CIP 2015 : A01N 43/50 : 1,3-Diazoles; Diazoles hidrogenados.

CIP2015AA01A01NA01N 43/00A01N 43/50[2] › 1,3-Diazoles; Diazoles hidrogenados.

Notas[g] desde A01N 25/00 hasta A01N 65/00: Biocidas; Productos que atraen o repelen a los animales perjudiciales; Reguladores del crecimiento de los vegetales

A SECCION A — NECESIDADES CORRIENTES DE LA VIDA.

A01 AGRICULTURA; SILVICULTURA; CRIA; CAZA; CAPTURA; PESCA.

A01N CONSERVACION DE CUERPOS HUMANOS O ANIMALES O DE VEGETALES O DE PARTES DE ELLOS (conservación de alimentos o productos alimenticios A23 ); BIOCIDAS, p. ej. EN TANTO QUE SEAN DESINFECTANTES, PESTICIDAS O HERBICIDAS (preparaciones de uso médico, dental o para el aseo que eliminan o previenen el crecimiento o la proliferación de organismos no deseados A61K ); PRODUCTOS QUE ATRAEN O REPELEN A LOS ANIMALES; REGULADORES DEL CRECIMIENTO DE LOS VEGETALES (mezclas de pesticidas con fertilizantes C05G).

A01N 43/00 Biocidas, productos que atraen o repelen a los animales perjudiciales, o reguladores del crecimiento de los vegetales, que contienen compuestos heterocíclicos (que contienen anhídridos cíclicos, imidas cíclicas A01N 37/00; que contienen compuestos de fórmula , que no tienen más que un heterociclo en los que m ≥ 1 y n ≥ 0 y es una pirrolidina, una piperidina, una morfolina, una tiomorfolina, una piperazina o una polimetilenoimina, no sustituida o sustituida por un alcoilo, que tiene al menos cuatro grupos CH 2 A01N 33/00 - A01N 41/12; que contienen ácidos ciclopropanocarbhoxílicos o sus derivados, p. ej. ésteres con heterociclos, A01N 53/00).

A01N 43/50 · · 1,3-Diazoles; Diazoles hidrogenados.

CIP2015: Invenciones publicadas en esta sección.

Tratamiento y/o profilaxis de enfermedades de almacenamiento en productos cosechados.

(25/03/2020). Ver ilustración. Solicitante/s: SP Sourcon Padena GmbH. Inventor/es: VOGT,Wolfgang.

Utilización de la bacteria Pseudomonas sp. Proradix (DSMZ 13134) para el tratamiento y/o la profilaxis de enfermedades de almacenamiento en productos cosechados, caracterizada por que la enfermedad de almacenamiento es causada por el hongo Helminthosporium solani (sarna plateada), y el producto cosechado se pone en contacto con una solución que contiene la bacteria Pseudomonas sp. Proradix (DSMZ 13134), y el producto cosechado son tubérculos de la planta de patata (Solanum tuberosum).

PDF original: ES-2798104_T3.pdf

Composición de tratamiento del agua que contiene compuesto de liberación de halógeno y fluoropolímero.

(26/02/2020). Solicitante/s: Innovative Water Care, LLC. Inventor/es: UNHOCH, MICHAEL, J., WISE,NICOLE, PARISH,DEREK FRANCIS.

Una composición de tratamiento del agua, que comprende una estructura unitaria formada a partir de una combinación de: (i) el 50-99,25 % en peso de un compuesto de liberación de halógeno de material en forma de partículas que comprende ácidos isocianúricos clorados; y (ii) el 0,75-2,0 % en peso de fluoropolímero de material en forma de partículas para ralentizar la velocidad de disolución del compuesto de liberación de halógeno en agua, en donde todos los porcentajes en peso se basan en el peso total de dicha composición.

PDF original: ES-2790998_T3.pdf

Mezclas de pesticidas.

(26/02/2020). Solicitante/s: BASF CORPORATION. Inventor/es: GEWEHR, MARKUS, WILHELM,RONALD, LIEBMANN,BURGHARD, BRAHM,LUTZ.

Mezclas sinergicas que comprenden, como principios activos, 1) un compuesto fungicida IA seleccionado del grupo que consiste en piraclostrobina y triticonazol; o 2) el compuesto insecticida IB teflutrina; y 3) Bacillus subtilis MBI600 como compuesto II que tiene el numero de registro NRRL B-50595 en las que la razon en peso desde el compuesto IA hasta el compuesto II es desde 1:50 hasta 50:1 y en las que la razon en peso desde el compuesto IB hasta el compuesto II es desde 50:1 hasta 1:1.

PDF original: ES-2785070_T3.pdf

Sulfonilamidas sustituidas para combatir parásitos animales.

(05/02/2020) Uso de un compuesto de la fórmula (I) **(Ver fórmula)** en la que M representa un resto seleccionado de las fórmulas (IIa-IIf): **(Ver fórmula)** donde R1, R2, R3 son en cada caso independientemente entre sí H o un resto alquilo, cicloalquilo, alquenilo, cicloalquenilo, cicloheteroalquilo, arilo o heteroarilo sustituido o no sustituido, donde R2 en el caso de (IIc) y (IIe) adicionalmente puede ser un resto halógeno o un resto alcoxi, y R3 adicionalmente en el caso de (IIa), (IId) y (IIe) puede ser un resto halógeno; Q es un resto arilo o heteroarilo sustituido o no sustituido, pero en el caso de (IIe) no es 2-piridimidinilo; D es un resto alquilo sustituido o no sustituido, heteroalquilo, cicloalquilo dado el caso parcialmente insaturado, cicloheteroalquilo,…

Pirrolidinonas como herbicidas.

(05/02/2020) Compuesto seleccionado de la Fórmula 1, N-óxidos y sales del mismo: **(Ver fórmula)** donde Q1 es un sistema de anillos de naftalenilo o anillo de fenilo, estando opcionalmente sustituido cada anillo o cada sistema de anillos por hasta 5 sustituyentes seleccionados independientemente de R7; o un anillo heterocíclico de 5 a 6 miembros o un sistema de anillos bicíclico heteroaromático de 8 a 10 miembros, conteniendo cada anillo o sistema de anillos miembros anulares seleccionados de entre átomos de carbono y de 1 a 4 heteroátomos seleccionados de manera independiente de hasta 2 átomos O, hasta 2 átomos S y 10 hasta 4 átomos N, donde hasta 3 miembros anulares de carbono se seleccionan independientemente de entre C(=O) y C(=S),…

Compuestos y composiciones que tienen actividad debilitante o inhibidora de la alimentación a partir de sangre contra plagas de insectos.

(15/01/2020). Solicitante/s: SYNGENTA PARTICIPATIONS AG. Inventor/es: PITTERNA, THOMAS, MAIENFISCH, PETER, HUETER,Ottmar,Franz, HOPPE,MARK, WEGE,PHILIP, BOEGER,MANFRED.

Un método para controlar un mosquito molesto, portador de enfermedades que comprende: aplicar una composición que contiene una cantidad eficaz para debilitar o inhibir la alimentación a partir de sangre de un compuesto de tipo 4-(trifluorometil)piridina a un mosquito de este tipo o a un lugar donde se desea un control de este tipo, donde el compuesto de tipo 4-(trifluorometil)piridina se selecciona a partir del grupo constituido por un compuesto representado por las fórmulas 1.1-1.29; con la excepción de un método para el tratamiento del cuerpo humano o animal por cirugía o terapia y métodos diagnósticos llevados a cabo en el cuerpo humano o animal. **(Ver fórmula)**.

PDF original: ES-2784726_T3.pdf

Composiciones plaguicidas y procedimientos relacionados.

(11/12/2019) Una composición que comprende una molécula de acuerdo con **(Ver fórmula)** en donde (a) A es **(Ver fórmula)** (b) R1 es H, F, Cl, Br, o I; (c) R2 is H, F, Cl, Br, o I; (d) R3 es H, F, Cl, Br, I o alquilo C1-C6 no sustituido; (e) R4 es H, F, Cl, Br, I, CN, NO2, alquilo C1-C6 sustituido o no sustituido, alquenilo C2-C6 sustituido o no sustituido, alcoxi C1-C6 sustituido o no sustituido, alqueniloxi C2-C6 sustituido o no sustituido, cicloalquilo C3-C10 sustituido o no sustituido, cicloalquenilo C3-C10 sustituido o no sustituido, arilo C6-C20 sustituido o no sustituido, heterociclilo C1-C20 sustituido o no sustituido, OR9, C(=X1)R9, C(=X1)OR9,…

Tratamiento de semillas con inhibidores de acetolactato sintasa (als).

(27/11/2019). Solicitante/s: BASF Agrochemical Products, B.V. Inventor/es: PFENNING,MATTHIAS.

Un método para controlar malas hierbas parásitas de plantas huésped, caracterizado porque comprende: el paso de tratar la semilla de dichas plantas huésped con una composición que comprende un inhibidor de acetolactato sintasa (ALS), o una sal o derivado agrícolamente aceptable del mismo, en donde la composición comprende como el inhibidor de ALS una imidazolinona seleccionada del grupo que consiste en imazamox, en donde el paso de tratar la semilla con un inhibidor de ALS es seguido por el paso de un tratamiento de las plantas huésped emergentes con una composición que comprende un inhibidor de la acetolactato sintasa (ALS), o una sal o derivado agrícolamente aceptable del mismo, en donde el inhibidor de la ALS es imazamox. en donde el derivado agrícolamente aceptable es un derivado del grupo carboxilo seleccionado de un ácido carboxílico, una carboxamida o un éster de ácido carboxílico.

PDF original: ES-2772257_T3.pdf

Composiciones de concentrado de suspensión acuosa nematicida.

(20/11/2019). Solicitante/s: MONSANTO TECHNOLOGY, LLC. Inventor/es: DING, YIWEI, SELNESS, SHAUN RAJ, SLOMCZYNSKA,URSZULA J.

Una composición de concentrado de suspensión acuosa nematicida, comprendiendo la composición: una fase acuosa continua que comprende un componente dispersante que comprende un sulfonato de alquilarilo; una fase en partículas sólidas dispersas que comprende un componente nematicida, comprendiendo el componente nematicida un 3,5-disustituido-1,2,4-oxadiazol o una sal del mismo; y un componente de disolvente orgánico que comprende un disolvente de hidrocarburo parafínico; en la que la mediana del tamaño de las partículas sólidas en la fase en partículas sólidas dispersas es inferior a 10 μm.

PDF original: ES-2773108_T9.pdf

PDF original: ES-2773108_T3.pdf

2-Tioimidazolil-carboxamidas sustituidas como pesticidas.

(21/08/2019) Compuestos de fórmula (I),**Fórmula** en la que Q representa oxígeno o azufre, V representa un radical de la serie hidrógeno, halógeno, alquilo, haloalquilo, alcoxi, haloalcoxi y ciano, W representa un radical de la serie hidrógeno, halógeno, alquilo, haloalquilo, alcoxi, haloalcoxi y ciano, X representa un radical de la serie alquilo, alquenilo, alquinilo opcionalmente sustituido, cicloalquilo opcionalmente sustituido que está saturado o insaturado y opcionalmente interrumpido por heteroátomos, cicloalquilalquilo opcionalmente sustituido que está saturado o insaturado y opcionalmente interrumpido por heteroátomos, arilo opcionalmente sustituido, hetarilo, arilalquilo opcionalmente sustituido, hetarilalquilo y ciano, Y representa un radical de la serie hidrógeno, alquilo,…

Composición fungicida agrícola y hortícola.

