CIP 2015 : A61K 39/35 : Alergenos.

CIP2015AA61A61KA61K 39/00A61K 39/35[1] › Alergenos.

Notas[t] desde A61 hasta A63: SALUD; SALVAMENTO; DIVERSIONES
Notas[n] desde A61K 31/00 hasta A61K 47/00:
  • Una composición, es decir, una mezcla de dos o más componentes, se clasifica en el último de los grupos A61K 31/00 - A61K 47/00 que cubra al menos uno de estos componentes. Los componentes pueden ser compuestos simples u otros ingredientes simples.
  • Cualquier parte de una composición que, en aplicación de la Nota (1), no esté identificada como tal por una clasificación asignada, pero que por sí misma se considere nueva y no obvia, debe clasificarse también en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . La parte puede ser un componente simple o una composición propiamente dicha.
  • Cualquier parte de una composición que, en aplicación de las Notas (1) ó (2), no esté identificada como tal por una clasificación asignada, pero que se considere que representa información de interés para la búsqueda, puede clasificarse además en el último lugar apropiado de los grupos A61K 31/00 - A61K 47/00 . Este caso puede plantearse cuando se considera de interés facilitar las búsquedas de composiciones utilizando una combinación de símbolos de clasificación. Esta clasificación optativa debería ser dada como "información adicional".

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A61 CIENCIAS MEDICAS O VETERINARIAS; HIGIENE.

A61K PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO (dispositivos o métodos especialmente concebidos para conferir a los productos farmacéuticos una forma física o de administración particular A61J 3/00; aspectos químicos o utilización de substancias químicas para, la desodorización del aire, la desinfección o la esterilización, vendas, apósitos, almohadillas absorbentes o de los artículos para su realización A61L;   composiciones a base de jabón C11D).

A61K 39/00 Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53).

A61K 39/35 · Alergenos.

CIP2015: Invenciones publicadas en esta sección.

Pasta de dientes para desensibilización alérgica a través de la mucosa oral.

(13/02/2019). Solicitante/s: Allovate, LLC. Inventor/es: FRANCOIS,CEDRIC.

Una composición de higiene dental para el suministro de un alérgeno a la mucosa oral, comprendiendo la composición: a) un ingrediente base de higiene dental; y b) uno o más alérgenos; en donde la composición de higiene dental es una pasta de dientes, y uno o más alérgenos comprenden una proteína alergénica.

PDF original: ES-2723173_T3.pdf

Transportador de vacuna.

(05/02/2019). Solicitante/s: BIOMAY AG. Inventor/es: VALENTA, RUDOLF, VRTALA, SUSANNE, VALENT, PETER, WESTRITSCHNIG, KERSTIN, LINHART,BIRGIT, SPITZAUER,SUSANNE, SWOBODA,INES, GRONLUND,HANS, FOCKE-TEJKL,MARGARETE, REININGER,RENATE, VAN HAGE,MARIANNE, TINHOFER,JOHANNA, POPOW-KRAUPP,THERESIA.

Una molécula hipoalergénica derivada de PhI p 5 y que consiste en la secuencia de aminoácidos GAASNKAFAEGLSGEPKGAAESSSKAALTSK, ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGK o TVATAPEVKYTVFETALKKAITAMSEAQKAAK.

PDF original: ES-2698525_T3.pdf

Reducción de la genotoxicidad in vitro de extractos de polen mediante la eliminación de flavonoides.

(23/01/2019). Solicitante/s: Stallergenes. Inventor/es: BATARD, THIERRY, MOINGEON,PHILIPPE, VILLET,BERTRAND.

Un extracto de polen purificado que contiene alérgenos de polen, en el que cada flavonoide está contenido en una cantidad que es inferior a 0,001 g por 100 g de fracción derivada de polen seco, expresada en equivalente de aglucona, en el que dicho extracto de alérgeno de polen purificado se puede obtener mediante un procedimiento que comprende una etapa de ultrafiltración de un extracto de alérgeno de polen acuoso en una membrana de 1-10 kDa y al menos 5 volúmenes de una disolución de bicarbonato de amonio, y una etapa de filtración estéril a través de un filtro de 0,22 μm.

PDF original: ES-2721752_T3.pdf

Composición de vacuna que contiene un adyuvante sintético.

