 humanos, en los que uno del primer dominio VH o el segundo dominio VH se une específicamente a HER2 humano y comprende las secuencias de aminoácidos de HCDR3, HCDR2 y HCDR1 seleccionadas del grupo que consiste en las SEQ ID NOs: 1, 2 y 3; 4, 5 y 6; 7, 8 y 9; y 10, 11 y 12, y en las que el polipéptido desprovisto de cadenas ligeras de anticuerpos se une específicamente a PDGFRβ y HER2.

PDF original: ES-2800674_T3.pdf

Anticuerpos anti-CD40.

(29/04/2020). Solicitante/s: BOEHRINGER INGELHEIM INTERNATIONAL GMBH. Inventor/es: SINGH,Sanjaya, LITZENBURGER,TOBIAS, BRODEUR,SCOTT, CANADA,KEITH A, BARRETT,RACHEL.

Un anticuerpo anti-CD40 humanizado que tiene una cadena pesada variable y una cadena ligera variable que comprende las secuencias de aminoácidos de SEQ ID NO: 53 y SEQ ID NO: 52, respectivamente, donde el anticuerpo comprende una región Fc de inmunoglobulina humana y en donde el anticuerpo es un anticuerpo IgG1.

PDF original: ES-2807217_T3.pdf

Moléculas de unión de alta avidez que reconocen MAGE-A1.

(08/04/2020). Solicitante/s: Max Delbrück Centrum für Molekulare Medizin (MDC) Berlin-Buch. Inventor/es: BLANKENSTEIN, THOMAS, OBENAUS,MATTHIAS, LEITAO,CATARINA.

Una construcción de reconocimiento de antígenos que es un receptor de células T (TCR), que comprende (i) una región variable de la cadena alfa con CDR1, CDR2 y CDR3 que comprenden una secuencia de aminoácidos que se muestran en las SEQ ID NO: 40, 41 y 1 respectivamente; y que comprende (ii) una región variable de la cadena beta con CDR1, CDR2 y CDR3 que comprenden una secuencia de aminoácidos que se muestran en las SEQ ID NO: 46, 47 y 4 respectivamente; en donde dicho TCR se une específicamente al antígeno MAGE-A1.

PDF original: ES-2804538_T3.pdf

Anticuerpos anti-ricina y sus usos.

(08/04/2020). Solicitante/s: HER MAJESTY THE QUEEN IN RIGHT OF CANADA AS REPRESENTED BY THE MINISTER OF NATIONAL DEFENCE. Inventor/es: HU,WEI-GANG, NEGRYCH,LAUREL M, CHAU,DAMON, YIN,JUNFEI, JAGER,SCOTT J, CHERWONOGRODZKY,JOHN W.

Un anticuerpo, aislado o purificado, o fragmento de este, que comprende una cadena ligera variable que comprende una CDR L1 de secuencia KASQDINNYLR (SEQ ID NO:2), una CDR L2 de secuencia RANRLVD (SEQ ID NO:6), y una CDR L3 de secuencia LQYDEFPYT (SEQ ID NO:10); y una cadena pesada variable que comprende la CDR H1 de secuencia EYIIN (SEQ ID NO:14) una CDR H2 de secuencia WFYPGSGDIKYNEKFKD (SEQ ID NO:18), y una CDR H3 de secuencia NGRWDDDYFDY (SEQ ID NO:22), en donde el anticuerpo, aislado o purificado, o fragmento de este se une específicamente a la ricina.

PDF original: ES-2785349_T3.pdf

Composiciones para inhibir la activación del complemento dependiente de MASP-2.

(11/03/2020). Solicitante/s: OMEROS CORPORATION. Inventor/es: TEDFORD, CLARK, E., PARENT, JAMES BRIAN, GOMBOTZ, WAYNE, R., REIERSEN,Herald, KAVLIE,ANITA, DUDLER,THOMAS, HAGEMANN,URS BEAT, KIPRIJANOV,SERGEJ.