(03/07/2019) Una composición fungicida agrícola y hortícola que comprende: el fármaco I seleccionado del grupo que consiste en un compuesto heterocíclico que contiene nitrógeno representado por la siguiente fórmula (A), un compuesto heterocíclico que contiene nitrógeno representado por la siguiente fórmula (B), un compuesto heterocíclico que contiene nitrógeno representado por la siguiente fórmula (C), y sales de los mismos:**Fórmula** y el fármaco II seleccionado de: ciflufenamida, cimoxanilo, proquinazid, metrafenona, quinoxifen, diclomezina, isoprotiolano, bupirimato, hexitiazox, tebufenozida, tiodicarb, spinosad, etofenprox, fipronil, etiprol, pimetrozina, buprofezina,…

Composición fungicida con efecto sinérgico.

(18/06/2019). Solicitante/s: Jiangsu Huifeng Agrochemical Co., Ltd. Inventor/es: ZHONG,HANGEN, JI,HONGJIN.

Una composición fungicida que tiene un efecto sinérgico, que comprende los principios activos A y B, en la que el principio activo A es benzisotiazolinona, el principio activo B es uno seleccionado de bentiavalicarb-isopropilo, zoxamida, protioconazol, boscalid, fenamidona, fluopicolida, famoxadona, piraclostrobina, picoxistrobina o fluazinam, y la relación en peso de los dos principios es de 1:50 a 50:1.

PDF original: ES-2717016_T3.pdf

Emulsiones de aceite parafínico en agua para controlar la infección de plantas de cultivo por patógenos fúngicos.

(22/05/2019). Solicitante/s: Suncor Energy Inc. Inventor/es: LIU, JUN, FEFER,MICHAEL.

Uso de una composición fungicida que comprende una emulsión de aceite parafínico en agua, comprendiendo la emulsión de aceite parafínico en agua un aceite parafínico, un emulsionante, un pigmento y un tensioactivo de silicona, para controlar la infección de una planta de cultivo por un patógeno fúngico, en donde el pigmento es una ftalocianina de cobre y en donde: la relación entre el aceite parafínico y el pigmento es desde 5:1 hasta 100:1; la relación de peso entre el aceite parafínico y el emulsionante es desde 10:1 hasta 500:1; y la relación de peso entre el pigmento y el tensioactivo de silicona es desde 2:1 hasta 50:1.

PDF original: ES-2735285_T3.pdf

Un concentrado en suspensión agroquímica que comprende un alcohol alcoxilado disuelto en la fase acuosa.

(14/05/2019). Solicitante/s: BASF SE. Inventor/es: KOLB, KLAUS, BERGHAUS, RAINER, SIMON,ANJA, MARXER,KATJA.

Un concentrado en suspensión acuosa agroquímica que comprende un pesticida en forma de partículas de pesticida y al menos el 5% en peso de un adyuvante disuelto en la fase acuosa, donde el adyuvante es de la fórmula (I) R1-O-EOm-POn-EOo-H (I) donde R1 es un alquilo C12-20; EO es etilenoxi; PO es propilenoxi; m tiene un valor de 1 a 20; n tiene un valor de 1 a 30; y o tiene un valor de 1 a 10.

PDF original: ES-2712638_T3.pdf

Derivados de arilsulfuro y arilsulfóxido acaricidas e insecticidas.

(09/05/2019) Compuesto de la fórmula (I)**Fórmula** en la que A y B junto con los átomos a los que están unidos, representan una subestructura que está seleccionada del grupo compuesto por**Fórmula** en las que en el caso de que esté presente una subestructura de acuerdo con la fórmula (I-A), (I-B) o (I-D), V1, V2 y V3, en cada caso independientemente entre sí, representan oxígeno; azufre, un nitrógeno dado el caso sustituido o sales de un nitrógeno dado el caso sustituido; y en el caso de que esté presente una subestructura de acuerdo con la fórmula (I-C), V1 y V2, en cada caso independientemente entre sí, representan oxígeno o azufre; en el caso de que esté presente una subestructura de acuerdo con la fórmula (I-A), (I-B) o (I-D), Q1 y Q2, en cada caso…

Soluciones de bromo estabilizadas y activadas como biocida y como agente antiincrustante.

(24/04/2019). Solicitante/s: BROMINE COMPOUNDS LTD.. Inventor/es: FELDMAN, DAVID, ANTEBI,SHLOMO, ZOLKOV,CHEN.

Un proceso de retirada o prevención de la bioincrustación en un volumen de un líquido acuoso o en una superficie en contacto con un líquido acuoso, que comprende i) proporcionar una composición acuosa (solución madre antiincrustante) que contiene urea y una fuente de bromo activo, que comprende un elemento seleccionado del grupo que consiste en BrCl, alquilhidantoína halogenada seleccionada de BC-DMH (bromocloro dimetilhidantoína), DB-DMH (dibromo dimetilhidantoína), BC-MEH (bromocloro metiletilhidantoína), DB-MEH (dibromo metiletilhidantoína), y una mezcla de un bromuro o HBr con un oxidante, en la que la relación molar de urea/bromo es de al menos 1/1 y el pH de dicha composición acuosa es ácido; ii) opcionalmente, diluir dicha solución madre con agua, obteniendo así una solución de trabajo; y iii) poner en contacto dicho volumen o dicha superficie con dicha solución madre o dicha solución de trabajo.

PDF original: ES-2722199_T3.pdf

Composición herbicida que comprende cinmetilina e imazamox.

(17/04/2019). Solicitante/s: BASF Agro B.V. Inventor/es: ZAGAR, CYRILL, SIEVERNICH, BERND, EVANS, RICHARD, R., KRAUS, HELMUT, DR., ETCHEVERRY,MARIANO, NIELSON,RYAN LOUIS, LIEBL,REX A.

Una composición herbicida que comprende una cantidad eficaz sinérgicamente herbicida de (a) (±) -2-exo- (2-metilbenciloxi) - 1-metil-4-isopropil-7-oxabiciclo[2.2.1]heptano, cualquiera de sus enantiómeros individuales o cualquier mezcla no racémica de los mismos (herbicida A) y (b) imazamox, cualquiera de sus isómeros individuales o una sal, éster o amida agrícolamente aceptable de los mismos (herbicida B).

PDF original: ES-2737410_T3.pdf

Composición para el control de enfermedades de las plantas y su uso.

(17/04/2019) Una composicion para controlar enfermedades de plantas que comprende un compuesto de tetrazolinona representado por una formula :**Fórmula** en la que n es un numero entero de uno cualquiera de 0 a 5; R1 representa un atomo de halogeno, un grupo alquilo C1-C6, un grupo alcoxi C1-C6, un grupo alquiltio C1- C6, un grupo nitro o un grupo ciano; R2 representa un grupo alquilo C1-C3, un grupo cicloalquilo C3-C4, un atomo de halogeno, un grupo alcoxi C1-C3, un grupo alquiltio C1-C2, un grupo alquenilo C2-C3 o un grupo alquinilo C2-C3, los R1 o R2 pueden tener independientemente atomo o atomos de halogeno…

Composición para mejorar el sabor e inhibir el crecimiento de bacterias patógenas en aves de corral.

(03/04/2019). Solicitante/s: Gum Products International Inc. Inventor/es: SANDRA,SANDRA, LIU,HENRY.

Una composición para tratar, reducir el recuento de patógenos y bacterias y mejorar la vida útil y la seguridad de las aves sin procesar que comprende vinagre tamponado (VT) y éster etílico de lauramida arginina (ELA), en donde la proporción de VT a ELA está entre el 10 % y el 90 % en peso de VT y el 0,2 % y el 10 % en peso de ELA, con el resto que es agua.

PDF original: ES-2707339_T3.pdf

Agentes herbicidas para cultivos de remolacha azucarera tolerantes o resistentes.

(20/03/2019) Utilización de combinaciones de herbicidas para la represión de plantas dañinas en cultivos de remolacha azucarera, caracterizada porque la respectiva combinación de herbicidas tiene un contenido activo de (A) un herbicida ampliamente activo, seleccionado entre el conjunto de los compuestos que consta de (A1) compuestos de las fórmulas (A1), en los que Z significa un radical de la fórmula - OH o un radical de péptido de la fórmula - NHCH(CH3)CONHCH(CH3)COOH ó -NHCH(CH3)CONHCH[CH2CH(CH3)2]COOH, y sus esteres y sales, otros derivados de fosfinotricina, (A2) compuestos de la fórmula (A2) y sus ésteres y sales, y (A3) imidazolinonas y sus sales, y (B) uno o más herbicidas seleccionados…

Derivados heterocíclicos con sustituyentes que contienen azufre activos como plaguicidas.

(27/02/2019) Un compuesto de fórmula I, **Fórmula** donde G1 es nitrógeno o CR2; G2 es nitrógeno o CR3; G3 es nitrógeno o CR4; G4 es nitrógeno o CR5; G5 es nitrógeno o CR6, siempre que no aparezcan más de 2 G que sean nitrógeno de manera consecutiva; R2, R3, R4, R5 o R6 son, independientemente el uno del otro, hidrógeno, halógeno o haloalquilo C1-C4, haloalquilo C1-C4 sustituido con uno o dos hidroxi, haloalquilo C1-C4 sustituido con uno o dos metoxi, haloalquilo C1- C4 sustituido con uno o dos ciano; o R2, R3, R4, R5 o R6 son, independientemente el uno del otro, (haloalquil C1-C4)tio, (haloalquil C1-C4)sulfinilo,…

Derivados heterocíclicos activos como plaguicida con sustituyentes que contienen azufre.

(26/02/2019) Un compuesto de fórmula I, **(Ver fórmula)** donde A representa CH o N; Q es cicloalquilo C3-C6, o cicloalquilo C3-C6 mono- o polisustituido con sustituyentes seleccionados del grupo que consiste en halógeno, ciano, alquilo C1-C4, haloalquilo C1-C4, cicloalquilo C3-C6 y fenilo, o es fenilo que puede estar mono- o polisustituido con sustituyentes seleccionados del grupo que consiste en halógeno, ciano, alquilo C1-C4, haloalquilo C1-C4, haloalcoxi C1-C4, alcoxi C1-C4, haloalquil C1-C4- sulfanilo, haloalquil C1-C4-sulfinilo, haloalquil C1-C4-sulfonilo y -C(O)haloalquilo C1-C4; o Q es alquenilo C2-C6, o alquenilo C2-C6 mono- o polisustituido con sustituyentes seleccionados del…

Compuestos herbicidas.

(08/02/2019) Un compuesto herbicida de fórmula (I)**Fórmula** donde X se selecciona de O y S; Ra se selecciona de hidrógeno y halógeno; Rb se selecciona de hidrógeno, halógeno, alquilo C1-C6, alquenilo C2-C6, alcoxi C1-C6, alqueniloxi C2-C4, alquiniloxi C2-C4, alcoxi C1-C4-alquilo C1-C4, alcoxi C1-C4-alcoxi C1-C4, alcoxi C1-C4-alcoxi C1-C4-alquilo C1-C4, haloalcoxi C1-C4, alquiltio C1-C4, alquilsulfinilo C1-C4, alquilsulfonilo C1-C4, un grupo R5R6N-, un grupo R5C(O)N(R6)-, un grupo R5S(O2)N(R6)-, un grupo R5R6NSO2-, un grupo R5R6NC(O)-, arilo opcionalmente sustituido con de 1 a 3 grupos seleccionados independientemente de halógeno, nitro, ciano, R5C(O)N(R6)-, R5R6NC(O)-, R5R6NSO2-, R5S(O2)N(R6)-, R5S(O)-, R515 S(O2)-, alquilo C1-C3,…

Un método para modular la velocidad de liberación de ingredientes activos microencapsulados.

(05/12/2018) Un método para modular la velocidad de liberación de ingredientes activos (i.a.) microencapsulados que comprende las siguientes etapas: I) preparación de una suspensión acuosa A) que comprende microcápsulas de al menos un ingrediente activo, II) preparación de un líquido emulsionable en agua, el componente B), que comprende un disolvente del ingrediente activo microencapsulado para al menos el 50 % en p/p, el disolvente que se selecciona entre los que tienen las siguientes características: - capacidad para solubilizar el ingrediente activo a temperatura ambiente (25 °C) para al menos el 5 % en p/p, preferiblemente el 10 % en p/p, más preferiblemente al menos el 20 % en p/p, - inercia con respecto a las cubiertas de la cápsula, por ejemplo, no causan ruptura o hinchazón de la cápsula. - inmiscibilidad con agua y al…

Composición fungicida.

(05/10/2018) Composición fungicida que comprende ciazofamida y una base orgánica seleccionada entre morfolina; piperidina; pirrolidina; una mono, di o trialquilamina inferior seleccionada entre etil-, dietil-, trietil- o dimetil-propilamina; hexametilentetramina; una amina orgánica seleccionada entre alquilaminas, alquilenaminas y alcanolaminas seleccionadas entre metilamina, etilamina, n-propilamina, isopropilamina, n-butilamina, isobutilamina, sec-butilamina, n-amilamina, isoamilamina, hexilamina, heptilamina, octilamina, nonilamina, decilamina, undecilamina, dodecilamina, tridecilamina, tetradecilamina, pentadecilamina, hexadecilamina, heptadecilamina,…

Plaguicidas.

(02/05/2018). Solicitante/s: UNIVERSITY OF DURHAM. Inventor/es: GATEHOUSE,JOHN A, FITCHES,ELAINE C.

Una proteína de fusión que comprende: (i) una toxina proteica ω-ACTX-Hv1a que comprende la secuencia de aminoácidos SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (SEQ ID NO: 1), o una variante de la misma que retiene sustancialmente la actividad biológica de la toxina proteica ω-ACTX-Hv1a, teniendo dicha variante una secuencia de aminoácidos que tiene al menos un 75 % de identidad con la SEQ ID NO: 1; unida operativamente a (ii) una proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado, en donde la proteína capaz de mediar la translocación de la proteína de fusión desde el intestino del invertebrado es una lectina vegetal seleccionada entre una cualquiera o más de las siguientes: lectina de galanto (GNA), lectina de ajo Allium sativum, lectina de guisante Pisum sativum (P-lec), lectina de cacahuete Arachis hypogaea, lectina de judía verde (PHA, Phytohaemagglutinin).

PDF original: ES-2674324_T3.pdf

Composiciones que comprenden un agente de control biológico y un insecticida.

(11/04/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: ANDERSCH, WOLFRAM, DR., HELLWEGE, ELKE, STENZEL, KLAUS, SPRINGER,BERND.

Una composición que comprende al menos un agente de control bioIógico seleccionado del grupo que consiste en Bacillus pumilus (n.º de acceso NRRL B-30087), Bacillus subti/is AQ713 (n.º de acceso NRRL B-21661) y Bacillus subtilis AQ30002 (n.º de acceso NRRL B-50421), y al menos un insecticida seleccionado del grupo que consiste en agonistas receptores nicotínicos de acetilcolina (nCAhR) seleccionado del grupo que consiste en Clotianidina, lmidacloprida, Tiacloprida, Tiametoxam y Sulfoxaflor, y los activadores alostéricos del receptor nicotínico de acetilcolina (nAChR) esta seleccionado del grupo que consiste en Espinetoram y Espinosad en una relación en peso sinérgica de agente de control biológico e insecticida de 1:10 a 5000:1 donde el agente de control biológico es Bacillus pumilus; 1:10 a 10000:1 donde el agente de control biológico es Bacillus subtilis QST713; 1:10 a 1000:1 donde el agente de control biológico es Bacillus subtilis AQ30002.

PDF original: ES-2672500_T3.pdf

Composición herbicida y método para usar la misma.

(21/03/2018). Solicitante/s: Rotam Agrochem International Co., Ltd. Inventor/es: BRISTOW,James Timothy.

Composición herbicida que comprende una cantidad eficaz desde el punto de vista herbicida de mesotriona y un segundo agente herbicida, en donde el segundo agente herbicida es la combinación de nicosulfuron y dicamba o sales de los mismos.

PDF original: ES-2674348_T3.pdf

Procesos para la síntesis de compuestos de diariltiohidantoína y diarilhidantoína.

(21/03/2018). Solicitante/s: Medivation Prostate Therapeutics LLC. Inventor/es: THOMPSON, ANDREW, ANGELAUD,Remy, JAIN,RAJENDRA PARASMAL, LAMBERSON,CAROL, GREENFIELD,SCOTT.

Proceso para preparar un compuesto de fórmula (I): **Fórmula** comprendiendo dicho proceso hacer reaccionar el compuesto de fórmula D: **Fórmula** en la que R6 es alquilo C1-C8; con el compuesto de fórmula (F): **Fórmula**.

PDF original: ES-2671343_T3.pdf

Composiciones herbicidas que comprenden ácido 4-amino-3-cloro-5-fluoro-6-(4-cloro-2-fluoro-3-metoxifenil-)piridino-2-carboxilico.

(14/03/2018). Solicitante/s: DOW AGROSCIENCES LLC. Inventor/es: MANN, RICHARD, K., YERKES,CARLA, SCHMITZER,PAUL R, SATCHIVI,NORBERT M.

Una composición herbicida sinérgica que comprende una cantidad eficaz como herbicida de (a) un compuesto de fórmula (I): **Fórmula** o un éster alquílico C1-4 o bencílico de fórmula (I) o una sal de sodio, potasio, magnesio o amonio de fórmula (I) y (b) una imidazolinona, en donde (b) es al menos un compuesto, o una sal, ácido carboxílico, sal carboxilato o éster del mismo, aceptables desde el punto de vista agrícola seleccionados del grupo que consiste en imizetapir, imazetapir amonio, imazamox, imazamox amonio, imazapic, imazapic amonio, imazapir, imazapir sal de isopropilamina, imazametabenz, imazametabenz-metilo, imazaquin, e imazaquín sal de isopropilamina.

PDF original: ES-2667576_T3.pdf

Combinaciones de compuestos activos.

(07/03/2018). Solicitante/s: Bayer Intellectual Property GmbH. Inventor/es: LATORSE, MARIE-PASCALE, TAFFOREAU,SYLVAIN, LEDESMA PEREZ,LUIS JULIAN.

Combinaciones de compuestos activos que consisten en (A) Fluopicolida de fórmula (I) **(Ver fórmula)** o una sal agroquímicamente aceptable de la misma, y (B) Ciazofamida, En una relación en peso de A:B de 20:1 a 1:20.

PDF original: ES-2663632_T3.pdf

Composición que comprende una mezcla de terpenos pesticidas y un fungicida.

(31/01/2018). Solicitante/s: BAYER CROPSCIENCE AG. Inventor/es: WACHENDORFF-NEUMANN, ULRIKE, DAHMEN, PETER, HELLWEGE, ELKE.

Una composición que comprende a) una mezcla de terpenos pesticida que comprende, como compuestos químicos de acción pesticida α- terpineno, p-cimeno y limoneno, en la que la relación relativa en peso del α-terpineno a p-cimeno a limoneno es 30 a 70 de α-terpineno, 10 a 30 de p-cimeno y 1 a 20 de limoneno y b) al menos un fungicida (I) en una cantidad sinérgicamente efectiva, en la que el fungicida (I) está seleccionado del grupo que consiste en azoxistrobina, clorotalonilo, difenoconazol, fenhexamida, fenamidona, fludioxonilo, fluopiram, flutolanilo, fluxapiroxad, fosetil-Al, isotianilo, mancozeb, mefenoxam, metalaxilo, penflufeno, propamocarb-HCl, protioconazol, piraclostrobina, espiroxamina, tebuconazol, trifoxistrobina y en la que la relación de la mezcla de terpenos pesticida y el al menos un fungicida (I) está en el intervalo de 1:500 a 500:1.

PDF original: ES-2665770_T3.pdf

1 · · 3 · 4 · 5 · 6 · 7 · 8 · 9 · 10 · 11 · ››
Utilizamos cookies para mejorar nuestros servicios y mostrarle publicidad relevante. Si continua navegando, consideramos que acepta su uso. Puede obtener más información aquí. .