(23/05/2018). Solicitante/s: INFECTIOUS DISEASE RESEARCH INSTITUTE. Inventor/es: REED, STEVEN G., CARTER,DARRICK.

Composición de células y GLA para su uso en un método para aumentr o provocar una respuesta inmune en un paciente, donde las células se aíslan de un cultivo celular ex vivo que comprende células de un paciente, en donde el GLA tiene la fórmula:**Fórmula** en la que: R1, R3, R5 y R6 son undecilo y R2 y R4 son tridecilo.

PDF original: ES-2675915_T3.pdf

Composición de vacuna que contiene un adyuvante sintético.

(09/05/2018). Solicitante/s: INFECTIOUS DISEASE RESEARCH INSTITUTE. Inventor/es: REED, STEVEN G., CARTER,DARRICK.

Una composición que comprende un adyuvante lípido de glucopiranosilo (GLA), y un vehículo o excipiente farmacéuticamente aceptable, para usar en un método para tratar o prevenir un cáncer, una enfermedad infecciosa o un enfermedad autoinmune en un huésped, en donde dicho método incluye administrar al huésped de manera simultánea o secuencial, y en cualquier orden, GLA y un antígeno que se deriva de, o tiene reacción inmunológica cruzada con (i) al menos un epítopo, biomolécula, célula o tejido que está asociado con un cáncer, (ii) al menos un patógeno infeccioso que está asociado con una enfermedad infecciosa o (iii) al menos un epítopo, biomolécula, célula o tejido que está asociado con una enfermedad autoinmune; donde el GLA tiene la fórmula**Fórmula** en la que: R1, R3, R5 y R6 son iguales a undecilo, y R2 y R4 son iguales a tridecilo.

PDF original: ES-2673046_T3.pdf

Clonación de alérgeno de abeja melífera.

(11/04/2018). Solicitante/s: PLS-DESIGN GMBH. Inventor/es: GRUNWALD,THOMAS.

Ácido nucleico que codifica un polipéptido capaz de unirse a IgE de sujetos alérgicos al veneno de un insecto del orden Hymenoptera, en el que el polipéptido tiene la secuencia de aminoácidos de SEQ ID NO: 2.

PDF original: ES-2677020_T3.pdf

Extractos de alérgenos.

(04/04/2018). Solicitante/s: Laboratorios LETI, S.L. Inventor/es: CARNES SÁNCHEZ,JERÓNIMO.

Un extracto de alérgeno polimerizado despigmentado seleccionado de cacahuete, polen de Phleum pratense y epitelio de gato capaz de reducir significativamente la potencia biológica de IgE reduciendo la capacidad de enlazamiento a IgE con respecto al extracto natural determinado por inhibición por ELISA de IgE o competición de inmunoensayo de enzima reversa (REINA), y retener la capacidad inmunogénica, en donde la inhibición por ELISA de IgE o la competición REINA se realiza usando un conjunto de sueros a partir de individuos sensibilizados.

PDF original: ES-2676058_T3.pdf

Vacuna de MTB-C contra respuestas alérgicas.

(07/03/2018). Solicitante/s: ARCHIVEL FARMA, S.L. Inventor/es: CARDONA IGLESIAS,PERE JOAN, AMAT RIERA,ISABEL, REYES MORENO,BLANCA, AMAT FABREGAT,MARIA MERCÈ.

Un agente, que es una formulación de liposoma que comprende: (a) fragmentos de pared celular de una cepa de complejo Mycobacterium tuberculosis (MTB-C), (b) un agente de formación de liposoma, y (c) sacarosa a del 1 al 20 % para su uso en la prevención o terapia de una respuesta alérgica de un humano o animal.

PDF original: ES-2670493_T3.pdf

Tratamiento de enfermedad inmune mediante suministro a la mucosa de antígenos.

(24/01/2018). Solicitante/s: Intrexon Actobiotics NV. Inventor/es: ROTTIERS,PIETER, SNOECK,VEERLE.

Un microorganismo que comprende un ácido nucleico que codifica un antígeno para uso en el tratamiento de una respuesta inmune relacionada con una enfermedad seleccionada de una enfermedad autoinmune, una enfermedad alérgica y enfermedad de injerto contra anfitrión, en un sujeto humano, en el que dicho antígeno se expresa y secreta constitutivamente por dicho microorganismo, en el que dicho microorganismo es una bacteria Lactococcus sp., y dicho antígeno es para ser administrado a través de suministro a la mucosa, y en el que dicho sujeto humano ha establecido hipersensibilidad a dicho antígeno.

PDF original: ES-2666658_T3.pdf

Péptidos inmunogénicos y su uso en trastornos inmunitarios.

(20/12/2017). Solicitante/s: Life Sciences Research Partners VZW. Inventor/es: SAINT-REMY, JEAN-MARIE.

Un péptido inmunogénico aislado con una longitud de entre 12 y 50 aminoácidos de un autoantígeno implicado en la diabetes de tipo 1, comprendiendo el péptido: un epítopo de linfocitos T del MHC de clase II de dicho autoantígeno; y un motivo redox C-X -C, estando dicho motivo adyacente a dicho epítopo o separado de dicho epítopo por un máximo de 7 aminoácidos.

PDF original: ES-2657504_T3.pdf

Vacunas multivalentes de nanovehículos sintéticos.

(06/12/2017). Solicitante/s: Selecta Biosciences, Inc. Inventor/es: JOHNSTON,LLOYD, LIPFORD,GRAYSON B, BRATZLER,ROBERT L, ZEPP,CHARLES.

Una composición que comprende: una forma de dosificación que comprende: una primera población de nanovehículos sintéticos poliméricos que comprende un primer conjunto de antígenos de superficie; una segunda población de nanovehículos sintéticos poliméricos que comprende un segundo conjunto de antígenos de superficie; y un excipiente farmacéuticamente aceptable; donde la primera población de nanovehículos sintéticos y la segunda población de nanovehículos sintéticos se combinan en la forma de dosificación para formar una vacuna multivalente para la administración y donde el primer conjunto de antígenos de superficie y el segundo conjunto de antígenos de superficie son estructural e inmunológicamente diferentes.

PDF original: ES-2661978_T3.pdf

Péptidos inmunogénicos y su uso en trastornos inmunitarios.

(29/11/2017). Solicitante/s: Life Sciences Research Partners VZW. Inventor/es: SAINT-REMY, JEAN-MARIE.

Un péptido inmunogénico aislado que comprende: - un epítopo de linfocitos T del MHC de clase II de una proteína autoantigénica implicada en esclerosis múltiple; y - un motivo redox C-X -[CT] o [CST]-X -C, estando dicho motivo adyacente a dicho epítopo o separado de dicho epítopo por un máximo de 7 aminoácidos.

PDF original: ES-2657480_T3.pdf

Procedimiento de producción de alérgenos hidrolizados.

(29/11/2017) Un procedimiento de producción de alérgenos hidrolizados a partir de alérgenos que comprende las etapas de: a) extracción de una fuente de alérgenos que comprende proteínas alergénicas para formar un extracto en bruto, b) purificación del extracto en bruto para retirar los componentes no proteicos para formar un extracto purificado, c) desnaturalización del extracto purificado con un primer agente de desnaturalización que es una mezcla de agentes caotrópicos y agentes reductores para formar un extracto desnaturalizado purificado, f) hidrolización de la mezcla de alérgenos desnaturalizados para formar los alérgenos hidrolizados, g) purificación de los alérgenos hidrolizados para retirar los péptidos con pesos moleculares por…

Procedimiento de producción de alérgeno hidrolizado.

(01/11/2017) Un procedimiento de producción de un hidrolizado de alérgeno purificado que comprende los pasos de a) extraer una fuente natural de alergenos que comprende proteínas alergénicas para formar un extracto, b) purificación de dicho extracto para eliminar componentes no proteicos para formar un extracto purificado, c) desnaturalizar dicho extracto purificado para formar un extracto desnaturalizado purificado, en el que la desnaturalización se realiza con mezclas de agentes caotrópicos y agentes reductores, dicho extracto desnaturalizado purificado comprende proteínas, en el que ninguna proteína individual es el 60 % o más (p/p) de todas las proteínas medidas por SDS-PAGE seguido de densitometría y todas las proteínas representan al menos…

Formulación particulada mucoadhesiva para inducir una tolerancia inmunitaria específica de antígeno.

(23/08/2017). Solicitante/s: Stallergenes. Inventor/es: MOINGEON,PHILIPPE, RAZAFINDRATSITA,ALAIN, TOURDOT,SOPHIE, SAINT-LU,NATHALIE, VAN OVERTVELT,LAURENCE.