Un anticuerpo monoclonal humano aislado, o fragmento de unión a antígeno del mismo, que se une a MASP-2 humana e inhibe la activación del complemento dependiente de MASP-2, en el que el anticuerpo o el fragmento de unión a antígeno del mismo comprende: a) una región variable de la cadena pesada que comprende el aminoácido expuesto en la SEQ ID NO: 20; y b) una región variable de la cadena ligera que comprende la secuencia de aminoácidos expuesta en la SEQ ID NO: 24.

PDF original: ES-2795667_T3.pdf

Anticuerpos anti-MIF para su uso en el tratamiento de enfermedades inflamatorias.

(19/02/2020). Solicitante/s: Baxalta Incorporated. Inventor/es: SCHEIFLINGER, FRIEDRICH, THIELE, MICHAEL, KERSCHBAUMER,RANDOLF, RIEGER,MANFRED, HOET,René, MUDDE,C. GEERT, MUELLBERG,JÜRGEN.

Anticuerpo monoclonal o parte de unión a antígeno del mismo que se une específicamente a la región que abarca los aa 50-68 o la región que abarca los aa 86-102 de MIF humano, e inhibe la función biológica de MIF humano, para su uso en el tratamiento de una enfermedad inflamatoria.

PDF original: ES-2791333_T3.pdf

Anticuerpos antagonistas anti-receptor de IL-7 y procedimientos.

(12/02/2020) Un anticuerpo aislado que se une específicamente a receptor de interleucina 7 alfa (IL-7Rα), en el que el anticuerpo se une a un epítopo que comprende los restos I82, K84, K100, T105 y Y192 del receptor de interleucina 7 alfa humano (IL-7Ra), y en el que el anticuerpo se compone: una región variable de cadena ligera (VL) que comprende un VL CDR1 con la secuencia aminoacídica que se muestra en la SEQ ID NO:29, un VL CDR2 con la secuencia aminoacídica que se muestra en la SEQ ID NO:31, y un VL CDR3 con la secuencia aminoacídica que se muestra en la SEQ ID NO:36; y una de: (i) una región variable de cadena pesada (VH) que comprende un VH CDR1 con la secuencia aminoacídica que se…

Anticuerpos monoclonales anti-gpc-1 y usos de los mismos.

(25/12/2019) Una población de anticuerpos monoclonales aislada que comprende: primeros anticuerpos y/o fragmentos de unión al antígeno de los mismos, en la que los primeros anticuerpos y/o fragmentos de unión al antígeno de los mismos comprenden: (a) una región variable de la cadena pesada que comprende: una región determinante de complementariedad 1 (CDR1) que comprende o que consiste en una secuencia de aminoácidos definida por las posiciones 50-54 de la SEQ ID NO: 3; una región determinante de complementariedad 2 (CDR2) que comprende o que consiste en una secuencia de aminoácidos definida por las posiciones 69-85 de la SEQ ID NO:…

Anticuerpos anti-cd40 y usos de los mismos.

(11/12/2019). Solicitante/s: AbbVie Inc. Inventor/es: WANG,Rui, HSIEH,CHUNG-MING, BENATUIL,LORENZO, ARGIRIADI,MARIA A, HARLAN,JOHN E, JUDGE,RUSSELL A, EGAN,DAVID A, MCRAE,BRADFORD L, KINGSBURY,GILLIAN A.

Un anticuerpo anti-CD40 que comprende una cadena pesada que comprende una secuencia de aminoacidos como se establece en SEQ ID NO: 41, y una cadena ligera que comprende una secuencia de aminoacidos como se establece en SEQ ID NO: 40.

PDF original: ES-2774016_T3.pdf

Humanización de anticuerpos de conejo usando un armazón de anticuerpo universal.

(13/11/2019). Solicitante/s: NOVARTIS AG. Inventor/es: URECH,DAVID, BORRAS,LEONARDO.

Anticuerpo o fragmento de unión a antígeno del mismo que comprende: (i) CDR1, CDR2 y CDR3 de la cadena ligera de un anticuerpo lagomorfo donador o fragmento de unión a antígeno del mismo y CDR1, CDR2 y CDR3 de la cadena pesada de un anticuerpo lagomorfo donador o fragmento de unión a antígeno del mismo; (ii) un armazón de la cadena ligera humana variable que comprende una secuencia de aminoácidos que es idéntica en al menos un 85 % con respecto a la secuencia SEQ ID NO: 2; y (iii) un armazón de la cadena pesada humana variable, en donde la secuencia de aminoácidos del armazón de la cadena pesada variable es idéntica en al menos un 85 % con respecto a la secuencia SEQ ID NO: 4 y comprende al menos cuatro de los siguientes aminoácidos: treonina (T) en la posición 24, alanina (A) o glicina (G) en la posición 56, treonina (T) en la posición 84, valina (V) en la posición 89 y arginina (R) en la posición 108 (numeración AHo).

PDF original: ES-2771150_T3.pdf

Anticuerpos anti-CD83 y uso de los mismos.

(13/11/2019). Solicitante/s: Kira Biotech Pty Limited. Inventor/es: MAHLER, STEPHEN, MICHAEL, MARKS,JAMES,D, SELDON,THERESE ANN, MUNSTER,DAVID JOHN, HART,DEREK NIGEL JOHN, JONES,MARTINA LOUISE, MUNRO,TRENT PHILLIP, ZHOU,EUNICE YU.

Una proteína que se une a CD83 aislada o recombinante que comprende un dominio que se une a antígeno de un anticuerpo que se une específicamente a CD83 y comprende una región variable de la cadena pesada (VH) y una región variable de la cadena ligera (VL), en donde: (a) la región variable de la cadena pesada (VH) comprende la secuencia de aminoácidos que se muestra en SEQ ID NO: 1; y (b) la región variable de la cadena ligera (VL) comprende la secuencia de aminoácidos que se muestra en SEQ ID NO: 7.

PDF original: ES-2762622_T3.pdf

Proteínas VL de unión a antígeno que exhiben diferentes características de unión.

(30/10/2019) Un método para producir una proteína VL de unión a antígeno que se une específicamente a un esteroide que comprende las etapas de: (a) inmunizar un ratón genéticamente modificado con dicho esteroide o dicho esteroide unido a un vehículo, en donde el ratón genéticamente modificado comprende (i) segmentos génicos variables de cadena ligera (VL) y de unión de cadena ligera (JL) de inmunoglobulina humanos no reordenados unidos operativamente a una secuencia de ácido nucleico de región constante de cadena pesada de inmunoglobulina de ratón y (ii) segmentos génicos variables de cadena ligera (VL) de inmunoglobulina y de unión de cadena ligera (JL) de inmunoglobulina…

Agentes de unión selectiva antagonistas de proteína que se une a osteoprotegerina.

(16/10/2019). Solicitante/s: AMGEN INC.. Inventor/es: BOYLE, WILLIAM, J., DESHPANDE,RAJENDRA,V, HITZ,ANNA, SULLIVAN,John,K.

Un anticuerpo monoclonal o uno de sus dominios que se unen a antígeno que comprende uno o más cambios de aminoácido en una o más de las CDR1, CDR2 o CDR3 de la cadena pesada o ligera de un anticuerpo, en donde a) la CDR1 de VL tiene la secuencia RASQSISRYLN de SEQ ID NO: 01, la CDR2 de VL tiene la secuencia GASSLQS de SEQ ID NO: 05 y la CDR3 de VL tiene la secuencia QHTRA de SEQ ID NO: 09, y b) la CDR1 de VH tiene la secuencia NYAIH de SEQ ID NO: 13, la CDR2 de VH tiene la secuencia WINAGNGNTKFSQKFQG de SEQ ID NO: 16, y la CDR3 de VH tiene la secuencia DSSNMVRGIIIAYYFDY de SEQ ID NO: 19, que se une a una porción de la secuencia de aminoácidos GGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP de SEQ ID NO: 76 desde el residuo de aminoácido 212 hasta el residuo de aminoácido 250 de OPGbp humana, en donde el anticuerpo monoclonal o uno de sus dominios que se unen a antígeno inhibe la formación o la activación de osteoclastos mediada por OPGbp humana.

PDF original: ES-2758881_T3.pdf

Variantes de Fc optimizadas.

(08/10/2019). Solicitante/s: LABORATOIRE FRANCAIS DU FRACTIONNEMENT ET DES BIOTECHNOLOGIES. Inventor/es: BEHRENS,Christian, JORIEUX,SYLVIE, MONDON,PHILIPPE, KHARRAT,ABDELHAKIM, BOUAYADI,KHALIL, MONNET-MARS,CÉLINE.

Una variante de un polipéptido progenitor que comprende una región Fc, variante la cual exhibe mayor unión a FcRn en comparación con dicho polipéptido progenitor, y comprende al menos dos modificaciones de aminoácidos, comprendiendo las mencionadas al menos dos modificaciones de aminoácidos: (i) una modificación de aminoácido que es 434Y, y (ii) al menos una modificación de aminoácido que es 315D, o 378V, de la región Fc, en la que la numeración de los aminoácidos en la región Fc es la del índice EU como en Kabat.

PDF original: ES-2726625_T3.pdf

Anticuerpos para el tratamiento de la infección y enfermedad asociada a Clostridium difficile.

(18/09/2019). Solicitante/s: PROGENICS PHARMACEUTICALS, INC.. Inventor/es: TSURUSHITA, NAOYA, CUPO, ALBERT, OLSON,WILLIAM,C, MA,DANGSHE, KANG,Yun, KUMAR,SHANKAR, NAGASHIMA,KIRSTEN, KENNEDY,BRIAN, DONOVAN,GERALD P, MAROZSAN,ANDRE J.

Un anticuerpo aislado seleccionado de un anticuerpo monoclonal que se une específicamente a la toxina B de C. difficile producido por la línea celular de hibridoma depositada bajo el número de acceso de la ATCC PTA-9693 (PA- 41), una forma humanizada quimérica o injertada de CDR del mismo, o un fragmento de unión a antígeno del mismo; y un anticuerpo monoclonal que se une específicamente a la toxina A de C. difficile producido por la línea celular de hibridoma depositada bajo el número de acceso de la ATCC PTA-9694 (PA-50), una forma quimérica o injertada de CDR del mismo, o un fragmento de unión a antígeno del mismo.

PDF original: ES-2757675_T3.pdf

Diseño anticuerpo heterodimérico estable con mutaciones en el dominio Fc.

(04/09/2019) Un heteromultímero aislado que comprende una región Fc de IgG humana de heterodímero, donde la región Fc del heterodímero comprende un dominio CH3 variante que comprende sustituciones de aminoácidos que promueven la formación de la región Fc del heterodímero, donde la región Fc del heterodímero tiene una pureza superior al 90 %, donde el dominio CH3 variante tiene una temperatura de fusión (Tm) de 72 °C o superior, donde: (a) un primer polipéptido del dominio CH3 comprende las sustituciones de aminoácidos F405A e Y407V, y un segundo polipéptido del dominio CH3 comprende las sustituciones de aminoácidos T394W y una de T366I o T366L, o (b) un primer polipéptido del dominio CH3 comprende una sustitución de aminoácidos en la posición F405 y las sustituciones de aminoácidos L351Y e Y407V, y un segundo polipéptido del dominio…

Anticuerpos de unión a colágeno II humano.

(04/09/2019). Solicitante/s: Janssen Biotech, Inc. Inventor/es: LEE,JENNIFER, WHEELER,JOHN, PICHA,KRISTEN, ORT,TATIANA, RYAN,MARY, KEHOE,JOHN.

Un anticuerpo monoclonal aislado o fragmento del mismo que se une al colágeno II humano, que comprende una región variable de la cadena pesada (región VH) y una región variable de la cadena ligera (región VL), en donde: la región VH comprende las secuencias de la región determinante de complementariedad (CDR) de la cadena pesada 1, 2 y 3 (HCDR1, HCDR2 y HCDR3) como se muestra en las SEQ ID NO: 11, 17 y 30, respectivamente; y la región VL comprende las secuencias de la CDR de la cadena ligera1, 2 y 3 (LCDR1, LCDR2 y LCDR3) como se muestra en las SEQ ID NO: 34, 42 y 47, respectivamente.

PDF original: ES-2757857_T3.pdf

Profilaxis de cáncer colorrectal y gastrointestinal.

(21/08/2019) Anticuerpo monoclonal antiprogastrina humana (hPG) neutralizante para la utilización en la prevención del cáncer gastrointestinal en un sujeto humano, que comprende administrar a un sujeto humano predispuesto a desarrollar pólipos adenomatosos una cantidad del anticuerpo monoclonal anti-hPG suficiente para proporcionar un beneficio terapéutico, en el que dicho anticuerpo monoclonal comprende: a. una región variable de cadena pesada en la que CDR1 comprende la secuencia de aminoácidos de VH CDR 1.3 (SEC ID nº: 1), CDR2 comprende la secuencia de aminoácidos de VH CDR 2.3 (SEC ID nº: 2) y CDR3 comprende la secuencia de aminoácidos de VH CDR 3.3 (SEC ID nº: 3) y una región variable de cadena ligera en la que CDR1 comprende la secuencia de aminoácidos de VL CDR…

Anticuerpo de PD-1, fragmento de unión a antígeno del mismo y aplicación médica del mismo.

(21/08/2019). Solicitante/s: Shanghai Hengrui Pharmaceutical Co. Ltd. Inventor/es: YE, XIN, ZHANG,LIANSHAN, ZHANG,LEI, CAO,GUOQING, Yang,Li, YUAN,JIJUN, QU,XIANGDONG, LIN,JUFANG, TAO,WEIKANG.

Un anticuerpo de PD-1, o un fragmento de unión a antígeno del mismo, que comprende: una región variable de cadena ligera que comprende una LCDR1, una LCDR2 y una LCDR3 como se muestra en la SEQ ID NO: 6, SEQ ID NO: 7 y SEQ ID NO: 8, respectivamente; y una región variable de cadena pesada que comprende una HCDR1, una HCDR2 y una HCDR3 como se muestra en la SEQ ID NO: 3, SEQ ID NO: 4 y SEQ ID NO: 5, respectivamente.

PDF original: ES-2746805_T3.pdf

Anticuerpos anti-IL-12, composiciones, métodos y usos para tratar la patología de Crohn.

(24/07/2019). Solicitante/s: Centocor Research & Development, Inc. Inventor/es: KNIGHT, DAVID, M., GILES-KOMAR,JILL, PERITT,DAVID, SHEALY,DAVID, SCALLON,BERNHARD.

Un anticuerpo anti-IL-12 humano que tiene una región de unión a antígeno que comprende tres CDR de cadena pesada (CDR1, CDR2 y CDR3) que tienen las secuencias de aminoácidos de las SEQ ID NO: 1, 2 y 3, y tres CDR de cadena ligera (CDR1, CDR2 y CDR3) que tienen las secuencias de aminoácidos de las SEQ ID NO: 4, 5 y 6, para su uso en el tratamiento de la patología de Crohn.

PDF original: ES-2747573_T3.pdf

Inmunoglobulina contra la toxina del carbunco.

(24/07/2019). Solicitante/s: LABORATOIRE FRANCAIS DU FRACTIONNEMENT ET DES BIOTECHNOLOGIES. Inventor/es: BEHRENS,Christian, KLEIN,PHILIPPE, HOGUET,DENIS.

Inmunoglobulina de clase G dirigida contra el antigeno protector de la toxina del carbunco, en la que: - cada una de las cadenas pesadas comprende, o consiste en, una secuencia de aminoacidos representada por la SEQ ID No: 5, y - cada una de las cadenas ligeras comprende, o consiste en, una secuencia de aminoacidos representada por la SEQ ID No: 6.

PDF original: ES-2749646_T3.pdf

Anticuerpos antagonistas a polipéptidos heterólogos IL-17 A/F.

(24/07/2019). Solicitante/s: GENENTECH, INC.. Inventor/es: GURNEY, AUSTIN, LEE, JAMES, WU,Yan, ARNOTT,DAVID, HASS,PHILLIP.

Antagonista de un polipéptido IL-17A/F, en el que el antagonista es un anticuerpo anti-IL-17A/F, en el que el anticuerpo es un anticuerpo humanizado o humano, y en el que el polipéptido IL-17A/F es: un polipéptido aislado que comprende: (a) la secuencia de aminoácidos de un polipéptido IL-17A/F que comprende la SEQ ID NO: 3 y SEQ ID NO: 4; o (b) la secuencia de aminoácidos de un polipéptido IL-17A/F que comprende la SEQ ID NO: 3 y SEQ ID NO: 4 que carecen de sus péptidos señal asociados.

PDF original: ES-2751414_T3.pdf

Modificación genética de dominios de inmunoglobulina.

(17/07/2019). Solicitante/s: NATIONAL RESEARCH COUNCIL OF CANADA. Inventor/es: TANHA,Jamshid, KIM,DAE-YOUNG.

Un andamio de inmunoglobulina sintética que comprende uno o más de un enlace disulfuro no canónico en la región marco (FR), en la que el andamio es una cadena ligera variable (VL) y está en el formato de un dominio variable único de inmunoglobulina con tres CDR, en el que el enlace disulfuro no canónico se forma entre un residuo de Cys en la posición 46-49 de la región FR2 y un residuo de Cys en la posición 62-66 de la región FR3 de una VL, en la que dicho enlace disulfuro no canónico proporciona una estabilidad mejorada en comparación con el andamio de inmunoglobulina sin dicho enlace y en el que la numeración se refiere a la numeración de Kabat.

PDF original: ES-2746559_T3.pdf

Anticuerpos monoclonales multiespecíficos.

(10/07/2019) Un procedimiento de producción de un anticuerpo multiespecífico a partir de un anticuerpo que se une al antígeno 1 que comprende la cadena ligera LC1 y la cadena pesada HC1 y otro anticuerpo que se une a un antígeno 2 diferente que comprende la cadena ligera LC2 y la cadena pesada HC2, comprendiendo el procedimiento las etapas de: (a) identificar una región de anticuerpo variable de cadena ligera única de inmunoglobulina que complementa funcionalmente las regiones de anticuerpo variables de cadena pesada de inmunoglobulina de dichas cadenas pesadas HC1 y HC2 mediante: (i) el cribado de una biblioteca de anticuerpos generada coexpresando la región de anticuerpo variable de cadena pesada de inmunoglobulina de la cadena pesada HC1 y una biblioteca de LC1 humanas…

Anticuerpos monoclonales anti-RHD.

(03/07/2019). Solicitante/s: Bharat Serums and Vaccines Ltd. Inventor/es: DAFTARY, GAUTAM VINOD, KAUNDINYA,JOHN, CINEK,TOMAS.

Un anticuerpo monoclonal anti-RhD aislado que comprende: una región variable de cadena pesada que es al menos un 80% idéntica a la región variable de la SEQ ID NO: 10 y tiene una primera, segunda y tercera CDR que son idénticas a las respectivas primera, segunda y tercera CDR de la SEQ ID NO: 10, y una región variable de cadena ligera que es al menos 80% idéntica a la región variable de la SEQ ID NO: 12 y tiene una primera, segunda y tercera CDR que son idénticas a las respectivas primera, segunda y tercera CDR de la SEQ ID NO: 12; en el que las CDR del anticuerpo monoclonal se determinan usando la herramienta IMGT/V-QUEST.

PDF original: ES-2740051_T3.pdf

Agentes antagonistas de unión selectivos de la proteína de unión a osteoprotegerina.

(03/07/2019). Solicitante/s: AMGEN INC.. Inventor/es: BOYLE, WILLIAM, J., DESHPANDE,RAJENDRA,V, HITZ,ANNA, SULLIVAN,John,K.

Un anticuerpo o dominio de unión a antígeno que comprende una cadena ligera y una cadena pesada, donde la cadena pesada comprende una secuencia de aminoácidos que es al menos aproximadamente el 80 % idéntica a la secuencia de aminoácidos de la SEQ ID NO: 53 como se muestra en la Figura 9 y la cadena ligera comprende una secuencia de aminoácidos que es al menos aproximadamente el 80 % idéntica a la secuencia de aminoácidos de la SEQ ID NO: 45 como se muestra en la Figura 5, donde el anticuerpo o dominio de unión a antígeno se une selectivamente a OPGbp humana con una constante de disociación de 1 nM o menos e inhibe la resorción ósea.

PDF original: ES-2738798_T3.pdf

Moléculas que se acoplan a anticuerpos EGFRVIII biespecíficas humanas.

(01/07/2019). Solicitante/s: DUKE UNIVERSITY. Inventor/es: PASTAN, IRA, H., BIGNER, DARELL, D., SAMPSON,JOHN, KUAN,CHIEN-TSUN, CAI,MINGQING, CHOI,BRYAN D, GEDEON,PATRICK C.

Polipéptido biespecífico, que comprende: una primera región variable de cadena única humana que se une a EGFRvIII y comprende segmentos codificados por las SEQ ID NO: 5 y 6 en orden de extremo amino a carboxilo; en serie con una segunda región variable de cadena única humana que se une al ligando CD3 de activación de células T y comprende segmentos codificados por las SEQ ID NO: 7 y 8 en orden de extremo amino a carboxilo; en el que las primera y segunda regiones variables de cadena única humanas están en orden de extremo amino a carboxilo.

PDF original: ES-2718399_T3.pdf

Anticuerpos dirigidos hacia alfaVbeta6 y uso de los mismos.

(05/06/2019). Solicitante/s: MEDIMMUNE LIMITED. Inventor/es: FOLTZ,IAN, BEDIAN,VAHE, RINKENBERGER,JULIE, ALFRED,AVRIL, BARRY,SIMON THOMAS.

Un anticuerpo o fragmento de union al antigeno del mismo, en el que el anticuerpo se une especificamente a la integrina αVß6, comprendiendo el anticuerpo: (i) una secuencia RDC3 de la region variable de la cadena pesada que comprende a la secuencia de aminoacidos VATGRADYHFYAMDV; (ii) una secuencia RDC2 de la region variable de la cadena pesada que comprende a la secuencia de aminoacidos YIYYSGRTYNNPSLKS; (iii) una secuencia RDC1 de la region variable de la cadena pesada que comprende a la secuencia de aminoacidos GGSISSGGYYWS; (iv) una secuencia RDC3 de la region variable de la cadena ligera que comprende a la secuencia de aminoacidos YSAADNNLV; (v) una secuencia RDC2 de la region variable de la cadena ligera que comprende a la secuencia de aminoacidos KDSERPS; (vi) una secuencia RDC1 de la region variable de la cadena ligera que comprende a la secuencia de aminoacidos SGDVLAKKSAR.

PDF original: ES-2746925_T3.pdf

Anticuerpos que potencian el Factor H y sus usos.

(29/05/2019). Solicitante/s: STICHTING SANQUIN BLOEDVOORZIENING. Inventor/es: KUIJPERS,Taco Willem, WOUTERS,DIANA, BROUWER,MARIA CLARA, POUW,RICHARD BENJAMIN.

Un anticuerpo aislado, sintético o recombinante o un fragmento del mismo que se une específicamente al dominio 18 de la proteína de control del complemento (CCP18) del factor H (FH) y potencia la actividad de FH, en donde dicha actividad de FH es la inhibición de la activación alternativa del complemento, y en donde dicho anticuerpo o fragmento del mismo comprende: - una CDR1 de cadena pesada que tiene la secuencia SEQ ID NO: 5, una CDR2 de cadena pesada que tiene la secuencia SEQ ID NO: 6 y una CDR3 de cadena pesada que tiene la secuencia SEQ ID NO: 7, y - una secuencia CDR1 de cadena ligera que tiene la secuencia SEC ID NO: 1, una secuencia CDR2 de cadena ligera que tiene la secuencia SEC ID NO: 2 y una CDR3 de cadena ligera que tiene la secuencia SEC ID NO: 3.

PDF original: ES-2739609_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · 9 · 10 · 11 · 12 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .