CIP 2015 : A61K 38/22 : Hormonas (derivados de pro-opiomelanocortina, pro-encefalina o pro-dinorfina A61K 38/33, p. ej. corticotropina A61K 38/35).

CIP2015AA61A61KA61K 38/00A61K 38/22[3] › Hormonas (derivados de pro-opiomelanocortina, pro-encefalina o pro-dinorfina A61K 38/33, p. ej. corticotropina A61K 38/35).

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 38/00 Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama A61K 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, A61K 31/00; péptidos basados en la ergolina A61K 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente A61K 31/74; preparaciones medicinales que contienen antígenos o anticuerpos A61K 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de fármacos, A61K 47/00).

A61K 38/22 · · · Hormonas (derivados de pro-opiomelanocortina, pro-encefalina o pro-dinorfina A61K 38/33, p. ej. corticotropina A61K 38/35).

CIP2015: Invenciones publicadas en esta sección.

Composición para uso en el tratamiento de dismotilidad gastrointestinal.

(08/05/2019). Solicitante/s: IPSEN PHARMA. Inventor/es: DONG, ZHENG, XIN, DATTA,RAKESH.

Un compuesto seleccionado del grupo que consiste en: H-Inp-D-Bal-D-Trp-Phe-Apc-NH2; H-Inp-D-2-Nal-D-Trp-Phe-Apc-NH2; H-Inp-D-Bal-D-Trp-Taz-Apc-NH2; H-Inp-D-Bal-D-Trp-2-Thi-Apc-NH2; H-Inp-D-Bal-D-Trp-Phe-Lys-NH2; H-Apc-D-1-Nal-D-Trp-2-Thi-Apc-NH2; y H-Apc-D-1-Nal-D-Trp-2-Thi-NH2, o una sal farmacéuticamente aceptable de cualquiera de los mismos, para uso en el tratamiento de una afección de dismotilidad gastrointestinal seleccionada entre enfermedad de reflujo gastroesofágico (GERD), IBS, estreñimiento, íleo, emesis, gastroparesis y pseudo-obstrucción colónica, en un paciente.

PDF original: ES-2740108_T3.pdf

Péptido para el tratamiento de la diabetes mellitus tipo 2 y sus complicaciones.

(07/05/2019). Solicitante/s: Cryno LLC. Inventor/es: TITOV,MIKHAIL IVANOVICH, ELISEEV,IVAN IVANOVICH, MAKAROV,VALERY GENNADYEVICH, MAKAROVA,MARINA NIKOLAEVNA, SHEKUNOVA,ELENA VASILYEVNA, KASHKIN,VLADIMIR ALEKSANDROVICH.

Un compuesto representado por la siguiente fórmula: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln- Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg- D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH.

PDF original: ES-2711841_T3.pdf

Compuestos para el tratamiento de la obesidad y procedimientos de uso de los mismos.

(22/04/2019) Una formulación farmacéutica para su uso en inducir la pérdida de peso en un paciente preobeso, obeso, o con obesidad mórbida; reducir la grasa corporal en un paciente preobeso, obeso, o con obesidad mórbida; reducir la ingesta de alimento en un paciente preobeso, obeso, o con obesidad mórbida; mejorar la homeostasia de la glucosa en un paciente preobeso, obeso, o con obesidad mórbida; o combinaciones de los mismos; que comprende un compuesto definido por la Fórmula I o un enantiómero o un diastereoisómero de la misma; o una mezcla de enantiómeros, una mezcla de diastereoisómeros o una mezcla racémica de los mismos:**Fórmula** en la que R1 -R7 son independientemente…

Compuestos de PYY selectivos y sus usos.

(17/04/2019) Un compuesto de PYY que es capaz de unirse al receptor Y2 humano que comprende i) triptófano en la posición correspondiente a la posición 30 de hPYY , ii) N(alfa)-metil-L-arginina en una posición correspondiente a la posición 35 de hPYY , iii) lisina en una posición correspondiente a la posición 7 de hPYY y un grupo modificador unido al grupo amino épsilon de dicha lisina, en donde dicho grupo modificador se define por A-B-C-, en donde A- se selecciona de**Fórmula** en donde a es un número entero de 12 a 19, b es un número entero de 10 a 16, y c es un número entero de 10 a 16, y en donde * denota el punto de unión a -B-, en donde…

Composiciones del dominio de fibronectina estabilizados, métodos y usos.

(17/04/2019). Solicitante/s: Janssen Biotech, Inc. Inventor/es: JACOBS,STEVEN.

Un polipéptido que comprende una molécula de base de armazón que comprende dominios en giro topológicamente similares a dominios del tercer dominio de fibronectina, el polipéptido tiene una secuencia de aminoácidos basada en una secuencia de consenso del tercer dominio de fibronectina que tiene: (i) la secuencia de aminoácidos de la SEQ ID NO:16, en donde los residuos específicos de la SEQ ID NO:16 se reemplazan y mejoran la estabilidad térmica de la molécula basada en armazón, en donde la molécula basada en armazón comprende una sustitución E11N; o (ii) la secuencia de aminoácidos de la SEQ ID NO:144.

PDF original: ES-2730693_T3.pdf

Péptidos terapéuticos.

(10/04/2019). Solicitante/s: GlaxoSmithKline Intellectual Property Development Limited. Inventor/es: WU,YULIN, DOCK,STEVEN THOMAS, CARPENTER,ANDREW JAMES, HUNTER,III ROBERT NEIL, SRIVASTAVA,VED P.

Un polipéptido que consiste en la secuencia de aminoácidos: ProLysProGluXaa1 ProGlyXaa 2 AspAlaSerXaa 3 GluGluXaa 4Xaa5 Xaa6TyrTyrAlaXaa7LeuArgXaa8TyrXaa9AsnTrpXaa10ThrArgGlnArgTyr-NH2 (SEQ ID NO:2) o una sal del mismo, en la que: Xaa1 es Ala, His o Ser; Xaa2 es Glu o Lys; Xaa3 es Pro o Ala; Xaa4 es Leu o Trp; Xaa5 es Asn, Ala o Thr; Xaa6 es Arg o Lys; Xaa7 es Ser, Asp o Ala; Xaa8 es Hiso Lys; Xaa9 es Leu o Ile; y Xaa10 es Val o Leu.

PDF original: ES-2732291_T3.pdf

Péptidos derivados de neuropéptidos y.

(27/03/2019) Un péptido derivado del neuropéptido Y (NPY) (SEQ ID NO: 22), donde dicho péptido se selecciona del grupo que consiste en: un péptido que consiste en 32 residuos de aminoácidos contiguos que tienen la secuencia KPDNPGEDAPAEDMARYYSALRHYINLITRQR (NPY4-35, SEQ ID NO: 2) o KPDNPGEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos, un péptido que consiste en 27 residuos de aminoácidos contiguos que tienen la secuencia GEDAPAEDMARYYSALRHYINLITRQR (NPY9-35, SEQ ID NO: 7) o GEDAPAEDMARYYSALRHYINLITRQR con 1, 2 o 3 sustituciones de aminoácidos, un péptido que consiste en 26 residuos de aminoácidos contiguos que tienen la secuencia EDAPAEDMARYYSALRHYINLITRQR (NPY10-35, SEQ ID NO: 8) o EDAPAEDMARYYSALRHYINLITRQR con…

Polipéptidos modificados por ingeniería genética que tienen una duración potenciada de la acción y una inmunogenicidad reducida.

(27/03/2019). Solicitante/s: Aegerion Pharmaceuticals, Inc. Inventor/es: GHOSH, SOUMITRA, S., LITZINGER, DAVID, C., EKBLAD,CAROLINE, ROTH,JONATHAN DAVID, ERICKSON,MARY, GUO,ZIJIAN.

Un polipéptido modificado por ingeniería genética que comprende: un polipéptido con dominio de unión a la albúmina (ABD) y un primer dominio hormonal peptídico (HD1) que comprende una leptina, un análogo de leptina que tiene al menos un 50 % de identidad de secuencia con la leptina original o un fragmento activo de la misma, en el que dicho ABD comprende al menos un 95 % de identidad con SEQ ID NO: 300, con la condición de que X14 se seleccione entre A, S y C; con la condición de que X7 no sea L, E o D; o como alternativa, con la condición de que la secuencia de aminoácidos no sea la SEQ ID NO: 679.

PDF original: ES-2732475_T3.pdf

Polipéptidos reguladores de glucosa y métodos para su producción y uso.

(22/03/2019) Un acido nucleico aislado que comprende una secuencia de polinucleotido que codifica una proteina de fusion, que comprende un peptido regulador de la glucosa (GP), en donde la secuencia de polinucleotido (i) comprende una secuencia que hibrida en condiciones rigurosas con AE864 de la tabla 9 (SEQ ID NO: 243) o Ex4-AE864 de la tabla 36 (SEQ ID NO: 897) o el complemento de las mismas y tiene al menos un 70 % de identidad de secuencia o un 80 % o un 90 % o un 95 % o un 97 % o un 98 % o un 99 % hasta un 100 % de identidad de secuencia respecto de AE864 de la tabla 9 (SEQ ID NO: 243) o Ex4-AE864 de la tabla 36 (SEQ ID NO: 897) o el complemento de las mismas, y (ii) codifica una proteina de fusion que comprende (a) exendina-4 y que tiene una secuencia de aminoacidos que muestra al…

Agonistas del péptido CRHR2 y usos de los mismos.

(13/03/2019). Solicitante/s: JANSSEN PHARMACEUTICA NV. Inventor/es: SWANSON, RONALD, V., SHANKLEY,NIGEL P, MORENO,VERONICA, GENGO,PETER.

Un péptido que tiene actividad agonista hacia el receptor de la hormona liberadora de corticotropina tipo 2, dicho péptido tiene una secuencia de aminoácidos seleccionada del grupo que consiste de las SEQ ID NO 2, 3, 4, 5, 6, 7, 9, 10, 11, 12 , 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 35, 36, 37, 39 , 40, y 41; o una sal o amida farmacéuticamente aceptable del mismo.

PDF original: ES-2723098_T3.pdf

Péptidos antagonistas de CRF cíclicos.

(11/03/2019) Un péptido antagonista del factor liberador de corticotropina (CRF) cíclico, o una sal farmacéuticamente aceptable del mismo, péptido que tiene la secuencia de aminoácidos: **(Ver secuencia)** en la que Y es H, Tyr o D-Tyr o un grupo acilo que tiene hasta 20 átomos de carbono, preferiblemente hasta 12 átomos de carbono, y más preferiblemente de 1 a 7 átomos de carbono, R1 es Asp o des-R1; R2 es Leu o des-R2; R3 es Ser o Thr o des-R3; D-Xaa es D-Phe, D-Leu, D-Tyr, D-Cpa, D-pNO2Phe, D-Nal, D-Trp, D-Aph(Cbm) o D-Pal; R5 es His, Tyr o Glu; R6 es CML o Leu; R7 es Leu o CML; R9 es Glu, CML, Asn o Lys; R10 es Val, CML, Nle o Met; R11 es Leu, CML o Ile; R12 es Glu, D-Glu o His; R13 es Nle, Leu, Nva o Met; R14 es Ala, D-Ala, Aib, Dpg, Thr, D-Thr, Glu o D-Glu; R15 es Arg, Orn o Lys; R16 es Ala, Aib, Dpg o CML; R17 es Glu o Asp; R18 es Gln, Asn o Lys;…

hPYY (1-36) con sustitución de beta-homoarginina en la posición 35.

(06/03/2019). Solicitante/s: NOVO NORDISK A/S. Inventor/es: WULFF, BIRGITTE, SCHJELLERUP, THOMSEN,JENS KAALBY, ØSTERGAARD,SØREN, WIECZOREK,BIRGIT, FRIEBOES,KILIAN WALDEMAR CONDE.

Un compuesto de PYY que comprende L-beta-homoarginina en una posición correspondiente a la posición 35 de hPYY (SEQ ID NO:1), y una sal farmacéuticamente aceptable de este.

PDF original: ES-2727721_T3.pdf

Bioconjugados no aglomerantes de compuestos miméticos de amilina y polietilenglicol.

(27/02/2019) Bioconjugados no aglomerantes de amilina humana y polietilenglicol, en los que dicho bioconjugado contiene al menos una unidad de polietilenglicol unida covalentemente al átomo de nitrógeno que forman los restos alfa y/o épsilon (cadena lateral) del resto de lisina 1 de la cadena polipeptídica de amilina; en el que los bioconjugados no aglomerantes de compuestos de amilina humana y polietilenglicol, tienen la fórmula I (R1-COX)m-R2 donde R1 representa un resto de metoxipolietilenglicol (mPEG) y espaciadores funcionales con distintos pesos molares medios, R2 representa la amilina humana, X representa NH u O, m representa el número de unidades del polímero de mPEG (R1) conjugado con la amilina humana (R2) obtenido de la conjugación de mPEG-succinimidilo…

Irisina para el cuidado y la prevención de la osteoporosis.

(25/02/2019). Solicitante/s: Università Degli Studi di Bari. Inventor/es: CINTI,SAVERIO, GRANO,MARIA, COLAIANNI,GRAZIANA, CUSCITO,CONCETTA, BRUNETTI,GIACOMINA, COLUCCI,SILVIA, MORI,GIORGIO.

Irisina para ser usada en el tratamiento y/o la prevención de la osteoporosis.

PDF original: ES-2701675_T3.pdf

Compuestos para el tratamiento de obesidad y procedimientos de uso de los mismos.

(17/01/2019). Solicitante/s: THE CHILDREN'S MEDICAL CENTER CORPORATION. Inventor/es: MAZITSCHEK,RALPH, OZCAN,UMUT, MAJZOUB,JOSEPH, CAKIR,ISIN, CABI,SERKAN.

Una formulación farmacéutica para su uso en la inducción de pérdida de peso o reducción de grasa corporal, o una combinación de las mismas en un paciente pre-obeso, obeso u obeso mórbido por administración oral de un agente de pérdida de peso en una cantidad entre 0,005 mg y 10 mg al día por kg de peso corporal; en la que la formulación comprende un agente de pérdida de peso que es un compuesto definido por la Fórmula I**Fórmula** o una sal farmacéuticamente aceptable del mismo.

PDF original: ES-2696626_T3.pdf

Derivados de exendina-4 como agonistas selectivos del receptor de glucagón.

(27/11/2018). Solicitante/s: SANOFI. Inventor/es: STENGELIN, SIEGFRIED, WAGNER, MICHAEL, EVERS,ANDREAS, HENKEL,BERND, HAACK,TORSTEN.

Un compuesto peptídico que tiene la fórmula (I):**Fórmula** X10 representa un residuo aminoacídico seleccionado de Tyr, Leu, Val, Ile, Phe, fenilglicina, 1-naftilalanina, 2- fluorofenilalanina, ciclohexilglicina y terc-leucina, X14 representa un residuo aminoacídico seleccionado de Leu y Nle X21 representa un residuo aminoacídico seleccionado de Asp y Glu, X29 representa un residuo aminoacídico seleccionado de Gly y Thr, R1 representa OH o NH2 o una sal o solvato de este.

PDF original: ES-2691534_T3.pdf

Formulaciones de insulina de acción prolongada.

(20/11/2018). Solicitante/s: SANOFI. Inventor/es: WERNER, ULRICH, DR., LOOS, PETRA, MUELLER, WERNER, BECKER, REINHARD, DR., BODERKE,PETER, FUERST,CHRISTIANE DR, TERTSCH,KATRIN DR, SCHOETTLE,ISABELL, FRICK,ANNKE.

Una formulación farmacéutica acuosa con pH entre 3,4 y 4,6 que comprende insulina glargina, en donde la concentración de insulina glargina es de 200-500 U/mL, que es equimolar a 200-500 UI de insulina humana.

PDF original: ES-2690302_T3.pdf

Microcápsulas de liberación sostenida basadas en poli(lactida-co-glicólido) que comprenden un polipéptido y un azúcar.

(15/11/2018) Un proceso para preparar una composición farmacéuticamente aceptable en forma de micropartículas para la liberación sostenida de exendina-4, que comprende: a) formar una mezcla combinando una fase acuosa que comprende polipéptido de exendina-4 hidrosoluble y sacarosa, con una fase oleosa que comprende un polímero biocompatible y un disolvente para el polímero biocompatible; b) formar una emulsión de agua en aceite de la mezcla de la etapa a), en donde el tamaño de las gotas de la emulsión interna es de aproximadamente 0,1 a aproximadamente 1,2 micrómetros; c) añadir un agente de coacervación a la mezcla para formar micropartículas embrionarias, en donde el agente de coacervación es aceite de silicona añadido…

Derivados de exendina-4 como agonistas duales de GLP1/GIP o trigonales de GLP1/GIP/glucagón.

(02/11/2018) Un compuesto peptídico que tiene la fórmula (I): R1-Z-R2 (I) en la que Z es un resto de péptido que tiene la fórmula (II) Tyr-Aib-X3-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-X12-Gln-X14-X15-X16-X17-5 X18-X19-X20-X21-Phe- Ile-Glu-Trp-Leu-Lys-X28-X29-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-X(II) X3 representa Glu, X12 representa un resto de aminoácido seleccionado de Ile y Lys, X14 representa un resto de aminoácido que tiene una cadena lateral con un grupo -NH2, en el que el grupo de cadena lateral -NH2 está funcionalizado por -C(O)-R5, en la que R5 puede ser un resto que comprende hasta 50 o hasta…

ACTH para el tratamiento de la esclerosis lateral amiotrófica.

(30/10/2018). Solicitante/s: MALLINCKRODT ARD IP LIMITED. Inventor/es: SOMERA-MOLINA,KATHLEEN C.

Un péptido de la hormona adrenocorticotropa (ACTH) (péptido ACTH1-39) para su uso en el retraso de la progresión de la Esclerosis Lateral Amiotrófica (ELA) en un individuo sospechoso de tener, o predispuesto a la Esclerosis Lateral Amiotrófica (ELA), donde el péptido de la ACTH se va a administrar como una primera dosis y una o más dosis posteriores.

PDF original: ES-2688072_T3.pdf

Método de obtención de datos útiles para el cribado y diagnóstico de la osteoporosis.

(24/10/2018). Solicitante/s: SERVICIO ANDALUZ DE SALUD. Inventor/es: MONTES CASTILLO,Cristina, MARTÍNEZ RAMÍREZ,María José.

Método de obtención de datos útiles para el cribado y diagnóstico de la osteoporosis. La presente invención se refiere al uso de la composición para el tratamiento de la osteoporosis, el uso de unos marcadores y un método de obtención de datos útiles para el cribado, diagnóstico, pronóstico y/o seguimiento de la osteoporosis, kit o dispositivo y usos.

PDF original: ES-2687220_A1.pdf

Métodos para el tratamiento o prevención de la anemia.

(18/10/2018) Un compuesto para su uso en el tratamiento o prevención de la anemia, en donde el compuesto es un compuesto de fórmula (I):**Fórmula** en donde A es (C1-C4)-alquileno; B es -CO2H, -NH2 , -NHSO2CF3, tetrazolilo, imidazolilo, 3-hidroxiisoxazolilo, -CONHCOR'", - CONHSOR"', CONHSO2R''', donde R''' es arilo, heteroarilo, (C3 -C7)-cicloalquilo, o (C1-C4)-alquilo, opcionalmente monosustituido con (C6 -C12)-arilo, heteroarilo, OH, SH, (C1 -C4)-alquilo, (C1-C4)-alcoxi, (C1-C4)-tioalquilo, (C1- C4)-sulfinilo, (C1-C4) sulfonilo, CF3, Cl, Br, F, I, NO2, -COOH, (C2-C5)-carbonilo, NH2, mono-(C1-C4-alquil)- amino, di-(C1-C4-alquil)-amino, o (C1-C4)- perfluoroalquilo; o en donde B es un radical carboxilo CO2-G, donde G es un radical de…

Medicamentos para tratar anemia asociada con enfermedad renal.

(18/10/2018) Un compuesto para su uso en la prevención o tratamiento de anemia asociada con enfermedad renal en un sujeto, en donde el compuesto es un compuesto de fórmula (I): **Fórmula** en donde A es (C1-C4)-alquileno; B es -CO2H, -NH2 , -NHSO2CF3, tetrazolilo, imidazolilo, 3-hidroxiisoxazolilo, -CONHCOR'", - CONHSOR"', CONHSO2R''', donde R''' es arilo, heteroarilo, (C3 -C7)-cicloalquilo, o (C1-C4)-alquilo, opcionalmente monosustituido con (C6 -C12)-arilo, heteroarilo, OH, SH, (C1 -C4)-alquilo, (C1-C4)-alcoxi, (C1-C4)-tioalquilo, (C1- C4)-sulfinilo, (C1-C4) sulfonilo, CF3, Cl, Br, F, I, NO2, -COOH, (C2-C5)-carbonilo, NH2, mono-(C1-C4-alquil)- amino, di-(C1-C4-alquil)-amino, o (C1-C4)- perfluoroalquilo; o en donde B es un radical carboxilo CO2-G,…

Agentes antienvejecimiento.

(15/10/2018). Solicitante/s: Qi, Haiyan. Inventor/es: QI,HAIYAN.

Composición de inhibidor de TOR para su uso en el tratamiento de enfermedades o trastornos relacionados con la edad de los seres humanos, en donde dicho inhibidor de TOR es una dosis baja de rapamicina o un análogo de esta seleccionado de Deforolimus, AP-23675, AP-23841, Zotarolimus, CCI779/Temsirolimus, RAD-001/Everolimus, 7-epi-rapamicina, 7- tiometil-rapamicina, 7-epi-trimetoxi-rapamicina, 2-desmetil-rapamicina y 42-O-(2-hidroxi)etil-rapamicina, en donde dicho inhibidor de TOR no inhibe el crecimiento celular en la fase G1 del ciclo celular y la traducción de proteínas, en donde dichas bajas dosis de rapamicina se administran a una dosificación oral diaria de 0,01 a 10 μg/día.

PDF original: ES-2685947_T3.pdf

Combinaciones y modos de administración de agentes terapéuticos y terapia combinada.

(06/06/2018). Solicitante/s: ABRAXIS BIOSCIENCE, LLC. Inventor/es: DESAI, NEIL P., SOON-SHIONG, PATRICK.

Una composición que comprende nanopartículas que contienen rapamicina y una albúmina, para uso en un método de tratamiento de una enfermedad proliferativa en un individuo, en donde el método comprende además administrar una composición que comprende nanopartículas que contienen paclitaxel y una albúmina.

PDF original: ES-2678448_T3.pdf

Análogo de exendina-4 pegilado con polietilenglicol o derivado del mismo, método de preparación del mismo y composición farmacéutica para evitar o tratar diabetes, que contiene el mismo como principio activo.

(04/04/2018). Solicitante/s: Theraly Pharmaceuticals Inc. Inventor/es: KIM, WON-BAE, LEE,SUNG KWON, LEE,SEULKI, KIM,TAE HYUNG.

Un analogo de exendina-4 en el que hay introducida una cisteina (Cys) en el sitio no. 40 del extremo terminal-C de la exendina-4 esta PEGilado con un tipo trimerico de polietilenglicol (PEG) o un derivado del mismo, en donde el derivado de polietilenglicol esta seleccionado entre succinimidilpropionato de metoxipolietilen glicol, metoxipolietilenglicol N-hidroxisuccinimida, metoxipolietilenglicol propionaldehido, metoxipolietilenglicol maleimida.

PDF original: ES-2674581_T3.pdf

Formulaciones de insulina de acción prolongada.

(04/04/2018). Solicitante/s: SANOFI. Inventor/es: WERNER, ULRICH, DR., LOOS, PETRA, MUELLER, WERNER, BECKER, REINHARD, DR., BODERKE,PETER, HAHN,ANNKE DR, FUERST,CHRISTIANE DR, TERTSCH,KATRIN DR.

Una formulación farmacéutica acuosa con un pH entre 3,4 y 4,6 que comprende insulina glargina, en donde la formulación comprende 270-330 U/mL de insulina glargina, que es equimolar a 270-330 UI de insulina humana.

PDF original: ES-2676401_T3.pdf

Uso de folistatina o de un inhibidor de activina para prevenir o tratar la disfunción del injerto de tejido.

(28/02/2018). Solicitante/s: Paranta Biosciences Limited. Inventor/es: DE KRETSER,DAVID, O'HEHIR,ROBYN.

Folistatina o un inhibidor de activina para el uso en el tratamiento de la disfunción del tejido de injerto de mamífero, en el que el inhibidor de activina es un antagonista de activina o una molécula proteica o no proteica que inhibe la transcripción o traducción del gen de activina, y en el que dicha folistatina o inhibidor de activina se administra: (i) al donante del injerto antes de la retirada del injerto, (ii) al tejido de injerto antes de su retirada del donante, (iii) al tejido de injerto posteriormente a su retirada del donante, pero antes de su trasplante, o (iv) al receptor antes del trasplante.

PDF original: ES-2663993_T3.pdf

Composición para administración transnasal y método para prepararla.

(21/02/2018). Solicitante/s: DAIICHI SANKYO COMPANY, LIMITED. Inventor/es: TAKEDA, SHUJI, MATSUMOTO, MASARU, NOBORI,KYOHEI.

Una composición en polvo para administración nasal que comprende un péptido fisiológicamente activo y acetato de celulosa como base, en donde la composición se obtiene 1) mezclando el péptido fisiológicamente activo, el acetato de celulosa y al menos un 20% en peso de agua en relación con el acetato de celulosa, y 2) secando la mezcla, y en donde el grado de acetilación del acetato de celulosa es de 32-40% y el péptido fisiológicamente activo es un péptido con un peso molecular no mayor que 20.000.

PDF original: ES-2663335_T3.pdf

Procedimientos, sistemas y composiciones para estimular la recuperación de la neuropatía periférica.

(14/02/2018). Solicitante/s: HENRY FORD HEALTH SYSTEM. Inventor/es: WANG,LEI, CHOPP,MICHAEL, ZHANG,ZHENGGANG, MORRIS,DANIEL C.

Composición que comprende timosina β4 para su utilización en el tratamiento para estimular la recuperación de la neuropatía periférica en un sujeto, comprendiendo dicho tratamiento administrar a un sujeto que necesita dicho tratamiento una cantidad terapéuticamente eficaz de dicha composición.

PDF original: ES-2668815_T3.pdf

Proteínas de fusión del receptor de linfocitos T y conjugados y procedimientos de uso de las mismas.

(10/01/2018). Solicitante/s: ALTOR BIOSCIENCE CORPORATION. Inventor/es: WONG, HING, C., WEIDANZ, JON, A., CARD,KIMBERLYN,F.

Un complejo de fusión del receptor de linfocito T soluble que comprende un receptor de linfocito T y un polipéptido biológicamente activo conectados por un engarce peptídico, en el que el receptor de linfocito T consiste en el receptor de linfocito T de cadena sencilla 264 (scTCR 264) y en el que el polipéptido biológicamente activo consiste en el dominio constante (Fc) de una IgG1 humana, en el que el receptor de linfocito T es específico para el reconocimiento de un antígeno peptídico que comprende una secuencia peptídica LLGRNSFEV.

PDF original: ES-2659376_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015