Composición mucoadhesiva adaptada para prevenir y/o tratar una reacción patológica del sistema inmunitario de un individuo mediante la inducción de una tolerancia específica hacia al menos un antígeno implicado en dicha reacción patológica, que comprende partículas de quitosano cargadas con dicho al menos un antígeno implicado en la reacción patológica, siendo dicho antígeno una proteína, un polipéptido o un péptido, en la que el tamaño de las partículas de quitosano cargadas es de 1 mm a 3 mm, y las partículas de quitosano están formadas de quitosano cuya viscosidad es de al menos 800 mPa.s cuando se mide según el procedimiento de Brookfield con una solución al 1% de quitosano en ácido acético al 1%.

PDF original: ES-2648866_T3.pdf

Composiciones para inmunoterapia.

(09/08/2017). Solicitante/s: HAL ALLERGY HOLDING B.V. Inventor/es: OPSTELTEN,DIRK,JAN,ELBERTUS, VAN DER KLEIJ,JOANNA PAULINA MARIA.

Composición adecuada para inmunoterapia que comprende un alérgeno, en donde más del 99% de dicho alérgeno en dicha composición está complejado o conjugado con aluminio, en donde dicho alérgeno es un extracto de proteína del grano de cacahuete y en donde dicho alérgeno no está modificado mediante reducción y alquilación.

PDF original: ES-2645740_T3.pdf

Proteínas híbridas hipoalergénicas de alérgenos de ácaros del grupo 1 y 2 principales para uso en el tratamiento de alergias.

(02/08/2017). Solicitante/s: BIAL INDUSTRIAL FARMACEUTICA, S.A.. Inventor/es: MARTINEZ GARATE,ALBERTO, ASTURIAS ORTEGA,JUAN ANDRES, IBARROLA LOPEZ DE DAVALILLO,IÑAKI, ARILLA RODRIGUEZ,MARIA CARMEN.

Polipéptido con actividad alergénica reducida que comprende fragmentos de las secuencias de aminoácidos de los alérgenos del ácaro D.pteronyssinus del grupo 1 y grupo 2 Der p 1 y Der p 2 en los cuales las secuencias carecen de uno o más epítopos de unión de anticuerpo IgE, dichos fragmentos tienen por lo menos 50 residuos de aminoácidos en longitud, caracterizado porque el polipéptido tiene por lo menos 95% de homología con la SEQ ID No.: 2, y tiene alergenicidad, según se mide por capacidad de unión a IgE, aproximadamente 2500 veces menor que aquella de la mezcla de las proteínas de alérgenos Der p 1 y Der p 2 naturales individuales.

PDF original: ES-2638308_T3.pdf

Proteínas híbridas hipoalergénicas de alérgenos de ácaros del grupo 1 y 2 principales para uso en el tratamiento de alergias.

(02/08/2017). Solicitante/s: BIAL INDUSTRIAL FARMACEUTICA, S.A.. Inventor/es: MARTINEZ GARATE,ALBERTO, ASTURIAS ORTEGA,JUAN ANDRES, IBARROLA LOPEZ DE DAVALILLO,IÑAKI, ARILLA RODRIGUEZ,MARIA CARMEN.

Polipéptido con actividad alergénica reducida que comprende fragmentos de las secuencias de aminoácidos de los alérgenos del ácaro D.pteronyssinus del grupo 1 y grupo 2 Der p 1 y Der p 2 en los cuales las secuencias carecen de uno o más epítopos de unión de anticuerpo IgE, dichos fragmentos tienen por lo menos 50 residuos de aminoácidos en longitud, caracterizado porque el polipéptido tiene al menos 95% de homología con la SEQ ID NO: 4, y no muestra reconocimiento de IgE en sueros de pacientes alérgicos a D. pteronyssinus.

PDF original: ES-2638271_T3.pdf

Método para prevenir las alergias.

(19/07/2017). Solicitante/s: DBV TECHNOLOGIES. Inventor/es: DUPONT, CHRISTOPHE, BENHAMOU, PIERRE-HENRI, MONDOULET,LUCIE.

Una composición que comprende un alérgeno de la leche para su uso en el tratamiento de un niño menor de 6 años que tiene una alergia detectada a la leche, para evitar que dicho niño desarrolle una alergia adicional a un alérgeno alimentario diferente, en donde la composición se administra repetidamente epicutáneamente a dicho niño utilizando un dispositivo de parche oclusivo no invasivo, protegiendo dicha administración al niño del desarrollo de al menos una alergia adicional al alérgeno alimentario diferente.

PDF original: ES-2644118_T3.pdf

Métodos para reducir las alergias provocadas por alérgenos ambientales.

(21/06/2017). Solicitante/s: NESTEC S.A.. Inventor/es: SATYARAJ,EBENEZER, WELLS,GEORGE.

Uso de un anticuerpo policlonal que inhibe la capacidad del alérgeno Fel D1, Can F1, Der p1, Der p2, Bla g1, Bla g2, Asf 1, Ara hl, Ara h2 o Ara h3 de unirse a mastocitos, para reducir una respuesta alérgica en un ser humano, un felino o un canino predispuesto a tener una respuesta alérgica frente a dicho alérgeno, que comprende minimizar la exposición al alérgeno poniendo en contacto una fuente del alérgeno en el entorno con una composición que contiene dicho anticuerpo policlonal.

PDF original: ES-2635870_T3.pdf

Tratamiento para la alergia a los cacahuetes.

(03/05/2017). Solicitante/s: CAMBRIDGE UNIVERSITY HOSPITALS NHS FOUNDATION TRUST. Inventor/es: CLARK, ANDREW, EWAN,PAMELA.

Una composición terapéutica que comprende proteína de cacahuete para su uso en un método para tratar a un individuo con alergia a los cacahuetes, que comprende: proporcionar un individuo con alergia a los cacahuetes, administrar por vía oral una dosis diaria de proteína de cacahuete al paciente, en donde la dosis oral diaria aumenta a intervalos de al menos 2 semanas en una serie de incrementos que comienzan desde una dosis inicial de 2 mg hasta una dosis máxima de 800 mg o menor, incluyendo la serie de incrementos de dosis 2 mg, 5 mg, 12,5 mg, 25 mg, 50 mg, 100 mg y 200 mg, administrar una dosis oral diaria de la dosis máxima de proteína de cacahuete durante al menos 1 año después de la etapa 2.

PDF original: ES-2633319_T3.pdf

Nuevos alérgenos de trigo.

(19/04/2017). Solicitante/s: PHADIA AB. Inventor/es: VALENTA, RUDOLF, CONSTANTIN,CLAUDIA, QUIRCE,SANTIAGO.

Un polipéptido aislado que comprende la secuencia de aminoácidos de acuerdo con el SEQ ID NO: 2.

PDF original: ES-2634241_T3.pdf

Reducción de la genotoxicidad in vitro de extractos de polen mediante la eliminación de flavonoides.

(12/04/2017). Solicitante/s: Stallergenes. Inventor/es: BATARD, THIERRY, MOINGEON,PHILIPPE, VILLET,BERTRAND.

Un procedimiento de reducción de la genotoxicidad in vitro de un extracto de polen que comprende la etapa consistente en reducir la cantidad de un flavonoide en el extracto de polen por ultrafiltración del extracto de polen con una membrana de 1-10 kDa y al menos 5 volúmenes de una disolución de bicarbonato de amonio, y una etapa de filtración estéril a través de un filtro de 0,22 μm.

PDF original: ES-2625977_T3.pdf

PÉPTIDO DERIVADO DEL ALÉRGENO PRU P 3 DE.

(30/03/2017). Solicitante/s: SERVICIO ANDALUZ DE SALUD. Inventor/es: ANDREU MARTINEZ,DAVID, BLANCA GOMEZ,MIGUEL, MAYORGA MAYORGA,CRISTOBALINA, TORRES JAEN,MARIA JOSE, ROJO MARCOS,Francisco Javier, MASCARAQUE GONZÁLEZ,Ainhoa, RAMOS SORIANO,Francisco Javier, FERNÁNDEZ PACIOS,Luis, DÍAZ PERALES,Araceli, VALLE GARCÍA,Javier.

Péptido para el tratamiento de la alergia La presente invención hace referencia a un péptido para el tratamiento de la alergia. Más específicamenteuna secuencia aminoacídicao peptídica (identificada en la presente invención como SEQ ID NO: 1) desarrollada a partir de varias regiones de la proteína Pru p 3. Adicionalmente, se refiere a un procedimiento para insertar dicha secuencia (SEQ ID NO: 1) en un sistema dendrítico. Dicho péptido de SEQ ID NO: 1 y complejo péptido-dendrímero proporcionan nuevas herramientas terapéuticas útiles, para la prevención, mejora, alivio y/o tratamiento de la alergia, concretamente de la alergia causada por el síndrome LTP.

Inmunoterapia para alergia alimentaria mediante alérgenos alimentarios reducidos y alquilados.

(15/02/2017). Solicitante/s: HAL ALLERGY HOLDING B.V. Inventor/es: KOPPELMAN,STEFAN JOHAN, PENNINKS,ANDREAS HENDRIKUS, KNIPPELS,LÉON MATHIEU JOHANNES.

Alérgeno alimentario modificado, en donde el alérgeno alimentario se modifica por reducción y alquilación y en donde se rompen esencialmente todos los enlaces disulfuro en el alérgeno alimentario, para uso en el tratamiento de un individuo que padece o que tiene tendencia a desarrollar una alergia alimentaria, dicho tratamiento comprende administrar a dicho individuo una cantidad terapéuticamente eficaz de dicho alérgeno alimentario modificado, en donde el alérgeno alimentario es una proteína alimentaria alergénica.

PDF original: ES-2625095_T3.pdf

Polipéptidos profilinas vegetales para su uso en inmunoterapia de alergia inespecífica.

(01/02/2017). Solicitante/s: ALK-ABELLO A/S. Inventor/es: LUND, KAARE, IPSEN, HANS-HENRIK, BRIMNES,JENS, MONSALVE CLEMENTE,Rafael Ignacio, HENMAR,HELENE, MÆRKEDAHL,LISE LUND, HANSEN,GITTE NORDSKOV.

Un polipéptido para su uso en el tratamiento de una respuesta immune de hipersensibilidad en un individuo, en el que la respuesta immune de hipersensibilidad está causada por un alérgeno distinto de la profilina de un material vegetal que contiene profilina, en el que dicho polipéptido comprende una secuencia de aminoácidos que tiene al menos 60 % de identidad con SEQ ID NO: 1.

PDF original: ES-2623050_T3.pdf

Método inmunoterapéutico para aumentar en un sujeto la tolerancia a los cacahuetes.

(07/09/2016). Solicitante/s: DBV TECHNOLOGIES. Inventor/es: DUPONT, CHRISTOPHE, DUPONT, BERTRAND, BENHAMOU, PIERRE-HENRI, MONDOULET,LUCIE.

Una composición de alérgenos de cacahuete para uso en el aumento de la tolerancia a los cacahuetes en un sujeto alérgico a los cacahuetes, en donde dicha composición comprende una o más proteínas seleccionadas de Ara h 1, Ara h 2 y Ara h 3 o sus isoformas, sin adyuvante, y en donde dicha composición se administra repetidamente a dicho sujeto por vía epicutánea por medio de un dispositivo de parche para la piel que comprende un soporte, estando adaptada la periferia de dicho soporte para crear con la piel una cámara herméticamente cerrada, en donde el parche comprende dicha composición en una dosis suficiente para inducir y controlar una reacción inflamatoria sobre la piel de dicho sujeto después de la aplicación del dispositivo de parche a la piel, conduciendo dicha administración, por repetición, a un aumento progresivo en el sujeto de la tolerancia a los cacahuetes.

PDF original: ES-2605740_T3.pdf

Péptidos inmunógenos y su uso en trastornos inmunitarios.

(03/08/2016). Solicitante/s: Life Sciences Research Partners VZW. Inventor/es: SAINT-REMY, JEAN-MARIE.

Un péptido inmunógeno aislado, con una longitud de entre 12 y 50 aminoácidos, que comprende: - un epítopo de linfocito T de un alérgeno o autoantígeno, cuyo epítopo encaja en la hendidura de una proteína MHC II, y - un motivo C-X -C, estando dicho motivo adyacente a dicho epítopo o separado de dicho epítopo por como máximo 7 aminoácidos, en donde dicho alérgeno o autoantígeno no comprende un motivo C-X -C dentro de una secuencia de 11 aminoácidos N o C terminales de dicha secuencia de epítopo.

PDF original: ES-2601432_T3.pdf

Nueva manera de administrar alérgeno en inmunoterapia específica con alérgenos.

(03/08/2016). Solicitante/s: ALK-ABELLÓ S.A. Inventor/es: RICO NIETO,Pilar, SASTRE DOMÍNGUEZ,JOAQUÍN.

Una composición alergénica que comprende un alérgeno de inhalación o un alérgeno de veneno asociado con una alergia mediada por la IgE, formulada para que sea adecuada para la administración subcutánea, para su uso en inmunoterapia específica subcutánea con alérgenos que comprende una fase de dosificación creciente y una fase de mantenimiento, y en la que se administra una dosis de la composición alergénica en la fase de dosificación creciente a un individuo que la necesita mediante el uso de infusión subcutánea usando un flujo continuo a un caudal que supera los 0,05 ml/min en un período en el intervalo de 5 a 180 minutos, y en la que la dosificación creciente tiene una duración de 2 a 6 semanas y el número de administraciones de las dosis individuales en la fase de administración creciente es de 2 a 4.

PDF original: ES-2606550_T3.pdf

Nuevo Alérgeno.

(22/06/2016). Solicitante/s: PHADIA AB. Inventor/es: LIDHOLM,JONAS, LUNDGREN,THOMAS, MATTSSON,LARS.

Un alérgeno aislado de caballo que es una secretoglobina que tiene un peso molecular de 15 kDa en condiciones no reductoras y que comprende una primera cadena peptídica que tiene un peso molecular de 5 kD, que comprende la secuencia de aminoácidos ATCPAVATDIASFFLLPDSLFKLQLIKYQAPPEAKDATMQVKQCINEISAGDRYIITETLGKIVLQCGA (SEQ ID NO: 4), y una segunda cadena peptídica que tiene un peso molecular de 10 kDa, que comprende la secuencia de aminoácidos GSGCQLLEDVVEKTITAELSPAEYVEAVQEFIPDEATEKAAIQLKQCYLKQSNETLNDFRTMMNSMYNSAYCALF (SEQ ID NO: 5), unidas juntas, o una variante o el fragmento del mismo que comparte epítopos para anticuerpos IgE con la misma, cuya variante o el fragmento del mismo tiene una identidad de secuencia frente a dicho alérgeno de caballo de al menos el 70%.

PDF original: ES-2592956_T3.pdf

Uso de la chaperonina 60.1 de M. tuberculosis para el tratamiento de la artritis.

(04/05/2016). Solicitante/s: Peptinnovate Limited. Inventor/es: COATES,ANTHONY ROBERT.

Una composición farmacéutica para su uso en la prevención y/o tratamiento de la artritis reumatoide, en la que la composición farmacéutica comprende una molécula de ácido nucleico que comprende (i) la secuencia de nucleótidos de la Figura 1, o (ii) una secuencia que tiene más de 70, por ejemplo, 75 %, preferiblemente más de 80 %, por ejemplo más de 90 o 95 % de identidad con la secuencia (i) o una secuencia que hibrida con la secuencia (i) en condiciones de 2 x SSC, 65 °C (en la que SCC ≥ NaCl 0,15 M, citrato sódico 0,015 M, pH 7,2) que codifica una proteína funcionalmente equivalente a la secuencia codificada por la secuencia de nucleótidos de la Figura 1, o (iii) un fragmento de la secuencia (i) o (ii) que codifica un fragmento de proteína funcionalmente equivalente y un excipiente, diluyente o vehículo farmacéuticamente aceptable.

PDF original: ES-2585641_T3.pdf

Nuevas composiciones y métodos para el tratamiento de enfermedades autoinmunes y alérgicas.

(27/04/2016). Solicitante/s: Toleranzia AB. Inventor/es: LYCKE,NILS.

Un complejo inmunomodulador que es una proteína de fusión que comprende: (a) una subunidad mutante de la ribosilación de ADP de subunidad A1 de la toxina del cólera (CTA1), (b) un péptido capaz de unirse a un receptor celular específico en donde dicho péptido es un dímero de subunidad D de la proteína A de Staphylococcus aureus, y (c) uno o más epítopos asociados con una enfermedad autoinmune o alérgica, en donde, en la subunidad CTA1 mutante, los aminoácidos que corresponden al aminoácido 7, arginina y aminoácidos 187, cisteína, en la CTA1 nativa han sido reemplazados con lisina en el aminoácido 7 y alanina en el aminoácido 187.

PDF original: ES-2578711_T3.pdf

1 · · 3 · ››

 

Patentes más consultadas

 

Clasificación Internacional de Patentes 2015