CIP 2015 : C07K 14/575 : Hormonas.

CIP2015CC07C07KC07K 14/00C07K 14/575[2] › Hormonas.

Notas[t] desde C01 hasta C14: QUIMICA



C07K PEPTIDOS (péptidos que contienen β -anillos lactamas C07D; ipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina diones-2,5, C07D; alcaloides del cornezuelo del centeno de tipo péptido cíclico C07D 519/02;   proteínas monocelulares, enzimas C12N; procedimientos de obtención de péptidos por ingeniería genética C12N 15/00).

C07K 14/00 Péptidos con más de 20 aminoácidos; Gastrinas; Somatostatinas; Melanotropinas; Sus derivados.

C07K 14/575 · · Hormonas.

CIP2015: Invenciones publicadas en esta sección.

Compuestos coagonistas de GIP y GLP-1.


Un compuesto de Fórmula: YX1EGTFTSDYSIX2LDKIAQKAX3VQWLIAGGPSSGAPPPS; en la que X1 es Aib; X2 es Aib; K en la posición 20 se modifica químicamente a través de la conjugación al grupo épsilon-amino de la cadena lateral K con ([2-(2-Amino-etoxi)-etoxi]-acetil)2-(γGlu)a-CO-(CH2)b-CO2H en la que a es 1 a 2 y b es 10 a 20; X3 es Phe o 1-NaI; y el aminoácido del extremo terminal C está opcionalmente amidado como una amida primaria del extremo terminal C (SEQ ID NO:11), o una de sus sales aceptables para uso farmacéutico.

PDF original: ES-2747928_T3.pdf

Polipéptidos escindibles por enteroquinasa.

(07/08/2019). Solicitante/s: NOVO NORDISK A/S. Inventor/es: BRANDT, JAKOB, OLESEN,KJELD.

Método para producir un polipéptido diana, dicho método que comprende las etapas: a) expresar el polipéptido de fusión escindible por Enteroquinasa que comprende el polipéptido de la fórmula: Z2-X6-X5-X4-G-D-R-Z1 (I) SEQ ID NO: 1 en donde Z1 es un polipéptido que comprende al menos 2 residuos de aminoácidos; X4 es E, Q, L, D, G, A, S, F, H, Y, W, T o M; X5 se selecciona de los aminoácidos codificados genéticamente, excepto S e I; X6 está ausente o se selecciona de los aminoácidos codificados genéticamente; Z2 es un polipéptido o residuo de aminoácido opcional; en donde dicho polipéptido diana es Z1 en la fórmula (I); b) poner en contacto dicho polipéptido de fusión escindible por Enteroquinasa con una Enteroquinasa en condiciones que facilitan la escisión; y c) aislar opcionalmente dicho polipéptido diana; en donde al menos uno de X4 y X5 es E o D.

PDF original: ES-2754271_T3.pdf

Transformante utilizado para perder peso y reducir la grasa, procedimiento de construcción para el transformante y aplicación del transformante.

(24/07/2019). Solicitante/s: Nanjing Sinogen Biotech & Pharmaceutical Inc. Inventor/es: XIANG,RONG, LIN,YAN, ZHAO,ALLANZIJIAN, LI,FANGHONG.

Transformante para la pérdida de peso y la reducción de lípidos en sangre, en el que el transformante se obtiene sustituyendo el gen thyA de L. lactis por el gen de oxintomodulina humana optimizado por codones mediante recombinación homóloga.

PDF original: ES-2750685_T3.pdf

Procedimiento in vitro para la detección de la leptina mutada y el uso de un reactivo de detección.

(22/05/2019) Procedimiento in vitro para la detección de leptina mutada, caracterizado porque el procedimiento comprende las siguientes etapas: - determinar la unión de la leptina no mutada que proviene del suero o plasma al receptor de leptina humano, que se une a la leptina no mutada, pero no se une a la leptina mutada, o se une con un máximo del 50 % del valor de enlace de la leptina no mutada, obteniendo un primer valor de enlace, en el que en la secuencia de aminoácidos, la leptina mutada presenta al menos una de las siguientes sustituciones de aminoácidos: D100Y, N103K, L72S, R105W, G133V, S141C y/o L161G, preferentemente D100Y, N103K y/o L72S, más preferentemente D100Y, - determinar la unión tanto de la leptina mutada como de la leptina no mutada que proviene del suero o plasma…

Formulaciones novedosas de agonistas de la exendina y métodos de administración de los mismos.

(15/05/2019). Solicitante/s: Amylin Pharmaceuticals, LLC. Inventor/es: YOUNG, ANDREW, L\'ITALIEN, JAMES, J., KOLTERMAN, ORVILLE.

Una formulación farmacéutica que es una forma farmacéutica líquida estable adecuada para la administración en múltiples usos que comprende del 0, 005% al 0, 4% (p/v) de un péptido de exendina o de un agonista de la exendina, una solución amortiguadora, un modificador de la iso-osmolalidad, y de un 0, 005% a un 1, 0% en p/v de un conservante seleccionado entre el grupo del m-cresol, fenol, alcohol bencílico, metilparabeno, etilparabeno, propilparabeno y butilparabeno , presentando dicha formulación un pH entre 4, 0 y 6, 0.

PDF original: ES-2244416_T3.pdf

PDF original: ES-2244416_T5.pdf

Péptido para el tratamiento de la diabetes mellitus tipo 2 y sus complicaciones.


Un compuesto representado por la siguiente fórmula: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln- Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg- D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH.

PDF original: ES-2711841_T3.pdf

Conjugado que comprende oxintomodulina y un fragmento de inmunoglobulina, y uso del mismo.

(24/04/2019). Solicitante/s: Hanmi Science Co., Ltd. . Inventor/es: KWON, SE CHANG, JUNG, SUNG YOUB, CHOI,IN-YOUNG, KIM,DAE-JIN, PARK,SUNG HEE, WOO,YOUNG EUN.

Un conjugado que comprende un derivado de oxintomodulina que comprende la secuencia de aminoácidos de la SEQ ID NO: 24, 25 o 26, una región Fc de inmunoglobulina y un polímero no peptidilo, en el que el polímero no peptidilo une covalentemente el derivado de oxintomodulina y la región Fc de inmunoglobulina.

PDF original: ES-2710356_T3.pdf

Compuestos de PYY selectivos y sus usos.

(17/04/2019) Un compuesto de PYY que es capaz de unirse al receptor Y2 humano que comprende i) triptófano en la posición correspondiente a la posición 30 de hPYY , ii) N(alfa)-metil-L-arginina en una posición correspondiente a la posición 35 de hPYY , iii) lisina en una posición correspondiente a la posición 7 de hPYY y un grupo modificador unido al grupo amino épsilon de dicha lisina, en donde dicho grupo modificador se define por A-B-C-, en donde A- se selecciona de**Fórmula** en donde a es un número entero de 12 a 19, b es un número entero de 10 a 16, y c es un número entero de 10 a 16, y en donde * denota el punto de unión a -B-, en donde…

Análogos de cortistatina y síntesis y usos de los mismos.

(16/04/2019) Un compuesto de Fórmula:**Fórmula** o una sal farmacéuticamente aceptable o una sal de amina cuaternaria del mismo; en donde: m es 0, 1, 2, 3 o 4; R1 y R2 se unen para formar un anillo de fórmula:**Fórmula** n es 0, 1, 2, 3 o 4; cada instancia de R6A es independientemente halógeno, -NO2, -CN, -OR6C, SR6C, N(R6C)2, -C(=O)R6C, - C(=O)OR6C, -C(=O)N(R6C))2, alquilo opcionalmente sustituido, alquenilo opcionalmente sustituido, alquinilo opcionalmente sustituido, carbociclilo opcionalmente sustituido, heterociclilo opcionalmente sustituido, arilo opcionalmente sustituido, o heteroarilo opcionalmente sustituido; en donde cada caso de R6C es independientemente hidrógeno, alquilo opcionalmente…

Péptidos terapéuticos.

(10/04/2019). Solicitante/s: GlaxoSmithKline Intellectual Property Development Limited. Inventor/es: WU,YULIN, DOCK,STEVEN THOMAS, CARPENTER,ANDREW JAMES, HUNTER,III ROBERT NEIL, SRIVASTAVA,VED P.

Un polipéptido que consiste en la secuencia de aminoácidos: ProLysProGluXaa1 ProGlyXaa 2 AspAlaSerXaa 3 GluGluXaa 4Xaa5 Xaa6TyrTyrAlaXaa7LeuArgXaa8TyrXaa9AsnTrpXaa10ThrArgGlnArgTyr-NH2 (SEQ ID NO:2) o una sal del mismo, en la que: Xaa1 es Ala, His o Ser; Xaa2 es Glu o Lys; Xaa3 es Pro o Ala; Xaa4 es Leu o Trp; Xaa5 es Asn, Ala o Thr; Xaa6 es Arg o Lys; Xaa7 es Ser, Asp o Ala; Xaa8 es Hiso Lys; Xaa9 es Leu o Ile; y Xaa10 es Val o Leu.

PDF original: ES-2732291_T3.pdf

Péptidos derivados de neuropéptidos y.

(27/03/2019) Un péptido derivado del neuropéptido Y (NPY) (SEQ ID NO: 22), donde dicho péptido se selecciona del grupo que consiste en: un péptido que consiste en 32 residuos de aminoácidos contiguos que tienen la secuencia KPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY4-35, SEQ ID NO: 2) o KPDNPGEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos, un péptido que consiste en 27 residuos de aminoácidos contiguos que tienen la secuencia GEDAPAEDMARYYSALRHYINLITRQR (NPY9-35, SEQ ID NO: 7) o GEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos, un péptido que consiste en 26 residuos de aminoácidos contiguos que tienen la secuencia EDAPAEDMARYYSALRHYINLITRQR (NPY10-35, SEQ ID NO: 8) o EDAPAEDMARYYSALRHYINLITRQR con…

Polipéptidos modificados por ingeniería genética que tienen una duración potenciada de la acción y una inmunogenicidad reducida.

(27/03/2019). Solicitante/s: Aegerion Pharmaceuticals, Inc. Inventor/es: GHOSH, SOUMITRA, S., LITZINGER, DAVID, C., EKBLAD,CAROLINE, ROTH,JONATHAN DAVID, ERICKSON,MARY, GUO,ZIJIAN.

Un polipéptido modificado por ingeniería genética que comprende: un polipéptido con dominio de unión a la albúmina (ABD) y un primer dominio hormonal peptídico (HD1) que comprende una leptina, un análogo de leptina que tiene al menos un 50 % de identidad de secuencia con la leptina original o un fragmento activo de la misma, en el que dicho ABD comprende al menos un 95 % de identidad con SEQ ID NO: 300, con la condición de que X14 se seleccione entre A, S y C; con la condición de que X7 no sea L, E o D; o como alternativa, con la condición de que la secuencia de aminoácidos no sea la SEQ ID NO: 679.

PDF original: ES-2732475_T3.pdf

Polipéptidos reguladores de glucosa y métodos para su producción y uso.

(22/03/2019) Un acido nucleico aislado que comprende una secuencia de polinucleotido que codifica una proteina de fusion, que comprende un peptido regulador de la glucosa (GP), en donde la secuencia de polinucleotido (i) comprende una secuencia que hibrida en condiciones rigurosas con AE864 de la tabla 9 (SEQ ID NO: 243) o Ex4-AE864 de la tabla 36 (SEQ ID NO: 897) o el complemento de las mismas y tiene al menos un 70 % de identidad de secuencia o un 80 % o un 90 % o un 95 % o un 97 % o un 98 % o un 99 % hasta un 100 % de identidad de secuencia respecto de AE864 de la tabla 9 (SEQ ID NO: 243) o Ex4-AE864 de la tabla 36 (SEQ ID NO: 897) o el complemento de las mismas, y (ii) codifica una proteina de fusion que comprende (a) exendina-4 y que tiene una secuencia de aminoacidos que muestra al…

Agonistas del péptido CRHR2 y usos de los mismos.


Un péptido que tiene actividad agonista hacia el receptor de la hormona liberadora de corticotropina tipo 2, dicho péptido tiene una secuencia de aminoácidos seleccionada del grupo que consiste de las SEQ ID NO 2, 3, 4, 5, 6, 7, 9, 10, 11, 12 , 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 39 , 40, y 41; o una sal o amida farmacéuticamente aceptable del mismo.

PDF original: ES-2723098_T3.pdf

Péptidos antagonistas de CRF cíclicos.

(11/03/2019) Un péptido antagonista del factor liberador de corticotropina (CRF) cíclico, o una sal farmacéuticamente aceptable del mismo, péptido que tiene la secuencia de aminoácidos: **(Ver secuencia)** en la que Y es H, Tyr o D-Tyr o un grupo acilo que tiene hasta 20 átomos de carbono, preferiblemente hasta 12 átomos de carbono, y más preferiblemente de 1 a 7 átomos de carbono, R1 es Asp o des-R1; R2 es Leu o des-R2; R3 es Ser o Thr o des-R3; D-Xaa es D-Phe, D-Leu, D-Tyr, D-Cpa, D-pNO2Phe, D-Nal, D-Trp, D-Aph(Cbm) o D-Pal; R5 es His, Tyr o Glu; R6 es CML o Leu; R7 es Leu o CML; R9 es Glu, CML, Asn o Lys; R10 es Val, CML, Nle o Met; R11 es Leu, CML o Ile; R12 es Glu, D-Glu o His; R13 es Nle, Leu, Nva o Met; R14 es Ala, D-Ala, Aib, Dpg, Thr, D-Thr, Glu o D-Glu; R15 es Arg, Orn o Lys; R16 es Ala, Aib, Dpg o CML; R17 es Glu o Asp; R18 es Gln, Asn o Lys;…

hPYY (1-36) con sustitución de beta-homoarginina en la posición 35.


Un compuesto de PYY que comprende L-beta-homoarginina en una posición correspondiente a la posición 35 de hPYY (SEQ ID NO:1), y una sal farmacéuticamente aceptable de este.

PDF original: ES-2727721_T3.pdf

Bioconjugados no aglomerantes de compuestos miméticos de amilina y polietilenglicol.

(27/02/2019) Bioconjugados no aglomerantes de amilina humana y polietilenglicol, en los que dicho bioconjugado contiene al menos una unidad de polietilenglicol unida covalentemente al átomo de nitrógeno que forman los restos alfa y/o épsilon (cadena lateral) del resto de lisina 1 de la cadena polipeptídica de amilina; en el que los bioconjugados no aglomerantes de compuestos de amilina humana y polietilenglicol, tienen la fórmula I (R1-COX)m-R2 donde R1 representa un resto de metoxipolietilenglicol (mPEG) y espaciadores funcionales con distintos pesos molares medios, R2 representa la amilina humana, X representa NH u O, m representa el número de unidades del polímero de mPEG (R1) conjugado con la amilina humana (R2) obtenido de la conjugación de mPEG-succinimidilo…

Procedimiento para aumentar la biomasa vegetal.

(06/02/2019). Solicitante/s: BioMass Booster, S.L. Inventor/es: MARTINEZ RAMIREZ,Alfredo, ARENAS VIDAL,JORGE CONRADO.

Un procedimiento para aumentar la biomasa de un organismo fotosintético que comprende cultivar dicho organismo fotosintético en presencia de un péptido que comprende: i. la secuencia de aminoácidos que se muestra en la SEQ ID NO: 3; o ii. Una variante funcional del péptido definido en (i), en el que dicha variante es un péptido cuya secuencia de aminoácidos tiene un grado de identidad con respecto a la secuencia de aminoácidos que se muestra en la SEQ ID NO: 3 de al menos el 70 % y mantiene su capacidad para aumentar la biomasa de un organismo fotosintético, y en el que dicha variante comprende la secuencia de aminoácidos Cys-Xaa1-Xaa2-Xaa3-Xaa4-Cys [SEQ ID NO 1] en la que Xaa1, Xaa2, Xaa3 y Xaa4, representan independientemente un aminoácido, y los restos de cisteína de la secuencia de aminoácidos que se muestra en la SEQ ID NO: 1 forman un puente disulfuro entre ellos, en el que dicho péptido está presente en una concentración entre 10-8 M y 10-16 M.

PDF original: ES-2698835_T3.pdf

Derivados de exendina-4 como agonistas selectivos del receptor de glucagón.


Un compuesto peptídico que tiene la fórmula (I):**Fórmula** X10 representa un residuo aminoacídico seleccionado de Tyr, Leu, Val, Ile, Phe, fenilglicina, 1-naftilalanina, 2- fluorofenilalanina, ciclohexilglicina y terc-leucina, X14 representa un residuo aminoacídico seleccionado de Leu y Nle X21 representa un residuo aminoacídico seleccionado de Asp y Glu, X29 representa un residuo aminoacídico seleccionado de Gly y Thr, R1 representa OH o NH2 o una sal o solvato de este.

PDF original: ES-2691534_T3.pdf



La presente invención se refiere a la formación de nanoconjugados que presentan actividad antitumoral, principalmente frente al cáncer de próstata avanzado,pero sin descartar otros. Los nanoconjugados están formados por sistemas dendríticos (dendrímeros o dendrones) y neuropéptidos. Las moléculas dendríticas son principalmente de estructura carbosilano con funciones amonio en la periferia. Los péptidos son preferentemente de la familia glucagón/secretina (ej.: VIP, GHRH, PACAP). La combinación de estos dos sistemas da lugar a un nanoconjugado con propiedades anticancerígenas, diferentes a las de sus precursores por separado. La actividad antitumoral se refleja en la inhibición de crecimiento y muerte de células tumorales de cáncer de próstata avanzado (PC3) y además estos nanoconjugados favorecen la adhesión celular y evitan procesos de migración de las células tumorales, es decir, procesos de metástasis.

Nanoconjugados formados por moléculas dendríticas y péptidos como agentes antitumorales frente al cáncer.

(31/07/2018) Nanoconjugados formados por moléculas dendríticas y péptidos como agentes antitumorales frente al cáncer La presente invención se refiere a la formación de nanoconjugados que presentan actividad antitumoral, principalmente frente al cáncer de próstata avanzado, pero sin descartar otros. Los nanoconjugados están formados por sistemas dendríticos (dendrímeros o dendrones) y neuropéptidos. Las moléculas dendríticas son principalmente de estructura carbosilano con funciones amonio en la periferia. Los péptidos son preferentemente de la familia glucagón/secretina (ej.: VIP, GHRH, PACAP). La combinación de estos dos sistemas da lugar a un nanoconjugado con propiedades anticancerígenas, diferentes a las de sus precursores por separado. La actividad antitumoral se refleja…

Análogo de exendina-4 pegilado con polietilenglicol o derivado del mismo, método de preparación del mismo y composición farmacéutica para evitar o tratar diabetes, que contiene el mismo como principio activo.

(04/04/2018). Solicitante/s: Theraly Pharmaceuticals Inc. Inventor/es: KIM, WON-BAE, LEE,SUNG KWON, LEE,SEULKI, KIM,TAE HYUNG.

Un analogo de exendina-4 en el que hay introducida una cisteina (Cys) en el sitio no. 40 del extremo terminal-C de la exendina-4 esta PEGilado con un tipo trimerico de polietilenglicol (PEG) o un derivado del mismo, en donde el derivado de polietilenglicol esta seleccionado entre succinimidilpropionato de metoxipolietilen glicol, metoxipolietilenglicol N-hidroxisuccinimida, metoxipolietilenglicol propionaldehido, metoxipolietilenglicol maleimida.

PDF original: ES-2674581_T3.pdf

Vacuna de ADN.


Un vector de expresión que codifica un polipéptido del antígeno de la nucleocápsida del virus de la hepatitis B quimérico insertado con una secuencia de aminoácidos que comprende un epitopo específico de angiotensina II, para su uso en un método para el tratamiento o la mejora de la hipertensión en un mamífero, en el que la secuencia de aminoácidos que comprende el epitopo específico se inserta entre los restos aminoácidos 80 y 81 del polipéptido del antígeno de la nucleocápsida del virus de la hepatitis B, en el que la secuencia de aminoácidos que comprende el epitopo específico es la secuencia de aminoácidos mostrada en SEQ ID NO:16, y en el que el vector de expresión comprende además una secuencia inmunoestimuladora (ISS) que consiste en la secuencia de nucleótidos mostrada en SEQ ID NO:22 incorporada en el vector de expresión y que expresa el polipéptido del antígeno de la nucleocápsida del virus de la hepatitis B quimérico en una célula en el mamífero.

PDF original: ES-2668672_T3.pdf

Proceso para la purificación del factor estimulador de colonias de granulocitos, G-CSF.

(28/02/2018). Solicitante/s: OCTAPHARMA AG. Inventor/es: WINGE, STEFAN, GILLJAM,GUSTAV, TIEMEYER,MAYA.

Un proceso de purificación del factor estimulador de colonias de granulocitos recombinante humano (rhG-CSF) en una secuencia de purificación empleando cromatografía, caracterizado porque - al menos una cromatografía se realiza usando resina Capto MMCTM, - rhG-CSF se une a la resina Capto MMCTM a un pH entre 4 y 6, y - el rhG-CSF se eluye a un pH entre 5,5 y 6,5 y en donde la elución se realiza con arginina que tiene una concentración en el rango de 0,1 M a 2,0 M, - opcionalmente en combinación con una etapa de cromatografía de afinidad por ligando que emplea un fragmento Fab derivado de levadura dirigido contra el rhG-CSF.

PDF original: ES-2670827_T3.pdf

Uso de folistatina o de un inhibidor de activina para prevenir o tratar la disfunción del injerto de tejido.

(28/02/2018). Solicitante/s: Paranta Biosciences Limited. Inventor/es: DE KRETSER,DAVID, O'HEHIR,ROBYN.

Folistatina o un inhibidor de activina para el uso en el tratamiento de la disfunción del tejido de injerto de mamífero, en el que el inhibidor de activina es un antagonista de activina o una molécula proteica o no proteica que inhibe la transcripción o traducción del gen de activina, y en el que dicha folistatina o inhibidor de activina se administra: (i) al donante del injerto antes de la retirada del injerto, (ii) al tejido de injerto antes de su retirada del donante, (iii) al tejido de injerto posteriormente a su retirada del donante, pero antes de su trasplante, o (iv) al receptor antes del trasplante.

PDF original: ES-2663993_T3.pdf

Procedimientos, sistemas y composiciones para estimular la recuperación de la neuropatía periférica.


Composición que comprende timosina β4 para su utilización en el tratamiento para estimular la recuperación de la neuropatía periférica en un sujeto, comprendiendo dicho tratamiento administrar a un sujeto que necesita dicho tratamiento una cantidad terapéuticamente eficaz de dicha composición.

PDF original: ES-2668815_T3.pdf

Derivados de pramlintida.

(27/12/2017). Solicitante/s: NOVO NORDISK A/S. Inventor/es: KRUSE, THOMAS, TH GERSEN, HENNING, SCHÄFFER,LAUGE.

Un polipéptido que comprende una secuencia de aminoácidos que es un análogo de SEQ ID No: 2 en donde dicho análogo se selecciona del grupo constituido por [Glu14,His17,Pro37]-pramlintida, [Glu14,His17,His35]-pramlintida, Glu-[Glu14,His17,His35]-pramlintida y [Glu14,Arg17,His35]-pramlintida; en donde la numeración de la secuencia de aminoácidos del análogo corresponde a la secuencia de numeración de los aminoácidos de SEQ ID No: 2 y en donde dicho polipéptido comprende un sustituyente N-alfa-[(S)-4-Carboxy-4-(19-carboxynonadecanoilamino)butirilo].

PDF original: ES-2664509_T3.pdf

Derivados de amilina.

(20/12/2017) Un derivado de amilina que comprende una secuencia de aminoácidos de Fórmula 1: **(Ver secuencia)** donde Xaa1 se elimina o se selecciona independientemente entre Lys, Arg, His y Glu; Xaa3 se selecciona independientemente entre Asn y Lys; Xaa14 se selecciona independientemente entre Glu, Asn, Gln y Asp; Xaa17 se selecciona independientemente entre His o Arg; Xaa18 se selecciona independientemente entre His o Arg; Xaa21 se selecciona independientemente entre Asp, Asn y Gln; Xaa24 se selecciona independientemente entre Glu y Gly; Xaa25 se selecciona independientemente entre Ala y Pro; Xaa26 se selecciona…

Polipéptidos de acción prolongada y usos de estos.

(13/12/2017). Solicitante/s: OPKO Biologics Ltd. Inventor/es: FARES,FUAD, FIMA,UDI EYAL.

Un polipéptido modificado con CTP que comprende un péptido de interferón-beta 1 (IFNß1) y dos péptidos carboxi terminal de la gonadotropina coriónica, en donde el primer péptido carboxi terminal de la gonadotropina coriónica se une al amino terminal de dicho péptido de interferón-beta 1, y el segundo péptido carboxi terminal de la gonadotropina coriónica se une al carboxi terminal de dicho péptido de interferón-beta 1, en donde el péptido carboxi terminal de la gonadotropina coriónica es de la subunidad beta de la gonadotropina coriónica humana y comprende la secuencia de aminoácidos SSSSKAPPPS, y en donde dicho péptido de interferón-beta 1 muestra actividad de interferón.

PDF original: ES-2663365_T3.pdf

Variantes de unión de anti-albúmina de suero mejoradas.


Un dominio variable único de inmunoglobulina de anti-albúmina sérica (SA) que comprende la secuencia de aminoácidos de la SEQ ID NO: 2.

PDF original: ES-2655071_T3.pdf

Antagonistas peptídicos de la familia calcitonina CGRP de hormonas peptídicas y su uso.

(26/07/2017) Un antagonista del péptido relacionado con el gen de la calcitonina que tiene la estructura de Fórmula I: X1-Y1-Z1 (I), en la que X1 comprende X11-X12-X13-X14-X15-X16-X17 (SEQ ID NO: 16), en la que X11 se selecciona del grupo que consiste en alanina (Ala), cisteína (Cys) y glicina (Gly), y en la que X12 se selecciona del grupo que consiste en cisteína (Cys) y serina (Ser), siempre que uno de X11 y X12 sea Cys; X13 se selecciona del grupo que consiste en arginina (Arg), asparagina (Asn), ácido aspártico (Asp) y valina (Val); X14 se selecciona del grupo que consiste en leucina (Leu), fenilalanina (Phe) y treonina (Thr); X15 se selecciona del grupo que consiste en alanina (Ala), glicina (Gly) y serina (Ser); X16 se selecciona del grupo que consiste en alanina (Ala),…

1 · · 3 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .