CIP 2015 : A01N 63/00 : Biocidas, productos que repelen o atraen a los animales perjudiciales,

o reguladores del crecimiento de los vegetales, que contienen microorganismos, virus, hongos microscópicos, animales, p. ej. nematodos, o sustancias producidas por, u obtenidas a partir de microorganismos, virus, hongos microscópicos o animales, p.ej. encimas o productos de fermentación (que contienen compuestos de constitución determinada A01N 27/00 - A01N 59/00).

CIP2015AA01A01NA01N 63/00[m] › Biocidas, productos que repelen o atraen a los animales perjudiciales, o reguladores del crecimiento de los vegetales, que contienen microorganismos, virus, hongos microscópicos, animales, p. ej. nematodos, o sustancias producidas por, u obtenidas a partir de microorganismos, virus, hongos microscópicos o animales, p.ej. encimas o productos de fermentación (que contienen compuestos de constitución determinada A01N 27/00 - A01N 59/00).

Notas[g] desde A01N 25/00 hasta A01N 65/00: Biocidas; Productos que atraen o repelen a los animales perjudiciales; Reguladores del crecimiento de los vegetales

A01N 63/02 · Sustancias producidas por, u obtenidas a partir de microorganismos o animales.

A01N 63/04 · Hongos microscópicos;  Sustancias producidas u obtenidas a partir de ellos.

CIP2015: Invenciones publicadas en esta sección.

Uso de una cepa de Bacillus mojavensis productora de fengicina y resistente al cobre para controlar fitopatógenos.

(01/03/2019). Solicitante/s: Szegedi Tudomanyegyetem. Inventor/es: KOVÁCS,András, VÁGVÖLGYI,CSABA, MANCZINGER,LÁSZLÓ, SAJBEN,ENIKÖ, NAGY,ÁRPÁD, SZÖKE-KIS,ZOLTÁN, NAGY,ADRIENN, TURÓCZI,GYÖRGY.

Uso de la cepa mutante R3B resistente al cobre de Bacillus mojavensis depositada bajo el n.º NCAIM (P) B 001389 de acuerdo con el Tratado de Budapest para ejercer antagonismo contra los patógenos seleccionados del grupo de bacterias fitopatógenas Xanthomonas vesicatoria, Pseudomonas syringae y Clavibacter michiganensis, y de hongos fitopatógenos Pythium debaryanum y Alternaria alternata.

PDF original: ES-2702497_T3.pdf

Procedimientos y composiciones de fermentación microbiana.

(20/02/2019). Solicitante/s: NewLeaf Symbiotics, Inc. Inventor/es: BOGOSIAN,Gregg.

Una composición que comprende un producto de fermentación que comprende una sustancia sólida en la que un monocultivo o un cocultivo de Methylobacterium está adherido a la misma, en la que la sustancia sólida comprende una pluralidad de partículas de 2 micrómetros a aproximadamente 1000 micrómetros de longitud promedio o de diámetro promedio, en la que el título de Methylobacterium de dichas partículas es de 5 x 108 unidades formadoras de colonias por gramo de partículas a 5 x 1013 unidades formadoras de colonias de Methylobacterium por gramo de partículas, en la que dicha sustancia sólida está esencialmente exenta de microorganismos contaminantes y no es un microorganismo fotosintético, y en la que la composición comprende opcionalmente adicionalmente al menos uno de un coadyuvante agrícolamente aceptable y/o un excipiente agrícolamente aceptable o en la que la sustancia sólida comprende opcionalmente un coadyuvante agrícolamente aceptable o un excipiente agrícolamente aceptable.

PDF original: ES-2700936_T3.pdf

Dispositivos prevascularizados y métodos relacionados.

(12/02/2019). Solicitante/s: ARIZONA BOARD OF REGENTS ON BEHALF OF THE UNIVERSITY OF ARIZONA. Inventor/es: WILLIAMS, STUART K., HOYING,JAMES B.

Dispositivo implantable para proporcionar un agente biológicamente activo a un sujeto que lo necesite, comprendiendo el dispositivo un constructo de microvasos en contacto con una bolsa biocompatible y semipermeable, encapsulando la bolsa una célula o células capaces de producir el agente biológicamente activo, donde el constructo de microvasos comprende fragmentos de microvasos aislados antes de la implantación.

PDF original: ES-2699690_T3.pdf

Uso de un compuesto de enaminocarbonilo en combinación con un agente de control biológico.

(08/02/2019). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: JESCHKE, PETER, HUNGENBERG,HEIKE.

Una combinación que comprende un compuesto de enaminocarbonilo de fórmula (I-3):**Fórmula** y al menos un agente de control biológico seleccionado de Bacterias del subgrupo (3a) que consiste en B. subtilis y B. amyloliquifaciens, y el subgrupo (3b) que consiste en B. thuringiensis, hongos o levaduras seleccionados del grupo que consiste en Metschnikowia fructicola, Metarhizium anisopliae y Paecilomyces lilacinus, y el virus de la granulosis Cydia pomonella.

PDF original: ES-2699258_T3.pdf

Uso de combinaciones que comprenden inductores de defensa de anfitrión y agentes de control biológico para controlar organismos perjudiciales bacterianos en plantas útiles.

(08/02/2019). Solicitante/s: BAYER CROPSCIENCE AKTIENGESELLSCHAFT. Inventor/es: LABOURDETTE, GILBERT, MANKER, DENISE, KERZ-MOEHLENDICK,FRIEDRICH DR, BECKER,ROLF CHRISTIAN, SPRINGER,BERND, MUENKS,KARL-WILHELM, DIAS,LINO MIGUEL, VAN BREUKELEN-GROENEVELD,CORALIE NICOLE.

Uso de una combinación que comprende (A) al menos un inductor de la defensa del hospedador seleccionado del grupo que consiste en acilbenzolar-Smetilo e isotianilo y (B) al menos un agente de control biológico que es Bacillus subtilis QST713/AQ713 (Acceso NRRL No. B21661) en una cantidad sinérgicamente eficaz para controlar organismos perjudiciales bacterianos en plantas útiles.

PDF original: ES-2699268_T3.pdf

Procedimiento para aumentar la biomasa vegetal.

(06/02/2019). Solicitante/s: BioMass Booster, S.L. Inventor/es: MARTINEZ RAMIREZ,Alfredo, ARENAS VIDAL,JORGE CONRADO.

Un procedimiento para aumentar la biomasa de un organismo fotosintético que comprende cultivar dicho organismo fotosintético en presencia de un péptido que comprende: i. la secuencia de aminoácidos que se muestra en la SEQ ID NO: 3; o ii. Una variante funcional del péptido definido en (i), en el que dicha variante es un péptido cuya secuencia de aminoácidos tiene un grado de identidad con respecto a la secuencia de aminoácidos que se muestra en la SEQ ID NO: 3 de al menos el 70 % y mantiene su capacidad para aumentar la biomasa de un organismo fotosintético, y en el que dicha variante comprende la secuencia de aminoácidos Cys-Xaa1-Xaa2-Xaa3-Xaa4-Cys [SEQ ID NO 1] en la que Xaa1, Xaa2, Xaa3 y Xaa4, representan independientemente un aminoácido, y los restos de cisteína de la secuencia de aminoácidos que se muestra en la SEQ ID NO: 1 forman un puente disulfuro entre ellos, en el que dicho péptido está presente en una concentración entre 10-8 M y 10-16 M.

PDF original: ES-2698835_T3.pdf

Composiciones que comprenden un agente de control biológico y un insecticida.

(06/02/2019). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: ANDERSCH, WOLFRAM, DR., HELLWEGE, ELKE, STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control biológico y al menos un insecticida, en la que a) el agente de control biológico es Bacillus pumilus (n.º de acceso NRRL B-30087) y el al menos un insecticida se selecciona del grupo que consiste en metiocarb y tiodicarb, en una relación de peso sinérgica de entre 1 : 10 a 5000 : 1, b) el agente de control biológico es Bacillus subtilis AQ713 (n.º de acceso NRRL. B-21661) y el al menos un insecticida se selecciona del grupo que consiste en metiocarb y tiodicarb, en una relación de peso sinérgica de entre 1 : 10 a 10.000 : 1, y c) el agente de control biológico es Streptomyces galbus (n.º de acceso NRRL 30232) y el al menos un insecticida es metiocarb, en una relación de peso sinérgica de entre 1 : 10 a 2500 : 1.

PDF original: ES-2698951_T3.pdf

Procedimiento de producción de semillas de planta que contienen bacterias endófitas.

(06/02/2019). Solicitante/s: AIT AUSTRIAN INSTITUTE OF TECHNOLOGY GMBH. Inventor/es: MITTER,BIRGIT, SESSITSCH,ANGELA, NAVEED,MUHAMMAD.

Procedimiento de producción de semillas de planta que contienen bacterias endófitas, caracterizado por las siguientes etapas: - poner en contacto una planta con flores en el curso de la fase de floración con una preparación de bacterias endófitas, mediante lo cual las bacterias endófitas entran en la planta por medio de las flores y se transportan al interior de la semilla producida por la planta y - obtener las semillas de planta que contienen bacterias endófitas de la planta.

PDF original: ES-2722275_T3.pdf

Cepas nuevas de Brevibacillus laterosporus como agentes de biocontrol contra plagas de plantas, particularmente Lepidoptera y Diptera.

(31/01/2019). Ver ilustración. Solicitante/s: Lincoln University. Inventor/es: GLARE,TRAVIS ROBERT, HAMPTON,JOHN GRAHAM, COX,MURRAY PAUL, BIENKOWSKI,DAMIAN ALEXANDER.

Una cepa aislada de Brevibacillius laterosporus con actividad insecticida contra al menos una especie de Lepidoptera y al menos una especie de Diptera, en la que la cepa aislada de Brevibacillius laterosporus se selecciona de la cepa NMI n.º V12/001946 de Brevibacillius laterosporus, cepa NMI n.º V12/001945 de Brevibacillius laterosporus y cepa NMI n.º V12/001944 de Brevibacillius laterosporus.

PDF original: ES-2698100_T3.pdf

Composición que comprende un agente de control biológico y fluopicolida.

(30/01/2019). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: WACHENDORFF-NEUMANN, ULRIKE, ANDERSCH, WOLFRAM, DR., STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control biológico seleccionado del grupo que consiste en Bacillus subtilis AQ713 (n.º de acceso NRRL B-21661) y Bacillus subtilis AQ30002 (n.º de acceso NRRL B-50421) y al menos un fungicida (I) que es fluopicolida en una cantidad sinérgicamente eficaz, en la que la relación en peso entre dicho agente de control biológico y dicho fungicida (I) está en el intervalo de 1:0,005 a 1:0,5.

PDF original: ES-2698061_T3.pdf

Composiciones y métodos para el tratamiento o la prevención de la infección por adenovirus-36 humano.

(16/01/2019). Solicitante/s: GLOBEIMMUNE, INC. Inventor/es: APELIAN,DAVID, KING,THOMAS H, COESHOTT,CLAIRE, LU,YINGNIAN.

Una composición inmunoterapéutica que comprende: a) un vehículo de levadura; y b) una proteína de fusión que comprende un antígeno de adenovirus-36 (Ad-36) que comprende al menos un dominio inmunogénico de CR1α y al menos un dominio inmunogénico de CR1γ.

PDF original: ES-2696551_T3.pdf

Un procedimiento para aumentar el rendimiento de cultivo de plantas agrícolas bajo presión por patógenos esencialmente no existente.

(16/01/2019) Un procedimiento para aumentar el rendimiento de cultivo de plantas agrícolas bajo presión por patógenos no existente, en el que presión por patógenos no existente se refiere a una situación en que los patógenos están presentes dentro del área de cultivo de una planta pero en una cantidad que no es nociva para la planta y que no da como resultado una disminución del rendimiento, en el que se tratan las plantas, los propágulos de las plantas, las semillas de las plantas y/o el lugar donde las plantas están creciendo o van a crecer con una cantidad eficaz de una composición que comprende a) la cepa de Bacillus subtilis con el N.º de referencia NRRL B-21661 como componente (I), y b) opcionalmente, al menos un compuesto como componente (II), seleccionado de…

Agricultura microbiana.

(27/12/2018). Solicitante/s: DSM IP ASSETS B.V.. Inventor/es: KUMAR, MANOJ, DONNERS,RUTH EMELIA WILHELMINA.

Un método para potenciar el crecimiento de las plantas, el rendimiento de las cosechas o ambos, comprendiendo el método la etapa de aplicar al menos una cepa bacteriana productora de natamicina a una planta.

PDF original: ES-2694810_T3.pdf

Composición que comprende un agente de control biológico y trifloxiestrobina.

(19/12/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: WACHENDORFF-NEUMANN, ULRIKE, ANDERSCH, WOLFRAM, DR., STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control biológico que es Bacillus subtilis AQ713 (Num de registro NRRL B-21661) y al menos un fungicida (I) que es trifloxistrobina en una cantidad sinérgicamente eficaz, en la que la relación de peso del al menos un agente de control biológico al fungicida (I) está en el intervalo de 1:0,001 a 1:0,1.

PDF original: ES-2694201_T3.pdf

Combinaciones de agentes de control biológico y fungicidas.

(18/12/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: ANDERSCH,DR. WOLFRAM, EVANS,PAUL HAWEN, BUGG,KEVIN, RIGGS,JENNIFER, CHEN,CHI-YU ROY, SPRINGER,DR. BERND.

Una composición que comprende espora de Bacillus firmus CNCM 1-1582 y un fungicida, en la que el fungicida se selecciona de fluopiram, fluoxastrobina, fludioxonilo, iprodiona, mancozeb.

PDF original: ES-2694148_T3.pdf

Producción de cuerpos de inclusión de virus que incluyen viriones que contienen genomas de diferentes especies de baculovirus que pueden usarse para combatir plagas de insectos.

(07/12/2018) Un método para producir viriones derivados de cuerpos de inclusión de virus (ODV) mixtos que comprenden genomas de al menos dos especies de baculovirus diferentes co-envueltos en el mismo virión, y/o para producir cuerpos de inclusión de virus en los que está incluido al menos uno de dichos viriones derivados de cuerpos de inclusión de virus mixtos, en el que todos los baculovirus que infectan son nucleopoliedrovirus múltiples, y en el que los cuerpos de inclusión de virus se producen mediante las etapas de: a. coinfectar larvas o células en cultivo de una especie de insecto con los genomas de baculovirus que deben quedar co-envueltos en al menos uno de los viriones derivados de cuerpos de inclusión producidos, en donde cada genoma de baculovirus pertenece a una especie…

Composición que comprende un agente de control biológico y un fungicida seleccionado de inhibidores de la biosíntesis del ergosterol.

(16/11/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: WACHENDORFF-NEUMANN, ULRIKE, ANDERSCH, WOLFRAM, DR., STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control biológico que es Bacillus subtilis AQ713 (n.º de acceso NRRL B-21661) y al menos un fungicida (I) seleccionado del grupo que consiste en fenhexamid, protioconazol, espiroxamina y tebuconazol, en la que la relación en peso sinérgica de agente de control biológico y fungicida (I) está entre 1:0,0001 y 1:1.

PDF original: ES-2689879_T3.pdf

Composición que comprende un agente de control biológico y un fungicida.

(16/11/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: WACHENDORFF-NEUMANN, ULRIKE, ANDERSCH, WOLFRAM, DR., STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control biológico que es Bacillus subtilis AQ713 (n.º de acceso NRRL B-21661) y al menos un fungicida (I) seleccionado del grupo que consiste en fosetil-aluminio, fosetil-calcio y fosetil-sodio, en la que la relación en peso sinérgica del agente de control biológico y el fungicida (I) está entre 1:0,0001 y 1:1.

PDF original: ES-2689896_T3.pdf

Composiciones inmunogénicas que comprenden Lawsonia intercellularis.

(07/11/2018). Solicitante/s: BOEHRINGER INGELHEIM VETMEDICA, INC.. Inventor/es: ROOF, MICHAEL, B., KROLL,JEREMY.

Una vacuna de combinación que comprende i) antígeno L. intracellularis eficaz para reducir la incidencia o disminuir la gravedad de la enteropatía proliferativa porcina (PPE, por sus siglas en inglés) causada por Lawsonia intracellularis, en donde el antígeno L. intracellularis es L. intracellularis muerto, y ii) componentes inmunológicos activos de M. hyopneumoniae y circovirus porcino eficaces para el tratamiento y/o la profilaxis de infecciones causadas por M. hyopneumoniae y circovirus porcino, en donde el componente activo inmunológico de M. hyopneumoniae es M. hyopneumoniae muerto.

PDF original: ES-2688922_T3.pdf

Transferencia adoptiva de clones de células T CD8+ derivadas de células de memoria central.

(11/10/2018). Ver ilustración. Solicitante/s: FRED HUTCHINSON CANCER RESEARCH CENTER. Inventor/es: RIDDELL,STANLEY R, BERGER,CAROLINA, JENSEN,MICHAEL C.

Un método para obtener una preparación de linfocitos T citotóxicos (CTL) CD8+ de primate, útil para la inmunoterapia adoptiva que comprende las etapas de: (a) enriquecer una población de linfocitos T obtenida de un primate donante para una subpoblación de linfocitos T de memoria central CD62L+ CD8+ (TCM), para generar así una composición enriquecida de TCM que está enriquecida de linfocitos TCM CD62L+ y agotada de linfocitos T de memoria efectores CD62L- (TEM); y (b) expandir las células de la composición enriquecida de TCM in vitro, opcionalmente en presencia de interleucina (IL) 15, para producir una preparación de CTL enriquecida de CTL derivados de TCM, la preparación de CTL comprende células T efectoras (TE), en donde las células TE tienen una disminución de la expresión de CD62L en comparación con la composición enriquecida de TCM de la etapa (a).

PDF original: ES-2685756_T3.pdf

METODO PARA CRIAR Y SELECCIONAR PUPAS DE ENCARSIA FORMOSA Y AMITUS FUSCIPENNIS Y METODO PARA CONTROLAR LA MOSCA BLANCA EN CULTIVOS DE TOMATE DE INVERNADERO.

(04/10/2018). Solicitante/s: FUNDACION UNIVERSIDAD DE BOGOTA JORGE TADEO LOZANO. Inventor/es: FUENTES QUINTERO,Luz Stella, GARZON ESPINOSA,Cindy Alejandra.

Se describe un método que utiliza un empaque para el transporte de pupas de Encarsia formosa y Amitus fuscipennis desde su sitio de crianza hasta un cultivo que requiere de dichas Encarsia formosa y Amitus fuscipennis para controlar biológicamente la presencia de mosca blanca. Se describe también el método para criar, recolectar y empacar en empaques las pupas de Encarsia formosa y Amitus fuscipennis y por último, se describe un método para controlar la presencia de mosca blanca en cultivos de tomate de invernadero, que consiste en distribuir en el cultivo uno o más de los empaques de acuerdo con la presente invención.

COMPOSICIÓN PARA DETECCIÓN Y/O MONITORIZACIÓN DE TERMITAS.

(02/10/2018). Solicitante/s: BERGADO PEREDA, Mª Pilar. Inventor/es: BERGADO PEREDA,Mª Pilar.

Composición para detección y/o monitorización de termitas. Composición en forma de gel que comprende celulosa, almidón, hidrolasas, espesantes y agua como cebo para la detección y/o para la monitorización de termitas. Además la composición puede comprender un insecticida útil como cebo para el control y/o eliminación de termitas.

PDF original: ES-2684434_A1.pdf

MÉTODOS Y COMPOSICIONES PARA MEJORAR LA SALUD DE PLANTAS Y/O RENDIMIENTO DE PLANTAS.

(20/09/2018). Solicitante/s: PLANTRESPONSE BIOTECH, S.L. Inventor/es: BRUNNER, FREDERIC, BORJA,Marisé, BONET GIGANTE,Julio, OLIVARES,Patricia, SANZ,Yolanda, PÉREZ,Rosa.

La presente invención se dirige a métodos y composiciones para aumentar una característica de crecimiento de una planta, aumentar la eficacia del uso de nutrientes de una planta, o mejorar la capacidad de una planta de superar agresión biótica o abiótica que comprende aplicar una composición que comprende un extracto micelial fúngico que comprende piperidina y/o una análogo de la misma (por ejemplo, ácido 6-oxopiperidina-2-carboxílico) y/o una sal de la misma (por ejemplo, 6-oxopiperidina-2-carboxilato), o cualquier combinación de los mismos a una planta, parte de planta, o a un material de propagación de la planta.

Control biológico de nematodos.

(17/09/2018). Solicitante/s: BAYER CROPSCIENCE LP. Inventor/es: ROYALTY, REED, NATHAN, THOMAS,VARGHESE PHILIP.

Un procedimiento para controlar los nematodos en una planta o sobre ella, en una parte de una planta y/o en la localización donde se desarrolla una planta, que comprende aplicar sobre la planta que se necesita proteger de los nematodos, sobre una parte de la planta o sobre la localización donde se desarrolla la planta una cantidad eficaz de Bacillus pumilus QST2808.

PDF original: ES-2681889_T3.pdf

Control biológico de la enfermedad de la agalla de la corona en vides.

(23/05/2018). Solicitante/s: CORNELL UNIVERSITY . Inventor/es: BURR,THOMAS J, ZHENG,DESEN.

Derivado de la cepa F2/5 de Agrobacterium vitis necrosis-negativo aislado, conservando dicho derivado un control biológico sobre la agalla de la corona, en el que un gen que codifica una aminotransferasa o un regulador de la respuesta al hierro de dicha F2/5 de A. vitis está inactivado o en el que la expresión de la aminotransferasa o del regulador de la respuesta al hierro está reducida o anulada, y en el que dicha aminotransferasa tiene por lo menos un 90% de identidad de secuencia con la SEQ ID NO: 4 y dicho regulador de respuesta al hierro tiene por lo menos un 90% de identidad de secuencia con la SEQ ID NO: 6.

PDF original: ES-2677918_T3.pdf

Plaguicidas.

(02/05/2018). Solicitante/s: UNIVERSITY OF DURHAM. Inventor/es: GATEHOUSE,JOHN A, FITCHES,ELAINE C.

Una proteína de fusión que comprende: (i) una toxina proteica ω-ACTX-Hv1a que comprende la secuencia de aminoácidos SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (SEQ ID NO: 1), o una variante de la misma que retiene sustancialmente la actividad biológica de la toxina proteica ω-ACTX-Hv1a, teniendo dicha variante una secuencia de aminoácidos que tiene al menos un 75 % de identidad con la SEQ ID NO: 1; unida operativamente a (ii) una proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado, en donde la proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado es una lectina vegetal seleccionada entre una cualquiera o más de las siguientes: lectina de galanto (GNA), lectina de ajo Allium sativum, lectina de guisante Pisum sativum (P-lec), lectina de cacahuete Arachis hypogaea, lectina de judía verde (PHA, Phytohaemagglutinin).

PDF original: ES-2674324_T3.pdf

Bacteria aislada del género Streptomyces.

(18/04/2018). Solicitante/s: Agronutrition. Inventor/es: ERRAKHI,RAFIK, ATTIA,FAOUZI, CABANES,CÉDRIC.

Bacteria aislada del género Streptomyces seleccionada del grupo que consiste en: • la bacteria depositada y registrada en la CNCM con el N.º I-4467, y • los mutantes de dicha bacteria depositados y registrados en la CNCM con el N.º I-4467 capaces de inhibir el crecimiento de al menos un microorganismo, denominado microorganismo objetivo, elegido del grupo compuesto por Botrytis cinerae, Fusarium culmorum, Pythium ultimum, Phaeomoniella chlamydospora, Phaeomoniella aelophilum, Eutypa lata, Fomitiporia mediterranea y Botryosphaeria obtusa, obteniéndose los mutantes de dicha bacteria depositada por mutagénesis de dicha bacteria depositada. comprendiendo la bacteria depositada y los mutantes de dicha bacteria depositada una secuencia de ADN, denominada ADN 16Sr, que codifica el ARN ribosómico 16S de dicha bacteria, siendo dicha secuencia de ADN idéntica a la secuencia SEQ ID_NO1.

PDF original: ES-2676460_T3.pdf

Usos agrícolas de una nueva bacteria del género Streptomyces.

(18/04/2018) Método para tratar un material vegetal, en el que se aplica una composición de tratamiento que comprende al menos un agente biológico elegido en el grupo compuesto por: - bacterias del género Streptomyces que comprenden una secuencia de ADN, denominada 16S ADNr, que codifica el ARN ribosómico 16S de dicha bacteria, 100% homólogo con la SEQ ID_NO1, - medios de cultivo que comprenden polinucleótidos que tienen una secuencia de ADN 100% homóloga con SEQ ID_NO1, obtenida por: * cultivar al menos una bacteria del género Streptomyces que comprende la secuencia de 16S rADN 100% homóloga con SEQ ID_NO1 en un medio de cultivo adecuado para permitir el crecimiento…

Composiciones que comprenden un agente de control biológico y un insecticida.

(11/04/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: ANDERSCH, WOLFRAM, DR., HELLWEGE, ELKE, STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control bioIógico seleccionado del grupo que consiste en Bacillus pumilus (n.º de acceso NRRL B-30087), Bacillus subti/is AQ713 (n.º de acceso NRRL B-21661) y Bacillus subtilis AQ30002 (n.º de acceso NRRL B-50421), y al menos un insecticida seleccionado del grupo que consiste en agonistas receptores nicotínicos de acetilcolina (nCAhR) seleccionado del grupo que consiste en Clotianidina, lmidacloprida, Tiacloprida, Tiametoxam y Sulfoxaflor, y los activadores alostéricos del receptor nicotínico de acetilcolina (nAChR) esta seleccionado del grupo que consiste en Espinetoram y Espinosad en una relación en peso sinérgica de agente de control biológico e insecticida de 1:10 a 5000:1 donde el agente de control biológico es Bacillus pumilus; 1:10 a 10000:1 donde el agente de control biológico es Bacillus subtilis QST713; 1:10 a 1000:1 donde el agente de control biológico es Bacillus subtilis AQ30002.

PDF original: ES-2672500_T3.pdf

Proteínas pesticidas modificadas.

(21/03/2018). Solicitante/s: SYNGENTA PARTICIPATIONS AG. Inventor/es: CHEN, JENG, SHONG, LEE,MIKYONG, DE FONTES,CHERYL MARIE, CONVILLE,JARED, PALEKAR,NARENDRA.

Un polipéptido pesticida modificado que comprende una secuencia de aminoácidos con una identidad de al menos un 95% respecto a SEQ ID NO:1 y que comprende además una mutación de un aminoácido en una posición que corresponde a la posición K455 en SEQ ID NO: 1, donde la mutación mejora la actividad pesticida del polipéptido modificado contra al menos Ostrinia nubilalis (gusano barrenador del maíz europeo, ECB) en comparación con la actividad frente a ECB de un polipéptido de origen natural a partir del cual se obtiene el polipéptido modificado.

PDF original: ES-2670505_T3.pdf

Remodelación de tejidos y órganos.

(14/03/2018). Solicitante/s: LIFECELL CORPORATION. Inventor/es: LIVESEY, STEPHEN A., BOERBOOM,LAWRENCE,E, MCQUILLAN,DAVID J, BENIKER,HERBERT DANIEL, HAGGARD,WARREN O.

Una composición para su uso en el tratamiento de un sujeto mamífero que tiene un defecto óseo, que comprende: un gel, pasta o masilla hidratados que incluyen una mezcla de una matriz dérmica acelular particulada y polvo de hueso desmineralizado adaptados para colocarse en el defecto óseo del sujeto mamífero.

PDF original: ES-2672815_T3.pdf

Método de recuperación del suelo, de olivos y otros árboles, afectados por Verticillium basado en el uso de cal viva.

(12/03/2018). Solicitante/s: OLIVARES BUENO, Joaquín. Inventor/es: OLIVARES BUENO,Joaquín, OLIVARES BUENO,José Alberto, OLIVARES ALBACETE,Desiderio.

Esta invención consiste en un método que recupera árboles afectados por la Verticilosis, consiguiendo que vuelvan a ser productivos y curándolo de dicha enfermedad. También es útil para recuperar el suelo infestado por el hongo del Verticillium, eliminándolo de forma que el suelo puede volver a ser utilizado. Ha sido probado eficazmente en el olivo.

PDF original: ES-2658787_A1.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · 9 · 10 · 11 · 12 · ››

 

Últimas patentes publicadas

 

Clasificación Internacional de Patentes 2015