Inventos patentados en España.

Inventos patentados en España.

Inventos patentados en España en los últimos 80 años. Clasificación Internacional de Patentes CIP 2013.

Subunidad catalítica de la telomerasa humana.

Patente Europea. Resumen:

LA INVENCION PROPORCIONA COMPOSICIONES Y METODOS RELACIONADOS CON UNA TRANSCRIPTASA REVERSA DE TELOMERASA HUMANA

(HTRT), LA SUBUNIDAD PROTEICA CATALITICA DE LA TELOMERASA HUMANA. LOS POLINUCLEOTIDOS Y POLIPEPTIDOS DE LA INVENCION SON UTILES PARA EL DIAGNOSTICO, PROGNOSIS Y TRATAMIENTO DE ENFERMEDADES HUMANAS, PARA CAMBIAR LA CAPACIDAD PROLIFERATIVA DE CELULAS Y ORGANISMOS, Y PARA LA IDENTIFICACION Y ESCRUTINIO DE COMPUESTOS Y TRATAMIENTOS UTILES PARA EL TRATAMIENTO DE ENFERMEDADES TALES COMO EL CANCER.

Solicitante: GERON CORPORATION.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 230 CONSTITUTION DRIVE MENLO PARK, CA 94025 ESTADOS UNIDOS DE AMERICA.

Inventor/es: ANDREWS, WILLIAM H., CECH, THOMAS R., LINGNER, JOACHIM, NAKAMURA, TORU, CHAPMAN, KAREN B., MORIN, CREGG B., Harley,Calvin B.

Fecha de Publicación de la Concesión: 11 de Abril de 2012.

Clasificación Internacional de Patentes: A61K39/00 (Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G 01 N 33/53) [2] Notas (1) Los grupos 39/002 a 39/295 cubren las preparaciones que contienen protozoos, bacterias, virus, o sus partes elementales, p. ej. partes de membranas. [3] (2) La preparación de composiciones que contienen antígenos o anticuerpos se clasifican igualmente en la subclase C 12 N si la etapa del cultivo del microorganismo tiene interés. [3]), A61P35/00 (Agentes antineoplásicos [7]), A61K48/00 (Preparaciones medicinales que contienen material genético que se introduce en las células del cuerpo vivo para tratar enfermedades genéticas; Terapia génica [5]), C12N15/12 (...Genes que codifican proteínas animales [5]), C12N15/85 (....para células animales [5]), C12N5/10 (.Células modificadas por introducción de material genético extraño, p. ej. células transformadas por virus [5]), C12N15/09 (.Tecnología del ADN recombinante [5]), A61K39/395 (.Anticuerpos (aglutininas 38/36); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario [3]), A61K31/70 (.Hidratos de carbono;Azúcares;Sus derivados (sorbitol 31/047) [2,7]), C12Q1/68 (.en los que intervienen ácidos nucleicos [3]), G01N33/53 (...Ensayos inmunológicos; Ensayos en los que interviene la formación de uniones bioespecíficas; Materiales a este efecto (preparaciones medicinales que contienen antígenos o anticuerpos A 61 K; haptenos en general, ver los lugares apropiados en la clase C 07; proteínas en general C 07 K) [4]), A61P43/00 (Medicamentos para utilizaciones específicas,no previstas en los grupos 1/00 a 41/00 [7]), G01N33/50 (..Análisis químico de material biológico, p. ej. de sangre, de orina; Investigación o análisis por métodos en los que interviene la formación de uniones bioespecíficas con grupos coordinadores; Investigación o análisis inmunológico (procedimientos de medida, de investigación o análisis diferentes de los procedimientos inmunológicos en los que intervienen enzimas o microorganismos, composiciones o papeles reactivos a este efecto, procedimientos para preparar estas composiciones, procedimientos de control sensibles a las condiciones del medio en los procedimientos microbiológicos o enzimáticos C 12 Q) [3] Notas (1) En el presente grupo, la expresión siguiente tiene el significado abajo indicado: --"que interviene", utilizada para un material, comprende la investigación o análisis de este material así como el empleo de este material como agente determinante o reactivo en la investigación o análisis de otro material. [3] (2) En los grupos 33/52 a 33/96, salvo indicación en contra, una invención se clasifica en el último lugar apropiado. [3]), G01N33/573 (....para enzimas o isoenzimas [4]), C12P21/08 (.Anticuerpos monoclonales [5]), A61K38/55 (..Inhibidores de proteasas [6]), C07K14/47 (...de mamíferos [6]), C07K5/10 (..Tretapéptidos [4]), G01N33/566 (....utilizando un soporte específico o proteínas receptoras como reactivos para la formación de uniones por ligando [4]), C12Q1/02 (.en los que intervienen microorganismos vivos [3]), C07K7/06 (..con 5 a 11 aminoácidos [4]), A01K67/027 (.Nuevas razas de vertebrados [5]), C12N9/12 (..transfieren grupos que contienen fósforo, p. ej. Quinasas (2.7) [3]), C12Q1/48 (.en los que interviene una transferasa [3]), G01N33/48 (.Material biológico, p. ej. sangre, orina (33/02 a 33/14, 33/26, 33/44, 33/46 tienen prioridad; determinación de las capacidades germinativas de los granos A 01 C 1/02); Hemocitómetros (cómputo de glóbulos repartidos sobre una superficie por barrido óptico de la superficie G 06 M 11/02) [3,4]), C12N15/54 (....Transferasas (2) [5]), C12N1/19 (...modificados por la introducción de material genético extraño [5]), C07K7/08 (..con 12 a 20 aminoácidos (gastrinas 14/595; somatostatinas 14/655; melanotropinas 14/68) [4,6]), A61K38/00 (Preparaciones medicinales que contienen péptidos (péptidos que contienen ciclos beta-lactama 31/00; dipéptidos cíclicos que no tienen en su molécula ningún otro enlace peptídico más que los que forman su ciclo, p. ej. piperazina 2,5-dionas, 31/00; alcaloides del cornezuelo de centeno del tipo péptido cíclico 31/48; que contienen compuestos macromoleculares que tienen unidades aminoácido repartidas estadísticamente 31/74; preparaciones medicinales que contienen antígenos o anticuerpos 39/00; preparaciones medicinales caracterizadas por los ingredientes no activos, p. ej. péptidos como soportes de drogas, 47/00) [6] Notas (1) Los términos o expresiones utilizados en el presente grupo siguen exactamente las definiciones dadas en la nota (1) que sigue al título de la subclase C 07 K. [6] (2) Las preparaciones que contienen fragmentos de péptidos o péptidos modificados por eliminación o adición de aminoácidos, por sustitución de aminoácidos por otros o por combinación de estas modificaciones están clasificadas con las preparaciones que contienen péptidos padres. Sin embargo, las preparaciones que contienen fragmentos de péptidos que tienen cuatro o menos de cuatro aminoácidos están igualmente clasificadas en los grupos 38/05 a 38/07. [6] (3) Las preparaciones que contienen péptidos preparados por tecnología de ADN recombinante no están clasificadas según el huésped sino según el péptido original expresado, p. ej. las preparaciones que contienen un péptido HIV expresado en E. coli están clasificadas con las preparaciones que contienen péptidos HIV. [6]), A61K35/12 (.Sustancias que provienen de mamíferos o de pájaros [2]), C12N1/21 (..modificados por la introducción de material genético extraño [5]), C07K16/40 (.contra enzimas [6]), A61K31/7088 (..Compuestos que tienen al menos tres nucleósidos o nucleótidos [7]), G01N33/15 (.preparaciones medicinales [3]), C12R1/19 (...Escherichia coli [3]), C12N1/15 (..modificados por la introducción de material genético extraño [5]), C12R1/84 (..Pichia [3]), A61K38/45 (...Transferasas (2) [6]), C07K5/107 (...la cadena lateral del primer aminoácido contiene carbociclos, p. ej. Phe, Tyr [6]), C07K5/117 (...el primer aminoácido es heterocíclico, p. ej. Pro, His, Trp [6]), C12R1/91 (.Líneas celulares [7]), C12N15/113.

Volver al resumen de la patente.

Descripción:

Subunidad catalítica de la telomerasa humana.

Campo de la invención

La presente invención se refiere a nuevos ácidos nucleicos que codifica la subunidad catalítica de telomerasa y polipéptidos relacionados. En particular, la presente invención está dirigida a la subunidad catalítica de telomerasa humana. La invención proporciona métodos y composiciones referentes a medicina, biología molecular, química, farmacología y diagnóstico médico y tecnología de prognosis.

Antecedentes de la invención

El objetivo de la siguiente exposición consiste en presentar el campo de la presente invención.

Durante mucho tiempo se ha reconocido que la réplica completa de los extremos terminales de cromosomas eucarióticos requiere componentes celulares especializados (Watson, 1972, Nature New Biol., 239:197; Olovnikov, 1973, J. Theor. Biol., 41:181) . La réplica de un filamento lineal de DNA por polimerasas de DNA convencionales requiere un ARN iniciador y puede proceder sólo 5' a 3'. Cuando el ARN enlazado en los extremos terminales de 5' de los filamentos de DNA cromosómicos eucarióticos es eliminado, se introduce un hueco, conduciendo a una reducción progresiva de filamentos hijos con cada ciclo de réplica. Se cree que esta reducción de telómeros, las estructuras de DNA de proteína físicamente situadas en los extremos de cromosomas, da razón del fenómeno de senectud o envejecimiento celular (vea, por ejemplo, Goldstein, 1990, Science 249:1129; Martin y otros, 1979, Lab. Invest. 23:86; Goldstein y otros, 1969, Proc. Natl. Acad. Sci. USA 64:155; y Schneider y Mitsui, 1976, Proc. Natl. Acad. Sci. USA, 73:3584) de células somáticas humanas normales in vitro y in vivo.

Por lo tanto, la longitud e integridad de los telómeros se relaciona con la entrada de una célula a una etapa de senectud (es decir, pérdida de la capacidad de proliferación) . Además, la habilidad de una célula de mantener (o aumentar) la longitud de los telómeros puede permitir que una célula evite la senectud, es decir, se vuelva inmortal.

En muchos sistemas se ha investigado la estructura de los telómeros y DNA telomérico (vea, por ejemplo, Harley y Villeponteau, 1995, Curr. Opin. Genet. Dev. 5:249) . En la mayor parte de los organismos, el DNA telomérico consta de un arreglo tandémico de secuencias muy simples; en humanos y otros vertebrados, el DNA telomérico consta de cientos a miles de repeticiones en tándem de la secuencia TTAGGG. Los métodos para determinar y modular la longitud de los telómeros en las células se describen en las Publicaciones PCT WO 93/23572 y WO 96/41016.

El mantenimiento de los telómeros es una función de una polimerasa de DNA específica de los telómeros conocida como telomerasa. La telomerasa es una ribonucleoproteína (RNP) que usa una parte de su mitad de ARN como un molde para síntesis de DNA repetitivo de telómeros (Morin, 1997, Eur. J. Cancer 33:750; Yu y otros, 1990, Nature 344:126; Singer y Gottschling, 1994, Science 266:404; Autexier y Greider, 1994, Genes Develop., 8:563; Gilley y otros, 1995, Genes Develop., 9:2214; McEachern y Blackburn, 1995, Nature 367:403; Blackburn, 1992, Ann Rev. Biochem., 61:113; Greider, 1996, Ann. Rev. Biochem., 65:337) . Los componentes de ARN de humano y otras telomerasas han sido clonados y caracterizados (vea, Publicación PCT WO 96/01835 y Feng y otros, 1995, Science 269:1236) . Sin embargo, la caracterización de los componentes de la proteína de telomerasa ha sido difícil. En parte, esto es porque se ha comprobado que es difícil purificar la RNP de telomerasa, la cual está presente en niveles extremadamente bajos en las células en las cuales se expresa. Por ejemplo, se ha estimado que las células humanas conocidas para expresar niveles altos de actividad de telomerasa pueden tener sólo alrededor de cien moléculas de la enzima por célula.

Consistente con la relación de telómeros y telomerasa con la capacidad de proliferación de una célula (es decir, la habilidad de la célula de dividirse indefinidamente) , la actividad de telomerasa se detecta en líneas celulares inmortales y un conjunto extraordinariamente diverso de tejidos de tumor, pero no se detecta (es decir, estuvo ausente o abajo del umbral del ensayo) en cultivos de células somáticas normales o tejidos normales adyacentes a un tumor (vea, Patente de los Estados Unidos Números 5, 629, 154; 5, 489, 508; 5, 648, 215; y 5, 639, 613; vea también, Morin, 1989, Cell 59:521; Shay y Bacchetti 1997, Eur. J. Cancer 33:787; Kim y otros, 1994, Science 266:2011; Counter y otros, 1992, EMBO J. 11:1921; Counter y otros, 1994, Proc. Natl. Acad. Sci. U.S.A. 91, 2900; Counter y otros, 1994, J. Virol. 68:3410) . Además, se ha reportado una correlación entre el nivel de actividad de telomerasa en un tumor y el posible resultado clínico del paciente (por ejemplo, Patente de los Estados Unidos Número 5, 639, 613, arriba; Langford y otros, 1997, Hum. Pathol. 28:416) . También se ha detectado actividad de telomerasa en células de gérmenes humanos, células impulsoras y progenitoras de proliferación y linfocitos activados. En células somáticas impulsoras y progenitoras y en linfocitos activados, la actividad de telomerasa en general es muy baja o sólo se expresa temporalmente (vea, Chiu y otros, 1996, Stem Cells 14:239; Bodnar y otros, 1996, Exp. Cell Res. 228:58; Taylor y otros, 1996, J. Invest. Dermatology 106:759) .

La telomerasa humana es un objetivo ideal para diagnosticar y tratar enfermedades humanas referentes a la proliferación y senectud, como el cáncer. Los métodos para diagnosticar y tratar cáncer y otras enfermedades relacionadas con la telomerasa en humanos se describen en la Patente de los Estados Unidos Números 5, 489, 508, 5, 639, 613 y 5, 645, 986. Los métodos para pronosticar el avance de tumores supervisando la telomerasa se describen en la Patente de los Estados Unidos Número 5, 639, 613. El descubrimiento y caracterización de la subunidad de proteína catalítica de telomerasa humana proporcionarían ensayos útiles adicionales para la telomerasa y para diagnóstico y terapia de enfermedades. Además, la clonación y determinación de la secuencia primaria de la subunidad de proteína catalítica permitirían terapias más eficaces para cánceres humanos y otras enfermedades relacionadas con la capacidad de proliferación y senectud de células.

Breve sumario de la invención

La presente invención proporciona un polinucleótido que comprende una secuencia que codifica un polipéptido capaz de presentar una actividad telomerasa catalítica cuando está asociado con un ARN de telomerasa y que es:

(a) un polinucleótido que tiene la secuencia del injerto del plásmido ATCC 209016; o

(b) un polinucleótido que se hibrida a (a) bajo condiciones rigurosas; o

(c) un polinucleótido que se hibrida a NUMERO DE IDENTIFICACIÓN DE SECUENCIA 3 ó NUMERO DE IDENTIFICACIÓN DE SECUENCIA 8 bajo condiciones rigurosas; o

(d) una secuencia de polinucleótido que se degenera como consecuencia del código genético a las secuencias definidas en (a) o (b) .

En otro aspecto la invención proporciona una composición que comprende por lo menos 20% de proteína catalítica de telomerasa humana que tiene una secuencia codificada por un polinucleótido según la invención, presentando dicha composición una actividad de telomerasa catalítica solamente si un ARN de telomerasa está añadido a la composición a fin de asociarse con dicha proteína. Dichas proteínas capaces de presentar una actividad de telomerasa catalítica pueden, por ejemplo, estar caracterizadas porque tienen un motivo definido que presenta la secuencia de aminoácidos:

Trp-R1-X7-R1-R1-R2-X-Phe-Phe-Tyr-X-Thr-Glu-X8-9-R3-R3-Arg-R4-X2-Trp

donde X es cualquier aminoácido y un subíndice se refiere al número de residuos consecutivos, R1 es leucina o isoleucina, R2 es glutamina o arginina, R3 es fenilalanina o tirosina y R4 es lisina o histidina.

Asimismo, el ácido nucleico aislado, substancialmente puro o recombinante según la invención puede codificar una proteína comprendiendo una secuencia de aminoácidos:

Trp-R1-X7-R1-R1-R2-X-Phe-Phe-Tyr-X-Thr-Glu-X8-9-R3-R3-Arg-R4-X2-Trp

La invención abarca oligonucleótidos y polinucleótidos compartiendo identidad o complementariedad de secuencia substancial con una subsecuencia de dichos ácidos nucleicos.

Proteínas de transcriptasa inversa de telomerasa humana (hTRT) que pueden incluirse en las composiciones según la invención incluyen proteína de hTRT, o una variante de la misma, o un fragmento de la misma, la proteína se caracteriza, por ejemplo, porque tiene una secuencia de aminoácido con por lo menos alrededor del 75% o por lo menos alrededor del 80% de identidad de secuencia a la proteína de hTRT de la Figura 17 (NÚMERO DEIDENTIFICACIÓN DE SECUENCIA: 2) , o una variante de la misma, o un fragmento de la misma. En un aspecto relacionado, la proteína de hTRT tiene la secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2. La proteína puede tener más de una actividad de telomerasa, que incluye la actividad catalítica. En una realización, el fragmento de proteína de hTRT tiene por lo menos 6 residuos de aminoácido.

La invención también incluye la utilización de una composición de telomerasa humana catalítica que contiene proteína según la invención para la fabricación de un complejo por la complexación de un componente de molde de ARN con la proteína telomerasa humana catalítica de la misma. El ARN puede ser un ARN de telomerasa, tal como un ARN de telomerasa humana. En una realización, la proteína de hTRT y el ARN de telomerasa humana (hTR) forman un complejo de ribonucleoproteína con una actividad de telomerasa.

En una realización, la invención proporciona telomerasa humana aislada comprendiendo proteína de hTRT, tal como telomerasa humana substancialmente pura comprendiendo proteína de hTRT y comprendiendo hTR. En una realización, la telomerasa es por lo menos alrededor del 95% pura. La telomerasa puede aislarse de una célula, como una célula huésped recombinante o una célula que expresa actividad de telomerasa.

Los polinucleótidos según la invención que una secuencia de nucleótidos codificando una proteína de hTRT puedecodificar una secuencia de aminoácidos tal como se establece en la Figura 17 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) o una secuencia que comprende una o más substituciones de aminoácidos (o codón)

conservadores o una o más substituciones de aminoácidos (o codón) alterando la actividad en la secuencia de aminoácidos mencionada. El polinucleótido puede hibridarse bajo estrictas condiciones a un polinucleótido teniendo la secuencia como se establece en la Figura 16 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1) . La secuencia de nucleótidos del polinucleótido puede tener una probabilidad de suma más pequeña de menos de 0.5 cuando secompara con una secuencia de nucleótidos como se establece en la Figura 16 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1) usando el algoritmo BLAST con parámetros implícitos.

En otro aspecto, la invención proporciona el polinucleótido descrito anteriormente teniendo una secuencia de promotor vinculada de una manera manejable a la secuencia codificando la proteína de hTRT. El promotor puede ser un promotor distinto al promotor de hTRT que ocurre naturalmente. En un aspecto relacionado, la invención proporciona un vector comprendiendo un polinucleótido según la invención, y una célula que contiene dicho vector.

La invención además proporciona un método para preparar telomerasa recombinante poniendo en contacto una proteína recombinante de hTRT producida por la expresión de un polinucleótido según la invención con un componente de ARN de telomerasa bajo condiciones tales que la proteína recombinante y el componente de ARN de telomerasa se asocian para formar una enzima de telomerasa capaz de catalizar la adición de nucleótidos a un substrato de telomerasa. En una realización, la proteína de hTRT tiene una secuencia como se establece en laFigura 17 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) . La proteína de hTRT puede producirse en un sistema de expresión in vitro y mezclarse con un ARN de telomerasa o, en otra realización, el ARN de telomerasa puede coexpresarse en el sistema de expresión in vitro. En una realización, el ARN de telomerasa es hTR. En una realización alternativa, el contacto ocurre en una célula, como una célula humana. En una realización, la célula no tiene actividad de telomerasa antes del contacto de la hTRT y el RNA, o la introducción, como por transfección, de un polinucleótido de hTRT. En una realización, el ARN de telomerasa es expresado naturalmente por dicha célula.

La invención también proporciona una célula, como una célula humana, de ratón, o de levadura, conteniendo los polinucleótidos recombinantes de la invención como un polinucleótido con una proteína de hTRT codificando la secuencia vinculada de una manera manejable a un promotor. En aspectos particulares, la célula es una célula de vertebrado, como una célula de un mamífero, por ejemplo un humano, y tiene una capacidad de proliferación aumentada relativa a una célula que de otra manera es idéntica pero no comprende el polinucleótido recombinante o tiene un nivel aumentado de actividad de telomerasa relativo a una célula que de otra manera es idéntica pero no comprende el polinucleótido recombinante. En algunas realizaciones, la célula es inmortal.

La invención comprende la utilización de un polinucleótido según la invención, un polipéptido obtenido por la expresión del vector según la invención, o una composición según la invención incrementando la capacidad proliferativa de una célula de un vertebrado introduciendo dicho polinucleótido, polipéptido o composición en la célula in vitro.

En realizaciones relacionadas, la invención prevé organismos y células comprendiendo un polinucleótido según la invención codificando un polipéptido de transcriptasa inversa de telomerasa humana, como un organismo transgénico no humano como una levadura, planta, bacteria, o un animal no humano, por ejemplo, un ratón. La invención también prevé la utilización de animales o células transgénicos de los cuales un gen de hTRT ha sido anulado (suprimido) o mutado de tal manera que el gen no expresa un producto génico de hTRT que ocurre naturalmente. Por lo tanto, en realizaciones alternativas, el animal no humano transgénico tiene un gen de telomerasa mutado, es un animal deficiente en una actividad de telomerasa, es un animal cuya deficiencia de TRT es un resultado de un gen mutado codificando un TRT teniendo un nivel reducido de una actividad de telomerasa comparada con una TRT tipo silvestre y es un animal teniendo un gen de TRT mutado con una o más mutaciones, incluyendo mutaciones falsas de sentido, mutaciones sin sentido, inserciones, o anulaciones.

La invención proporciona también un anticuerpo, o un fragmento de enlace del mismo, que se enlaza específicamente a una proteína de hTRT de la composición de proteína según la invención. En una realización, el anticuerpo se enlaza con una afinidad de por lo menos alrededor de 108 M-1. El anticuerpo puede ser monoclonal o puede ser una composición policlonal, como un antisuero policlonal. En un aspecto relacionado, la invención proporciona una célula capaz de secretar el anticuerpo, como un hibridoma.

La invención también proporciona un método para determinar si un compuesto o tratamiento es un modulador de una actividad de transcriptasa inversa de telomerasa o expresión de hTRT. El método implica la detección o supervisión de un cambio en la actividad o expresión en una célula, animal o composición comprendiendo una proteína de hTRT o polinucleótido después de la administración del compuesto o tratamiento. En una realización, el método incluye los pasos de: proporcionar una composición de TRT, poner en contacto la TRT con el compuesto de prueba y medir la actividad de la TRT, donde un cambio en la actividad de TRT en la presencia del compuesto de prueba es un indicador de que el compuesto de prueba modula la actividad de TRT. En ciertas realizaciones, la composición es una célula, o una célula en la forma de un organismo, o un organismo transgénico, o un sistema in vitro, como un sistema de expresión, el cual contiene un polinucleótido recombinante codificando un polipéptido de hTRT. De esta manera, la hTRT del método puede ser un producto de expresión in vitro. En varias realizaciones, la detección de actividad de telomerasa o expresión puede ser detectando un cambio en la abundancia de un producto génico de hTRT, supervisando la incorporación de una etiqueta de nucleótido a un substrato para telomerasa, supervisando la hibridación de una sonda a un substrato de telomerasa extendido, supervisando la amplificación de un substrato de telomerasa extendido, supervisando la longitud de telómeros de una célula expuesta al compuesto de prueba, supervisando la pérdida de la habilidad de la telomerasa de enlazarse a un cromosoma, o midiendo la acumulación o la pérdida de la estructura de telomerasa.

En un aspecto, la invención proporciona un método para detectar un producto génico de hTRT, un mutante o una variante del mismo en una muestra biológica poniendo en contacto la muestra biológica con una sonda que enlaza específicamente el producto génico, en donde la sonda y el producto génico forman un complejo y detectando el complejo, donde la presencia del complejo se correlaciona con la presencia del producto génico de hTRT en la muestra biológica. El producto génico puede ser RNA, DNA o un polipéptido. Los ejemplos de sondas que pueden usarse para detección incluyen, pero no están limitados a, ácidos nucleicos y anticuerpos según la invención.

En una realización, el producto génico es un ácido nucleico el cual se detecta amplificando el gen y detectando el producto de amplificación, donde la presencia del complejo o producto de amplificación se correlaciona con la presencia del producto génico de hTRT en la muestra biológica. La sonda en tal procedimiento de amplificación puede ser un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica o exactamente complementaria a una secuencia contigua de un polinucleótido según la invención.

En una realización, la muestra biológica es de un paciente, como un paciente humano. En otra realización, la muestra biológica incluye por lo menos una célula de un cultivo de células in vitro, como un cultivo de célula humanas.

La invención además proporciona un método para detectar la presencia de por lo menos una célula humana positiva inmortal o de telomerasa en una muestra biológica que comprende células humanas obteniendo la muestra biológica que comprende células humanas; y detectando la presencia en la muestra de una célula que tiene un nivel alto de un producto génico de hTRT, donde la presencia de una célula que tiene un nivel alto del producto génico de hTRT se correlaciona con la presencia de células positivas inmortales o de telomerasa en la muestra biológica.

La invención también proporciona un método para diagnosticar una condición relacionada con la telomerasa en un paciente obteniendo una célula o muestra de tejido del paciente, determinando la cantidad de un producto génico de hTRT en la célula o tejido; y comparando la cantidad de producto génico de hTRT en la célula o tejido con la cantidad en una célula o tejido saludable del mismo tipo, donde una cantidad diferente de producto génico de hTRT en la muestra del paciente y la célula o tejido saludable es el diagnóstico de una condición relacionada con la telomerasa. En una realización, la condición relacionada con la telomerasa es cáncer y una cantidad mayor del producto génico de hTRT se detecta en la muestra.

Los procedimientos de la invención permiten el diagnóstico de cáncer en un paciente obteniendo una muestra biológica del paciente y detectando un producto génico de hTRT en la muestra del paciente, donde la detección del producto génico de hTRT en la muestra se correlaciona con un diagnóstico de cáncer.

Los procedimientos de la invención además permiten el diagnóstico de cáncer en un paciente obteniendo una muestra del paciente, determinando la cantidad de producto génico de hTRT en la muestra del paciente; y comparando la cantidad de producto génico de hTRT con un valor normal o de control, donde una cantidad del producto génico de hTRT en el paciente que es mayor que el valor normal o de control es un diagnóstico de cáncer.

Los procedimientos de la invención también permiten el diagnóstico de cáncer en un paciente obteniendo una muestra del paciente que contiene por lo menos una célula; determinando la cantidad de un producto génico de hTRT en una célula en la muestra; y comparando la cantidad de producto génico de hTRT en la célula con un valor normal para la célula, en donde una cantidad de producto génico de hTRT mayor que el valor normal es un diagnóstico de cáncer. En una realización, se cree que la muestra contiene por lo menos una célula maligna.

Los procedimientos de la invención también permiten un método para pronosticar un cáncer determinando la cantidad de producto génico de hTRT en una célula de cáncer obtenida del paciente; y comparando la cantidad de hTRT en la célula de cáncer con un valor de prognosis de hTRT consistente con una prognosis para el cáncer; donde una cantidad de hTRT en la muestra que está en el valor de prognosis proporciona la prognosis particular.

Los procedimientos de la invención también permiten un método para supervisar la habilidad de un tratamiento anticáncer para reducir la capacidad de proliferación de las células de cáncer en un paciente, haciendo una primera medición de la cantidad de un producto génico de hTRT en por lo menos una célula de cáncer del paciente, haciendo una segunda medición del nivel del producto génico de hTRT en por lo menos una célula de cáncer del paciente, en donde el tratamiento anticáncer se administra al paciente antes de la segunda medición; y comparando la primera medición y la segunda medición, donde un nivel más bajo del producto génico de hTRT en la segunda medición se correlaciona con la habilidad de un tratamiento anticáncer para reducir la capacidad de proliferación de células de cáncer en el paciente.

La invención también proporciona equipos para la detección de un gen de hTRT o producto génico de hTRT, un mutante o variante, que comprende un polinucleótido según la invención, un polipéptido obtenido por la expresión de un vector según la invención, una composición según la invención, un anticuerpo o fragmento de enlace según la invención, o un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica o exactamente complementaria a una secuencia contigua del polinucleótido según la invención. En una realización, el equipo incluye un recipiente incluyendo una molécula seleccionada de un ácido nucleico de hTRT o subsecuencia del mismo, un polipéptido de hTRT o subsecuencia del mismo y un anticuerpo anti-hTRT.

La invención también permite métodos para tratar enfermedades humanas. La invención permite un método para aumentar la capacidad de proliferación de una célula de vertebrado, como una célula mamífera, introduciendo un polinucleótido recombinante según la invención en la célula, en donde el polinucleótido comprende una secuencia codificando un polipéptido de hTRT. El polipéptido de hTRT puede tener una secuencia como se muestra en la Figura 17. La secuencia puede estar vinculada de una manera manejable a un promotor. La célula puede ser humana, como una célula en un paciente humano o la célula es introducida a un paciente humano.

La invención además permite un método para tratar una enfermedad humana introduciendo polinucleótido recombinante de hTRT a por lo menos una célula en un paciente.

Un vector de terapia de gen puede utilizarse. El método además puede constar de la introducción a la célula de un polinucleótido que comprende una secuencia codificando hTR, por ejemplo, un polinucleótido de hTR vinculado de manera manejable a un promotor.

La invención también permite un método para aumentar la capacidad de proliferación de una célula de vertebrado, el método comprendiendo la introducción a la célula de una cantidad efectiva de polipéptido de hTRT tal como contenido en una composición según la invención. La invención además permite células y progenie de células con capacidad de proliferación aumentada.

La invención también permite un método para tratar una condición asociada con un nivel elevado de actividad de telomerasa dentro de una célula, comprendiendo la introducción a la célula de una cantidad terapéuticamente efectiva de un inhibidor de la actividad de telomerasa, en donde el inhibidor es un polipéptido de hTRT según la invención o un polinucleótido de hTRT según la invención. El inhibidor puede ser un polipéptido o polinucleótido comprendiendo, por ejemplo, por lo menos una subsecuencia de una secuencia mostrada en las Figuras 16, 17, ó

20. El polipéptido o polinucleótido puede inhibir una actividad de TRT, como el enlace de TRT endógena a ARN de telomerasa.

La invención también proporciona un polinucleótido según la invención, un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica o exactamente complementaria a una secuencia contigua del polinucleótido de la parte (a) de la invención, un polipéptido obtenido por la expresión de un vector según la invención, una composición según la invención, o un anticuerpo o fragmento de enlace según la invención para utilización como un fármaco.

Otro aspecto de la invención es la utilización de un polinucleótido según la invención, un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica o exactamente complementaria a una secuencia contigua del polinucleótido de la parte (a) de la invención, un polipéptido obtenido por la expresión de un vector según la invención, una composición según la invención, o un anticuerpo o fragmento de enlace según la invención en la fabricación de un medicamento.

Además, otro aspecto de la invención es la utilización de un polinucleótido según la invención, un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica o exactamente complementaria a una secuencia contigua del polinucleótido de la parte (a) de la invención, un polipéptido obtenido por la expresión de un vector según la invención, una composición según la invención, o un anticuerpo o fragmento de enlace según la invención en la fabricación de un medicamento, para incrementar la capacidad proliferativa de una célula de un vertebrado, disminuyendo la capacidad proliferativa de una célula de un vertebrado, o el tratamiento de una condición asociada con un nivel elevado o disminuido de actividad telomerasa.

La invención incluye una composición farmacéutica que comprende un polinucleótido según la invención, un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica o exactamente complementaria a una secuencia contigua del polinucleótido de la parte (a) de la invención, un polipéptido obtenido por la expresión de un vector según la invención, una composición según la invención, o un anticuerpo o fragmento de enlace según la invención opcionalmente junto con una portadora farmacéuticamente aceptable.

Otro aspecto de la invención es la utilización de un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica o exactamente complementaria a una secuencia contigua del polinucleótido de la parte (a) de la invención, o un polipéptido obtenido por la expresión de un polinucleótido según la invención en un vector según la invención o fragmento inmunológico del mismo, o una composición según la invención en la preparación de una vacuna capaz de provocar una respuesta inmunitaria.

Descripción de las figuras

La Figura 1 muestra residuos altamente conservados en motivos de TRT de humano, S. pombe (tez1) , S. cerevisiae (EST2) y Euplotes aediculatus (p123) . Los aminoácidos idénticos se indican con un asterisco (*) [ligeramente en relieve], mientras que los residuos de aminoácidos similares se indican con un punto (•) . El motivo "0" en la figura también se llama Motivo T; Motivo "3" se llama también Motivo A.

La Figura 2 muestra el lugar de los motivos de secuencia específica de telomerasa y específica de RT de las proteínas de telomerasa y otras transcriptasas inversas. Los lugares del motivo T específico de telomerasa y los motivos conservados de RT 1, 2 y A-E se indican con cuadros. El rectángulo abierto etiquetado HIV-1 RT delinea la parte de esta proteína mostrada en la Figura 3.

La Figura 3 muestra la estructura de cristal de la subunidad de p66 de transcriptasa inversa HIV-1 (Brookhaven código 1HNV) . La vista es desde la parte posterior del lado derecho para permitir que todos los motivos sean mostrados.

La Figura 4 muestra la alineación de múltiples secuencias de transcriptasas inversa de telomerasa (Sp_Trt1p, S. pombe TRT [también llamado en el presente como "tez1p"]; hTRT, TRT humana; Ea_p123, Euplotes p123; Sc_Est2p, S. cerevisiae Est2p) y miembros de otras familias de RT (Sc_a1, proteína citocromo oxidasa intrón 1codificada de grupo II proveniente de mitocondria de S. cerevisiae, Dm_TART, transcriptasa inversa proveniente de Drosophila melanogaster del elemento retrotranspuesto TART de no LTR) ; HIV-1, transcriptasa inversa del virus de inmunodeficiencia humana. TRT con y RT con representan secuencias de consenso para transcriptasas inversas de telomerasa y transcriptasas inversas de no telomerasa. Los aminoácidos son designados con una h, hidrófobos; p, polares; c, cargados. Los triángulos muestran residuos que son conservados entre las proteínas de telomerasa pero diferentes en otras transcriptasas inversas. La línea sólida abajo del motivo E realza la región del asa del iniciador.

La Figura 5 muestra la expresión de ARN de hTRT en cepas de células mortales negativas de telomerasa y líneas de células mortales positivas de telomerasa como se describe en el Ejemplo 2.

La Figura 6 muestra un posible árbol filogenético de telomerasas y retroelementos arraigados con ARN polimerasas dependientes de RNA.

La Figura 7 muestra un mapa de restricción de lambda clone G<5.

La Figura 8 muestra un mapa del cromosoma 5p con la ubicación del marcador STS D5S678 (situado cerca del gen de hTRT) indicado.

La Figura 9 muestra la construcción de un plásmido promotor-reportero de hTRT.

La Figura 10, en dos páginas, muestra la coexpresión in vitro de hTRT y hTR para producir telomerasa humana catalíticamente activa.

La Figura 11, en dos páginas, muestra una alineación de secuencias de cuatro proteínas de hTRT e identifica motivos de interés. TRT con muestra una secuencia de consenso de TRT. RT con muestra residuos de consenso para otras transcriptasas inversas. Los residuos de consenso en mayúscula indican conservación absoluta en las proteínas de TRT.

La Figura 12 muestra un sitio de disociación Topoisomerase II y motivos de sitio de enlace NFkB en un intrón de hTRT, con la secuencia mostrada correspondiendo a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 7.

La Figura 13, en dos páginas, muestra la secuencia del DNA codificando la subunidad de proteína de telomerasa Euplotes 123 kDa (Euplotes TRT) .

La Figura 14 muestra la secuencia de aminoácidos de la subunidad de proteína de telomerasa Euplotes 123 kDa (Euplotes proteína de TRT) .

La Figura 15, en cinco páginas, muestra las secuencias del DNA y aminoácidos de la subunidad catalítica de telomerasa S. pombe (S. pombe TRT) .

La Figura 16, en dos páginas, muestra la secuencia de cDNA de hTRT, con la secuencia mostrada correspondiendo a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1.

La Figura 17 muestra la proteína de hTRT codificada por el cDNA de la Figura 16. La secuencia de proteína mostrada corresponde a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2.

La Figura 18 muestra la secuencia del clon 712562, con la secuencia mostrada correspondiendo a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 3.

La Figura 19 muestra una proteína de residuos 259 codificada por el clon 712562, con la secuencia mostrada correspondiendo a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 10.

La Figura 20 muestra, en siete páginas, la secuencia de un ácido nucleico con una configuración de lectura abierta codificando un polipéptido de variantes L182, con la secuencia mostrada correspondiendo a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 4. Esta Figura también muestra la secuencia de aminoácidos de este polipéptido de variantes de L182, con la secuencia de aminoácidos mostrada correspondiendo a NÚMERO DEIDENTIFICACIÓN DE SECUENCIA: 5.

La Figura 21 muestra, en seis páginas, la secuencia de un clon genómico de hTRT, con la secuencia mostrada correspondiendo a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 6. Se indican los motivos y elementos de consenso, incluyendo secuencias características de un sitio de disociación Topoisomerase II, sitios de enlace NFkB, una secuencia Alu y otros elementos de secuencia.

La Figura 22 muestra el efecto de mutación del gen de TRT en levadura, como se describe en el Ejemplo 1.

La Figura 23 muestra la secuencia de EST AA281296, correspondiendo a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 8.

La Figura 24 muestra la secuencia de los 182 pares de bases anulados en el clon 712562, con la secuenciamostrada correspondiendo al NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 9.

La Figura 25 muestra los resultados de un ensayo para actividad de telomerasa de células BJ transfectadas con un vector de expresión codificando una proteína de hTRT (pGRN133) o un plásmido de control (pBBS212) como se describe en el Ejemplo 13.

La Figura 26 es un diagrama esquemático de la purificación de afinidad de telomerasa mostrando los pasos de enlace y elución de desplazamiento.

La Figura 27 es una fotografía de un manchado Northern de preparaciones de telomerasa obtenidas durante un protocolo de purificación, como se describe en el Ejemplo 1. La ruta 1 contenía 1.5 fmol de ARN de telomerasa, la ruta 2 contenía 4.6 fmol de ARN de telomerasa, la ruta 3 contenía 14 fmol de ARN de telomerasa, la ruta 4 contenía 41 fmol de ARN de telomerasa, la ruta 5 contenía extracto nuclear (42 fmol de telomerasa, la ruta 6 contenía telomerasa purificada con heparina Affi-Gel (47 fmol de telomerasa) , la ruta 7 contenía telomerasa purificada en afinidad (68 fmol) y la ruta 8 contenía telomerasa purificada por gradiente en glicerol (35 fmol) .

La Figura 28 muestra actividad de telomerasa a través de un protocolo de purificación.

La Figura 29 es una fotografía de un gel SDS-PAGE, mostrando la presencia de un polipéptido de aproximadamente 123 kDa y un doblete de aproximadamente 43 kDa de Euplotes aediculatus.

La Figura 30 es una gráfica mostrando el coeficiente de sedimentación de telomerasa de Euplotes aediculatus.

La Figura 31 es una fotografía de un gel de poliacrilamida/urea con formamida al 36% mostrando la utilización de substrato de telomerasa de Euplotes.

La Figura 32 muestra las alineaciones putativas del molde de ARN de telomerasa e iniciadores tipo horquilla con ARN de telomerasa.

La Figura 33 es una fotografía de las rutas 25-30 del gel mostrado en la Figura 31, mostrado en una nivel de exposición más ligero.

La Figura 34 muestra la secuencia de DNA del gen codificando la subunidad de proteína de telomerasa de 43 kDa de Euplotes.

La Figura 35 muestra, en cuatro páginas, la secuencia de DNA, así como las secuencias de aminoácidos de las tres configuraciones de lectura abierta de la subunidad de proteína de telomerasa de 43 kDa de Euplotes.

La Figura 36 muestra una comparación de secuencias entre la subunidad de proteína de telomerasa de 123 kDa de Euplotes (secuencia superior) y la subunidad de polipéptido de 80 kDa de T. thermophila (secuencia inferior) .

La Figura 37 muestra una comparación de secuencias entre la subunidad de proteína de telomerasa de 123 kDa de E. aediculatus (secuencia superior) y el polipéptido de telomerasa de 95 kDa de T. thermophila (secuencia inferior) . La Figura 38 muestra la alineación mejor ajustada entre una parte de "Ladomain" de la subunidad de proteína de telomerasa de 43 kDa de E. aediculatus (secuencia superior) y una parte de la subunidad de polipéptido de 95 kDa de T. thermophila (secuencia inferior) . La Figura 39 muestra la alineación mejor ajustada entre una parte de "Ladomain" de la subunidad de proteína de telomerasa de 43 kDa de E. aediculatus (secuencia superior) y una parte de la subunidad de polipéptido de 80 kDa de T. thermophila (secuencia inferior) . La Figura 40 muestra la alineación y motivos del dominio de polimerasa de la subunidad de proteína de telomerasa de 123 kDa de E. aediculatus y los dominios de polimerasa de varias transcriptasas inversas incluyendo una proteína citocromo oxidasa intrón 1-codificada de grupo II proveniente de mitocondria de S. cerevisiae (a1 S.c. (grupo II) ) , Dong (LINE) y levadura ESTp (L8543.12) .

La Figura 41 muestra la alineación de un dominio de la subunidad de proteína de telomerasa de 43 kDa con varias proteínas La. La Figura 42 muestra la secuencia de nucleótidos codificando la subunidad de proteína de 80 kDa de T. thermophila. La Figura 43 muestra la secuencia de aminoácidos de la subunidad de proteína de 80 kDa de T. thermophila. La Figura 44 muestra la secuencia de nucleótidos codificando la subunidad de proteína de 95 kDa de T. thermophila. La Figura 45 muestra la secuencia de aminoácidos de la subunidad de proteína de 95 kDa de T. thermophila.

La Figura 46 muestra la secuencia de aminoácidos de L8543.12 ("Est2p") . La Figura 47 muestra la alineación de la secuencia de aminoácidos codificada por el producto de la PCR de Oxytricha con la secuencia de Euplotes p123.

La Figura 48 muestra la secuencia de DNA de Est2.

La Figura 49 muestra la secuencia parcial de aminoácidos de un clon de cDNA codificando motivos de péptidos de telomerasa humana. La Figura 50 muestra la secuencia parcial de DNA de un clon de cDNA codificando motivos de péptidos de telomerasa humana. La Figura 51 muestra la secuencia de aminoácidos de tez1, llamado también S. pombe trt. La Figura 52 muestra, en dos páginas, la secuencia de DNA de tez1. Las regiones intrónicas y otras de no codificación se muestran en minúscula y exones (es decir, regiones de codificación) se muestran en mayúscula.

La Figura 53 muestra la alineación de EST2p; secuencias de Euplotes y Tetrahymena, así como la secuencia de consenso. La Figura 54 muestra las secuencias de péptidos útiles para la producción de anticuerpos anti-hTRT. La Figura 55 es un sumario esquemático de los experimentos de la secuencia de tez1+. La Figura 56 muestra dos iniciadores degenerados usados en la PCR para identificar el homólogo S. pombe de las secuencias de E. aediculatus p123.

La Figura 57 muestra las cuatro principales bandas producidas en la PCR usando iniciadores degenerados para identificar el homólogo S. pombe de las secuencias de E. aediculatus p123. La Figura 58 muestra la alineación del producto M2 PCR con secuencias de proteína de telomerasa de E.

aediculatus p123, S. cerevisiae y Oxytricha.

La Figura 59 es un esquema que muestra la estrategia de 3' RT PCR para identificar el homólogo S. pombe de las secuencias de E. aediculatus p123. La Figura 60 muestra características de las bibliotecas usadas para seleccionar las secuencias de proteína de telomerasa de S. pombe y muestra los resultados de la selección de las bibliotecas para las secuencias de proteína de telomerasa de S. pombe.

La Figura 61 muestra los resultados positivos obtenidos con clones genómicos positivos digestados en HindIII que contienen secuencia de telomerasa de S. pombe.

La Figura 62 es un esquema que muestra la estrategia de 5' RT PCR usada para obtener un clon de TRT de S. pombe de tamaño natural.

La Figura 63 muestra la alineación de los dominios de RT de las subunidades catalíticas de telomerasa para S. pombe (S.p.) , S. cerevisiae (S.c.) y E. aediculatus (E.a.) .

La Figura 64 muestra la alineación de las secuencias de Euplotes ("Ea_p123") , S. cerevisiae ("Sc_Est2p") y S. pombe ("Sp_Tez1p") . En el Tablero A, las áreas sombreadas indican residuos compartidos entre dos secuencias. En el Tablero B, las áreas sombreadas indican residuos compartidos entre las tres secuencias.

La Figura 65 muestra la estrategia de disrupción usada con los genes de telomerasa en S. pombe.

La Figura 66 muestra los resultados experimentales que confirman la disrupción de tez1.

La Figura 67 muestra la reducción progresiva de telómeros en S. pombe debido a la disrupción de tez1.

La Figura 68 muestra, en cuatro páginas, el DNA y aminoácido de la ORF codificando una proteína de telomerasa de aproximadamente 63 kDa codificada por el inserto EcoRI-NotI del clon 712562.

La Figura 69 muestra una alineación de motivos de transcriptasa inversa de varias fuentes.

La Figura 70 proporciona un mapa de restricción y función del plásmido pGRN121.

La Figura 71 muestra, en dos páginas, los resultados del análisis de la secuencia preliminar del ácido nucleico de una secuencia de cDNA de hTRT.

La Figura 72 muestra, en diez páginas, la secuencia preliminar del ácido nucleico de hTRT y secuencias deducidas de la ORF en tres configuraciones de lectura.

La Figura 73 proporciona un mapa de restricción y función del plásmido pGRN121.

La Figura 74 muestra, en ocho páginas, una secuencia refinada de ácido nucleico y secuencias deducidas de la ORF de hTRT.

La Figura 75 muestra un mapa de restricción de clon lambda 25-1.1.

Descripción detallada de la invención I. INTRODUCCIÓN

La telomerasa es un complejo de ribonucleoproteína (RNP) comprendiendo un componente de ARN y un componente de proteína catalítica. La presente invención se refiere a la clonación y caracterización del componente de proteína catalítica de telomerasa, en lo sucesivo referido como "TRT" (transcriptasa inversa de telomerasa) . TRT es así llamada porque esta proteína actúa como un DNA polimerasa dependiente de ARN (transcriptasa inversa) , usando el componente de ARN de telomerasa (en lo sucesivo, "TR") para dirigir la síntesis de las secuencias de repetición de DNA de telómeros. Además, la TRT se relaciona de manera evolutiva con otras transcriptasas inversas (vea el Ejemplo 12) .

En un aspecto, la presente invención se refiere a la clonación y caracterización del componente de proteína catalítica de telomerasa humana, en lo sucesivo referido como "hTRT". La TRT humana es de extraordinario interés y valor ya que, como se indica arriba, la actividad de telomerasa en células humanas (y otras células mamíferas) se correlaciona con la capacidad de proliferación de las células, la inmortalidad de las células y el desarrollo de un fenotipo neoplástico. Por ejemplo, la actividad de telomerasa y, como se demuestra en el Ejemplo 2, abajo, los niveles de productos génicos de TRT humana son elevados en células humanas inmortales (como células de tumores malignos y líneas de células inmortales) en relación con las células mortales (como la mayoría de las células somáticas humanas) .

La presente invención además proporciona métodos y composiciones valiosas para diagnosis, prognosis y tratamiento de enfermedades humanas y condiciones de enfermedades, como se describe abajo con detalles. También se proporcionan métodos y reactivos útiles para inmortalizar células (in vivo y ex vivo) , produciendo animales transgénicos con características convenientes y muchos otros usos, muchos de los cuales se describen abajo. La invención también proporciona métodos y reactivos útiles para preparar, clonar, o volver a clonar genes y proteínas de TRT de ciliados, hongos, vertebrados, como mamíferos y otros organismos.

Como se describe a continuación con mayor detalle, TRT se caracterizó inicialmente después de la purificación de la telomerasa del ciliado Euplotes aediculatus. La extensa purificación de telomerasa de Euplotes aediculatus, usando cromotografía de afinidad con ARN y otros métodos, produjo la proteína "p123". De manera sorprendente, p123 no se relaciona con proteínas las cuales anteriormente se creía que constituían las subunidades de proteína de la holoenzima de telomerasa (es decir, las proteínas p80 y p95 de Tetrahymena thermophila) . El análisis de las secuencias de DNA de p123 y proteínas (Número de Acceso de GenBank U95964; Figuras 13 y 14) reveló motivos de transcriptasa inversa (RT) consistentes con el papel de p123 como la subunidad catalítica de telomerasa (vea, por ejemplo, las Figuras 1, 4 y 11) . Además, p123 se relaciona con una proteína de S. cerevisiae (levadura) , Est2p, la cual se sabía que desempeña un papel en el mantenimiento de telómeros en S. cerevisiae (Número de Acceso de GenBank S5396) , pero antes de la presente invención fue reconocida por codificar una proteína de la subunidad catalítica de telomerasa (vea, por ejemplo, Lendvay y otros, 1996, Genetics, 144:1399) .

En un aspecto, la presente invención proporciona reactivos que pueden utilizarse para identificar y clonar nuevas TRTs usando: sondas de ácido nucleico e iniciadores generados o derivados de los polinucleótidos de TRT revelados (por ejemplo, para clonar genes de TRT y cDNAs) ; anticuerpos que reconocen específicamente los motivos o secuencias de motivos u otros epítopos de TRT (por ejemplo, para expresión clonando genes de TRT o purificación de proteínas de TRT) ; seleccionando bases de datos computarizadas; u otros medios. Por ejemplo, como se describe en el Ejemplo 1, la amplificación de la PCR (reacción de cadena de polimerasa) de DNA de S. pombe se realizó con iniciadores de secuencia degenerados diseñados de los motivos B' y C de p123 RT de Euplotes. De cuatro productos prominentes generados, uno codificó una secuencia de péptidos homóloga a p123 de Euplotes y Est2p de S. cerevisiae. Usando este producto de PCR como una sonda, la secuencia completa del homólogo de TRT de S. pombe se obtuvo seleccionando de bibliotecas de cDNA de S. pombe y genómicas y amplificando ARN de S. pombe por transcripción inversa y PCR (TR-PCR) . La secuencia completa del gen de S. pombe ("trt1"; Número de Acceso de GenBank AF015783; Figura 15) reveló que la homología con p123 y Est2p fue especialmente alta en los motivos de la transcriptasa inversa. trt1 de S. pombe también se conoce como tez1.

La amplificación usando iniciadores degenerados derivados de los motivos de RT de telomerasa también se usó para obtener secuencias de genes de TRT en Oxytricha trifallax y Tetrahymena thermophila, como se describe en el Ejemplo 1.

Las secuencias de p123 de Euplotes, trt1 de S. pombe y ácido nucleico Est2p de S. cerevisiae nción se usaron en una búsqueda de una base de datos computarizada de etiquetas de secuencias expresadas humanas (ESTs) usando el programa BLAST (Altschul y otros, 1990, J. Mol. Biol. 215:403) . La búsqueda de esta base de datos con la secuencia Est2p no indicó una concordancia, pero la búsqueda con las secuencias p123 y trt1 identificaron una EST humana (Número de Acceso de GenBank AA281296; vea NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 8) , como se describe en el Ejemplo 1, codificando putativamente una proteína homóloga. La secuencia completa delclon de cDNA conteniendo la EST (en lo sucesivo, "clon 712562"; vea NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 3) mostró que estaban presentes siete motivos de RT. Sin embargo, este clon no codificó una TRT humana contigua con los siete motivos, ya que los motivos B', C, D y E estaban contenidos en una configuración de lectura abierta (ORF) diferente a los demás motivos terminales de NH2. Además, la distancia entre los motivos A y B' fue substancialmente más corta que la distancia de las tres TRTs antes caracterizadas. El clon 712562 se obtuvo del Consorcio I.M.A.G.E.; Lennon y otros, 1996, Genomics 33:151.

Un clon de cDNA, pGRN121, codificando una hTRT funcional (vea la Figura 16, NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1) se aisló de una biblioteca de cDNA derivada de la línea de células humanas 293 como se describe en el Ejemplo 1. La comparación del clon 712562 con pGRN121 mostró que el clon 712562 tiene una anulación de182 pares de bases (vea la Figura 24, NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 9) entre los motivos A y B'. Los 182 pares de bases adicionales presentes en pGRN121 ponen todos los motivos de TRT en una sola configuración de lectura abierta y aumentan el espacio entre las regiones del motivo A y el motivo B' a una distancia consistente con las otras TRTs conocidas. Como se describe abajo en los Ejemplos (por ejemplo, Ejemplo 7) , elNÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1 codifica una proteína de telomerasa catalíticamente activateniendo la secuencia del NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2. El polinucleótido del NÚMERO DEIDENTIFICACIÓN DE SECUENCIA: 2 tiene 1132 residuos y un peso molecular calculado de alrededor de 127 kilodaltons (kD) .

Como se expone a continuación y como se describe en el Ejemplo 9, a continuación, los cDNAs de TRT que posee la anulación de 182 pares de bases característica del clon 712562 son detectados después de la transcripción inversa de ARN de las células positivas de telomerasa (por ejemplo, teste y 293 células) . Los RNAs de hTRT que carecen de esta secuencia de 182 pares de bases se conocen generalmente como "variantes L182" y pueden representar una, dos, o varias especies. Aunque es probable que las variantes de hTRT que carecen de la secuencia de 182 pares de bases encontrada en el cDNA de pGRN121 codifiquen una enzima catalítica de telomerasa completamente activa, pueden desempeñar un papel en la regulación de telomerasa, como se discute abajo y/o tener actividad parcial de telomerasa, como el enlace de telómeros o la actividad de enlace de hTR, como se discute abajo.

De esta manera, en un aspecto, la presente invención proporciona unos polinucleótidos aislados, tal como se ha especificado anteriormente, que comprenden polinucleótidos codificando una proteína, fragmento, variante o derivado de hTRT. La invención permite ácidos nucleicos con sentido y antisentido que se fijan a un gen de hTRT o mRNA. La invención además proporciona unas composiciones de proteínas de hTRT tal como se ha especificado anteriormente, irrespectivemente de que la proteína sea sintetizada o purificada de fuentes naturales, así como anticuerpos y otros agentes que enlazan específicamente una proteína de hTRT o un fragmento de la misma. La presente invención también prevé muchos métodos nuevos, incluyendo métodos que emplean las composiciones antes mencionadas, por ejemplo, proporcionando ensayos de diagnosis y prognosis para enfermedades humanas, métodos para desarrollar terapias y métodos de terapia, identificación de proteínas asociadas con telomerasa y métodos para seleccionar agentes capaces de activar o inhibir la actividad de telomerasa. Más adelante se proporcionan otros muchos aspectos de la invención y otros asuntos y materias relacionados.

Un aspecto adicional proporcionado por la invención es el uso de un agente que aumenta la expresión de hTRT en la fabricación de un medicamento para el tratamiento de una condición dirigida aumentando la capacidad de proliferación de una célula de vertebrado, opcionalmente el medicamento que es para inhibir los efectos del envejecimiento.

Otro aspecto proporcionado por la invención es el uso de un inhibidor de la actividad de telomerasa en la fabricación de un medicamento para el tratamiento de una condición asociada con un nivel elevado de la actividad de telomerasa dentro de una célula humana. Generalmente, la invención proporciona un procedimiento para proporcionar un fármaco que comprende la realización de las etapas de un procedimiento según la invención y a continuación la formulación de un modulador de expresión de actividad transcriptasa inversa de telomerasa o hTRT identificado por dicho procedimiento para su utilización farmacéutica para lograr la modulación de expresión de actividad transcriptasa inversa de telomerasa o hTRT.

Las proteínas, variantes y fragmentos de la invención y los polinucleótidos o fragmentos de codificación también se proporcionan cada uno en otro aspecto de esta invención para uso como un farmacéutico.

La invención además incluye el uso de una proteína, variante o fragmento, o de un polinucleótido o fragmento, en cada caso como se define en el presente, en la fabricación de un medicamento, por ejemplo en la fabricación de un medicamento para inhibir un efecto de envejecimiento o cáncer.

La siguiente descripción se organiza por tema. La parte II describe además los motivos de aminoácidos característicos de las proteínas de TRT, así como genes de TRT codificando proteínas que tienen dichos motivos. Las Partes III-VI describen, entre otras cosas, ácidos nucleicos, proteínas, anticuerpos y composiciones purificadas con enfoque particular en las composiciones relacionadas con la TRT humana. La Parte VII describe, entre otras cosas, métodos y composiciones útiles para el tratamiento de enfermedades humanas. La Parte VIII describe la producción e identificación de líneas de células humanas inmortalizadas. La Parte IX describe, entre otras cosas, los usos de los ácidos nucleicos, polinucleótidos y otras composiciones para el diagnóstico de enfermedades humanas. La Parte X describe, entre otras cosas, métodos y composiciones útiles para seleccionar e identificar agentes y tratamientos que modulen (por ejemplo, inhiben o promuevan) la actividad de telomerasa o expresión. La Parte XI describe, entre otras cosas, animales transgénicos (por ejemplo, animales y células con supresión de telomerasa) . La Parte XII es un glosario de términos usados en las Partes I-XI. La Parte XIII describe ejemplos referentes a realizaciones específicas de la invención. La organización de la descripción por tema y subtema debe proporcionar claridad y de ninguna manera debe ser de carácter limitativo.

II. GENES Y PROTEÍNAS DE TRT

La presente invención proporciona genes y composiciones de proteínas aislados y/o recombinantes teniendo una secuencia de proteína de la subunidad catalítica de telomerasa (es decir, transcriptasa inversa de telomerasa) , incluyendo, pero no limitado a, las formas de estos genes y proteínas que ocurren naturalmente de manera aislada o recombinante. Normalmente, las TRTs son proteínas grandes, básicas teniendo motivos de aminoácidos de transcriptasa inversa (RT) y específicos de telomerasa (T) , como se revela en el presente.

Los siete motivos de RT encontrados en las TRTs, similares a aquellos encontrados en otras transcriptasas inversas, tienen marcas de contraste particulares. Por ejemplo, como se muestra en la Figura 4, dentro de los motivos de RT de TRT, hay un número de substituciones de aminoácidos (marcadas con flechas) en los residuos altamente conservados entre las demás RTs. Por ejemplo, en el motivo C, los dos residuos de ácido aspártico (DD) que coordinan los iones metálicos de sitio activo (vea, Kohlstaedt y otros, 1992, Science 256:1783; Jacobo-Molina y otros, 1993, Proc. Natl. Acad. Sci. U.S.A. 90:6320; Patel y otros, 1995, Biochemistr y 34:5351) ocurren en el contexto hxDD (F/Y) en las RTs de telomerasa en comparación con (F/Y) xDDh en las demás RTs (donde "h" es un aminoácido hidrófobo y "x" es cualquier aminoácido; vea Xiong y otros, 1990, EMBO J. 9:3353; Eickbush, en The Evolutionar y Biology of Viruses (S. Morse, Ed., Raven Press, NY, pág. 121, 1994) ) . Otro cambio sistemático característico del subgrupo de telomerasa ocurre en el motivo E, donde WxGxSx es una secuencia de consenso o se conserva entre las proteínas de telomerasa, considerando que hLGxxh es característico de otras RTs (Xiong y otros, arriba; Eickbush arriba) . Este motivo E se llama el "asa del iniciador" y se ha reportado que las mutaciones en esta región afectan la iniciación de ARN pero no la iniciación de DNA (Powell y otros, 1997, J. Biol. Chem. 272:13262) . Debido a que la telomerasa requiere un iniciador de DNA (por ejemplo, el extremo 3' de cromosomas) , no se espera que la telomerasa difiera de las demás RTs en la región del asa del iniciador. Además, la distancia entre los motivos A y B' es más larga en las TRTs que típica para las demás RTs, los cuales pueden representar una inserción dentro de la región de "dedos" de la estructura que se parece a una mano derecha (Figura 3; vea Kohlstaedt y otros, arriba; Jacobo-Molina y otros, arriba; y Patel y otros, arriba) .

Además, como se indica arriba, el Motivo T es una marca de contraste adicional de proteínas de TRT. Este Motivo T, como se muestra, por ejemplo en la Figura 4 (W-L-X-Y-X-X-h-h-X-h-h-X-p-F-F-T-E-X-p-X-X-X-p-X-X-X-Y-X-R-K-X-X-W [X es cualquier aminoácido, h es hidrófobo, p es polar]) , comprende una secuencia que puede describirse usando la fórmula:

Trp-R1-X7-R1-R1-R2-X-Phe-Phe-Tyr-X-Thr-Glu -X8-9-R3-R3-Arg-R4-X2-Trp

donde X es cualquier aminoácido y el subíndice se refiere al número de residuos consecutivos, R1 es leucina o isoleucina, R2 es glutamina o arginina, R3 es fenilalanina o tirosina y R4 es lisina o histidina.

El motivo T también puede describirse usando la fórmula:

Trp-R1-X4-h-h-X-h-h-R2-p-Phe-Phe-Tyr-X-Thr-GluX-p-X3-p-X2-3-R3-R3-Arg-R4-X2-Trp

donde X es cualquier aminoácido y un subíndice se refiere al número de residuos consecutivos, R1 es leucina o isoleucina, R2 es glutamina o arginina, R3 es fenilalanina o tirosina y R4 es lisina o histidina, h es un aminoácido hidrófobo seleccionado de Ala, Leu, Ile, Val, Pro, Phe, Trp y Met y p es un aminoácido polar seleccionado de Gly, Ser, Thr, Tyr, Cys, Asn y Gln.

Las proteínas de TRT normalmente comprenden uno o más de los motivos ilustrados en la Figura 11, por ejemplo, Motivo TW-X12-FFY-X-TE-X10-11-R-X3-W-X7-I Motivo T'E-X2-V-X Motivo 1X3-R-X2-PK-X3 Motivo 2X-R-X-I-X Motivo AX4-F-X3-D-X4-YD-X2 Motivo B'Y-X4-G-X2-QG-X3-S-X8 Motivo CX6-DD-X-L-X3

Cuando la proteína de TRT mostrada contiene más de un motivo de TRT, el orden (NH2 - >COOH) es como se muestra en la Figura 11.

Las proteínas de TRT aisladas que ocurren naturalmente pueden comprender el siguiente supermotivo:

(NH2) -X300-600-W-X12-FFY-X-TE-X10-11-R-X3-W-X7-I-X5-20-E-X2-V-X-X5-20-X3-R-X2-PK-X4-10-R-X-I-X-X60-80-X4-F-X3-D-X4YD-X2-X80-130-Y-X4-G-X2-QG-X3-S-X8-X5-35-X6-DD-X-L-X3-X10-20-X12-K

Será aparente para un experto que, provisto con los reactivos, incluyendo las secuencias de TRT reveladas en el presente reveladas en el presente para esos reactivos y los métodos y orientación provistos en el presente (incluyendo metodologías específicas descritas abajo) , los genes y proteínas de TRT pueden obtenerse, aislarse y producirse en forma recombinante mediante una destreza ordinaria. Por ejemplo, se proporcionan iniciadores (por ejemplo, iniciadores de amplificación degenerados) que se hibridan a secuencias de genes codificando motivos de RT y T característicos de TRT. Por ejemplo, uno o más iniciadores o iniciadores degenerados que se hibridan a secuencias codificando la región de FFYXTE del motivo F, otros motivos de TRT (como se discute abajo) , o combinaciones de motivos o secuencias de consenso, pueden prepararse sobre la base del uso de codón del organismo de objetivo y usarse para amplificar la secuencia de genes de TRT de DNA o cDNA genómico preparado de los organismos de objetivo. Es muy conocido el uso de iniciadores degenerados en el arte y ocasiona el uso de conjuntos de iniciadores que se hibridan al conjunto de secuencias de ácidos nucleicos que potencialmente pueden codificar los aminoácidos del motivo de objetivo, tomando en cuenta las preferencias de codón y el uso del organismo de objetivo y usando las condiciones de amplificación (por ejemplo, PCR) apropiadas para permitir desigualdades de base en los pasos de recocimiento de la PCR. Normalmente, se usan dos conjuntos de iniciadores; sin embargo, son muy conocidos los sistemas de amplificación de un solo iniciador (o, en este caso, un solo conjunto de iniciadores degenerados) y pueden usarse para obtener genes de TRT.

El Cuadro 1 proporciona iniciadores ilustrativos que pueden usarse para amplificar nuevos ácidos nucleicos de TRT, particularmente aquellos de vertebrados (por ejemplo, humanos y otros mamíferos) . "N" es una mezcla equimolar de los cuatro nucleótidos y los nucleótidos dentro de paréntesis son mezclas equimolares de los nucleótidos especificados.

CUADRO 1

INICIADORES DEGENERADOS ILUSTRATIVOS PARA AMPLIFICACIÓN DE ÁCIDOS NUCLEICOS DE TRT

motivo dirección 5'-secuencia-3'

a FFYVTE Delantera TT (CT) TT (CT) TA (CT) GTNACNGA b FFYVTE Inversa TCNGTNAC (GA) TA (GA) AA (GA) AA c RFIPKP Delantera (CA) GNTT (CT) AT (ACT) CCNAA (AG) CC d RFIPKP Inversa GG (TC) TTNGG (TGA) AT (GA) AANC e AYDTI Delantera GCNTA (CT) GA (CT) ACNAT f AYDTI Inversa TANGT (GA) TC (GA) TANGC g GIPOG Delantera GGNAT (ACT) CCNCA (AG) GG h GIPOGS Inversa (GC) (AT) NCC (TC) TGNGG (TGA) ATNCC i LVDDFL Delantera (CT) TNGTNGA (CT) GA (CT) TT (CT) (CT) T j DDFLLVT Inversa GTNACNA (GA) NA (GA) (GA) AA (GA) TC (GA) TC

Combinaciones de iniciadores preferidas (s = sí, n = no)

Inversa Delantera b d f h j a -n s s s s c -n n s s s e -n n n s s g -n n n n s i -n n n n n Los ácidos nucleicos de TRT amplificados pueden utilizarse como unas sondas de hibridación para la hibridación de colonias a una biblioteca (por ejemplo, biblioteca de cDNA) hecha del organismo de objetivo, de tal manera que un 15 ácido nucleico que tiene toda la secuencia de codificación de proteína de TRT, o una parte substancial de la misma, se identifica y se aísla o se clona. Los reactivos y métodos como los que se acaban de describir se usaron en conformidad con los métodos descritos en el presente para obtener secuencias de genes de TRT de Oxytricha trifallax y Tetrahymena thermophila, como se describe detalladamente abajo. Se reconocerá que después de la clonación de un gen de TRT previamente no caracterizado, la secuencia puede determinarse por métodos de rutina y el polipéptido codificado se sintetizó y se ensayó para una actividad de TRT, como la actividad catalítica de telomerasa (como se describe en el presente y/o mediante ensayos de telomerasa conocidos en el arte) .

También será aparente para aquellas personas expertas que los genes de TRT pueden clonarse usando una variedad de métodos de clonación debido a que las secuencias de motivos de TRT y los ácidos nucleicos de la 25 invención comprendiendo dichas secuencias pueden usarse en una amplia variedad de estos métodos. Por ejemplo, puede usarse la hibridación usando una sonda sobre la base de la secuencia de una biblioteca conocida de TRT a DNA u otros ácidos nucleicos del organismo de objetivo, como se describe en el Ejemplo 1. Se apreciará que los iniciadores de PCR degenerados o sus productos de amplificación como los que se describen arriba, pueden etiquetarse y usarse como sondas de hibridación. Alternativamente, se usan métodos de clonación de expresión. 30 Por ejemplo, uno o más anticuerpos que enlazan específicamente péptidos que se extienden sobre un motivo de TRT u otro epítopo de TRT, como el motivo de FFYXTE pueden emplearse para aislar un complejo ribosómico comprendiendo una proteína de TRT y el mRNA que la codifica. Para generar estos anticuerpos de la invención, las substancias inmunógenas de péptidos normalmente tienen entre 6 y 30 aminoácidos de longitud, más a menudo alrededor de 10 a 20 aminoácidos de longitud. Los anticuerpos también pueden usarse para sondar una biblioteca de expresiones de cDNA derivada del organismo de interés para identificar un clon codificando una secuencia de TRT. Alternativamente, también pueden hacerse búsquedas por computadora de bases de datos de DNA para DNAs conteniendo secuencias conservadas con TRTs conocidas para identificar un clon que comprende una secuencia de TRT.

En un aspecto, la presente invención comprende composiciones según la invención que comprenden un polipéptido aislado o recombinante teniendo la secuencia de aminoácidos de una proteína de TRT que ocurre naturalmente. En general, la TRT que ocurre naturalmente tiene un peso molecular de entre 80, 000 daltons (D) y 150, 000 D, muy a menudo entre 95, 000 D y 130, 000 D. Normalmente, la TRT que ocurre de manera natural tiene una carga positiva neta en pH 7 (calculada pI normalmente mayor que 9) . Las composiciones según la invención pueden comprender 45 fragmentos de estos polipéptidos. La presente invención también proporciona polinucleótido aislado o recombinante teniendo la secuencia de un gen que ocurre naturalmente codificando una proteína de TRT. La invención efectivamente permite reactivos útiles para aislar la secuencia de una TRT de no vertebrados (como la levadura) y vertebrados, como mamíferos (por ejemplo, murino o humano) . El polinucleótido aislado puede asociarse con otras secuencias de ácido nucleico de vector que ocurre naturalmente o recombinante o sintético. En general, el ácido nucleico es más pequeño que 300 kb, a menudo menos que 50 kb, más a menudo menos que 20 kb, frecuentemente menos que 10 kb y algunas veces menos que 5 kb o 2 kb de longitud. El polinucleótido de TRT aislada puede ser aún más pequeño, como un fragmento de gene, cebador, o sonda de menos de 1 kb o menos de 0.1 kb.

III. ÁCIDOS NUCLEICOS

A) GENERALMENTE

La presente memoria de patente describe ácidos nucleicos aislados o recombinantes teniendo una secuencia de un polinucleótido codificando una proteína de la subunidad catalítica de telomerasa (TRT) , como un gene de TRT recombinante de Euplotes, Tetrahymena, S. pombe o humanos. Se proporcionan polinucleótidos ejemplares en la Figura 13 (Euplotes) ; Figura 15 (S. pombe) y Figura 16 (humanos, Número de Acceso de GenBank AF015950) . Polinucleótidos con sentido y antisentido teniendo una secuencia de genes de TRT, incluyendo sondas, cebadores, polinucleótidos que codifican la proteína de TRT y similares, están comprendidos en el alcance de la presente memoria de patente.

B) TRT HUMANA

La presente invención proporciona ácidos nucleicos teniendo una secuencia de una subunidad catalítica de telomerasa de humanos (es decir, hTRT) .

En un aspecto, la invención proporciona un polinucleótido que tiene una secuencia o subsecuencia de genes de TRT humana o RNA. En una realización, el polinucleótido de la invención tiene una secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1 mostrada en la Figura 16 o una subsecuencia de la misma. En otra realización, el polinucleótido tiene una secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 3 (Figura 18) , NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 4 (Figura 20) , o subsecuencias de la misma. Se describen polinucleótidos con identidad de secuencia substancial a las secuencias de ácido nucleico de hTRT reveladas en elpresente, por ejemplo, incluyendo, pero no limitado a NÚMEROS DE IDENTIFICACIÓN DE SECUENCIA: 1 [Figura 16], 4 [Figura 20], 6 [Figura 21] y 7) . La invención proporciona alelos de genes de TRT humana y secuencias de polinucleótidos de variantes teniendo una o más anulaciones, inserciones o substituciones de nucleótidos relativas a una secuencia de ácidos nucleicos de hTRT revelada en el presente. Como se describe abajo, pueden producirse ácidos nucleicos de variantes usando los métodos recombinantes o sintéticos descritos más adelante o por otros medios.

Aunque no forman parte de la presente invención, la memoria de patente describe polinucleótidos aislados y recombinantes teniendo una secuencia de una región flanqueante de un gene de TRT humana. Estos polinucleótidos incluyen aquellos derivados de secuencias genómicas de regiones no traducidas del mRNA dehTRT. Se muestra una secuencia genómica ejemplar en la Figura 21 (NÚMERO DE IDENTIFICACIÓN DESECUENCIA: 6) . Como se describe en el Ejemplo 4, NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 6 se obtuvo clasificando un clon, AG<5 aislado de una biblioteca genómica humana. Lambda G<5 contiene un inserto de 15 "kilobasepairs" (kbp) incluyendo aproximadamente 13, 000 bases 5' a las secuencias que codifican la hTRT. Este clon contiene secuencias de promotor de hTRT y otras secuencias de regulación de genes de hTRT (por ejemplo, intensificadores) .

Aunque no forman parte de la presente invención, la memoria de patente describe polinucleótidos aislados y recombinantes teniendo una secuencia de una región intrónica de un gene de TRT humana. En la Figura 21 semuestra una secuencia intrónica ejemplar (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 7; vea el Ejemplo 3) . Los intrones de hTRT pueden estar incluidos en "minigenes" para expresión mejorada de las proteínas de hTRT en células eucarióticas.

En un aspecto relacionado, la presente invención proporciona polinucleótidos que codifican proteínas o fragmentos de proteína de hTRT, incluyendo polipéptidos modificados, alterados y variantes de hTRT. En una realización, la proteína de hTRT codificada o fragmento tiene una secuencia de aminoácidos como se establece en la Figura 17 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) , o con substituciones conservadoras de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2. En una realización, la proteína de TRT codificada o fragmento tiene substituciones que cambian una actividad de la proteína (por ejemplo, actividad catalítica de telomerasa) .

Se apreciará que, como resultado de la degeneración del códigogenético, el ácido nucleico codificando la proteína de hTRT no necesita tener la secuencia de un gene de hTRT que ocurre naturalmente, pero que una multitud depolinucleótidos puede codificar un polipéptido de hTRT teniendo una secuencia de aminoácidos de NÚMERO DEIDENTIFICACIÓN DE SECUENCIA: 2. La presente invención proporciona todas y cada una de las posibles variaciones de secuencia de nucleótidos que pudieron hacerse seleccionando combinaciones basadas en posibles elecciones de codón hechas en conformidad con códigos genéticos triples conocidos y todas estas variaciones se revelan específicamente por medio del presente. Por lo tanto, aunque en algunos casos se prefieren las secuencias de nucleótidos que codifican polipéptidos de hTRT las cuales son capaces de hibridar a la secuencia de nucleótidos de la secuencia que ocurre naturalmente (bajo condiciones de rigor debidamente seleccionadas) . Puede ser conveniente en otros casos producir secuencias de nucleótidos codificando hTRT que emplean un uso de codón substancialmente diferente y por lo tanto quizás no se hibridan a ácidos nucleicos con la secuencia que ocurre naturalmente.

En realizaciones particulares, la invención proporciona oligonucleótidos y polinucleótidos que comprenden una subsecuencia de un ácido nucleico de hTRT revelado en el presente (por ejemplo, NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1) . Los ácidos nucleicos útiles en la invención normalmente comprenden por lo menos alrededor de 10, más a menudo por lo menos alrededor de 12 ó 15 bases consecutivas del polinucleótido de hTRT ejemplificado. Con frecuencia, los ácidos nucleicos comprenderán una secuencia más larga, como por lo menos alrededor de 25, alrededor de 50, alrededor de 100, alrededor de 200, o por lo menos alrededor de 500 a 3000 bases de longitud, por ejemplo cuando se desea la expresión de un polipéptido, o proteína de hTRT de tamaño natural.

Los polinucleótidos "L182 hTRT" teniendo una secuencia idéntica o complementaria a polinucleótidos que ocurrende manera natural o que no ocurren naturalmente como NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 3 o NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 4, los cuales no contienen la secuencia de nucleótidos 182 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 9 [Figura 24]) encontrada en pGRN121 (y también ausente en el clon 712562) son de interés. Estos polinucleótidos son de interés, en parte, ya que codifican polipéptidos que contienen combinaciones o arreglos de los motivos de TRT distintos a los encontrados en el polipéptido de hTRT "detamaño natural" (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) como se codifica por pGRN121. Como se discute abajo, se contempla que estos polipéptidos pueden desempeñar un papel biológico por naturaleza (por ejemplo, en la regulación de la expresión de telomerasa en las células) y/o usarse como terapéuticos (por ejemplo, como productos negativos dominantes que inhiben la función de las proteínas tipo silvestre) , o tener otros papeles y usos, por ejemplo, como se describe en el presente.

Por ejemplo, en contraste con el polipéptido codificado por pGRN121, el clon 712562 codifica una proteína de 259 residuos con un peso molecular calculado de aproximadamente 30 kD (en lo sucesivo, "hTRT 712562") . El polipéptido de hTRT 712562 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 10 [Figura 19]) contiene motivos T, 1, 2 y A, pero no motivos B', C, D y E (Vea la Figura 4) . Del mismo modo, un polipéptido de hTRT de variante con actividades terapéuticas y otras puede expresarse de un ácido nucleico similar al cDNA de pGRN121 pero que carece de los 182 pares de bases 182 que faltan en el clon 712562, por ejemplo, teniendo la secuencia mostrada enla Figura 20 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 4) . Este ácido nucleico (en lo sucesivo, "hTRT pro90") , el cual puede sintetizarse usando métodos sintéticos o recombinantes de rutina como se describe en el presente, codifica una proteína de 807 residuos (peso molecular calculado de aproximadamente 90 kD) que comparte la misma secuencia terminal de aminos que la proteína de hTRT codificada por NÚMERO DEIDENTIFICACIÓN DE SECUENCIA: 1, pero se desvía en la región terminal de carboxi (los primeros 763 residuos son comunes, los últimos 44 residuos de hTRT pro90 son distintos a la hTRT "de tamaño natural") . El polipéptido de hTRT pro90 contiene motivos T, 1, 2 y A, pero no motivos B, C, D, E y de esta manera puede tener algunas actividades de telomerasa, pero probablemente no todas.

C) PRODUCCIÓN DE ÁCIDOS NUCLEICOS DE TRT HUMANA

Los polinucleótidos de la invención tienen diversos usos incluyendo, pero no limitados a, la expresión de polipéptidos que codifican hTRT o fragmentos de la misma, uso como sondas con sentido o antisentido iniciadores para hibridación y/o amplificación de genes de hTRT que ocurren naturalmente o RNAs (por ejemplo, para aplicaciones de diagnóstico o pronóstico) y como agentes terapéuticos (por ejemplo, en composiciones antisentido, triplex, o ribosómicas) . Como será aparente al revisar la revelación, estos usos tendrán un enorme impacto en el diagnóstico y tratamiento de enfermedades humanas referentes al envejecimiento, cáncer y fertilidad, así como el crecimiento, reproducción y fabricación de productos basados en células. Como se describe en las siguientes secciones, los ácidos nucleicos de hTRT de la invención pueden hacerse (por ejemplo, clonados, sintetizados, o amplificados) usando técnicas bien conocidas en el arte.

1) CLONACIÓN, AMPLIFICACIÓN Y PRODUCCIÓN RECOMBINANTE

Los genes de hTRT o cDNAs pueden ser clonados usando una sonda de ácido nucleico que específicamente se hibrida a un mRNA de hTRT, cDNA, o DNA genómico. Una sonda adecuada para este propósito es un polinucleótidoque tiene todo o una parte de la secuencia proporcionada en la Figura 16 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1) , como una sonda comprendiendo una subsecuencia de la misma. Normalmente, el DNA genómico de hTRT de objetivo o cDNA está ligado a un vector (por ejemplo, un plásmido, fase, virus, cromosoma artificial de levadura, o similares) y puede aislarse de una biblioteca genómica o de cDNA (por ejemplo, una biblioteca de cDNA de placenta humana) . Una vez que se identifica un ácido nucleico de hTRT, puede aislarse de acuerdo con los métodos estándar conocidos por aquellas personas expertas en el arte. En el Ejemplo se proporciona un ejemplo ilustrativo de selección de una biblioteca de cDNA humano para el gen de hTRT; del mismo modo, en los Ejemplos 3

y 4 se encuentra un ejemplo de selección de una biblioteca genómica humana. Los métodos de clonación son bien conocidos y se describen, por ejemplo, en Sambrook y otros, (1989) MOLECULAR CLONING: A LABORATORY MANUAL (CLONACIÓN MOLECULAR: UN MANUAL DE LABORATORIO) , SEGUNDA EDICIÓN, VOLÚMENES 1-3, Cold Spring Harbor Laborator y en lo sucesivo, "Sambrook") ; Berger y Kimmel (1987) , METHODS IN ENZYMOLOGY (MÉTODOS EN ENZIMOLOGÍA) , VOLUMEN 152: GUIDE TO MOLECULAR CLONING TECHNIQUES (GUÍA DETÉCNICAS DE CLONACIÓN MOLECULAR) , San Diego: Academic Press, Inc.; Ausubel y otros, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (PROTOCOLOS ACTUALES EN LA BIOLOGÍA MOLECULAR) , Greene Publishing y Wiley-Interscience, New York (1997) ; Cashion y otros, Patente de los Estados Unidos Número 5, 017, 478; y Carr, Patente Europea Número 0, 246, 864.

La invención también proporciona ácidos nucleicos de cDNA o genómicos de hTRT aislados por métodos de amplificación como reacción en cadena de polimerasa (PCR) . En una realización, la secuencia de codificación de la proteína de hTRT es amplificada de una muestra de ARN o cDNA (por ejemplo, cDNA de placenta de doble filamento) (Clontech, Palo Alto CA) ) usando los iniciadores 5'-GTGAAGGCACTGTTCAGCG-3' ("TCP1.1") y 5'-CGCGTGGGTGAGGTGAGGTG-3 ("TCP 1.15") . Puede usarse un tercer iniciador o segundo par de iniciadores, por ejemplo, para "PCR agrupado", a fin de aumentar la especificidad. Un ejemplo de un segundo par de iniciadores es 5'-CTGTGCTGGGCCTGGACGATA-3' ("billTCP6") y 5'-AGCTTGTTCTCCATGTCGCCGTAG-3' ("TCP1.14") . Será aparente para los expertos que otros muchos iniciadores y combinaciones de iniciadores, útiles para la amplificación de ácidos nucleicos de hTRT, pueden emplearse.

Pueden emplearse los iniciadores que amplifican cualquier región específica (por ejemplo, regiones de codificación, regiones de promotores y/o intrones) o subsecuencia de DNA genómico de hTRT, cDNA o RNA. Por ejemplo, elintrón de hTRT en la posición 274/275 de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1 (vea el Ejemplo 3) puede amplificarse (por ejemplo, para la detección de clones genómicos) usando iniciadores TCP1.57 y TCP1.52 (par 1 de iniciadores) o iniciadores TCP1.49 y TCP1.50 (par 2 de iniciadores) . (Los nombres de iniciadores se refieren a los iniciadores incluidos en el Cuadro 2, abajo) . Los pares de iniciadores pueden usarse individualmente o en un PCR agrupado donde el conjunto 1 de iniciadores se usa por primera vez. Otro ejemplo ilustrativo se refiere a iniciadores que amplifican específicamente y por lo tanto detectan el extremo 5' de mRNA de hTRT o el exón codificando el extremo 5' del gene de hTRT (por ejemplo, para valorar el tamaño o estado completo de un clon de cDNA) . Los siguientes pares de iniciadores son útiles para amplificar el extremo 5' de hTRT: iniciadores K320 y K321 (par 3 de iniciadores) ; iniciadores K320 y TCP1.61 (par 4 de iniciadores) ; iniciadores K320 y K322 (par 5 de iniciadores) . Los conjuntos de iniciadores pueden usarse en un PCR agrupado en el orden conjunto 5, después conjunto 4 o conjunto 3, o conjunto 4 o conjunto 5, después conjunto 3. Otro ejemplo ilustrativo implica iniciadores escogidos para amplificar o detectar específicamente la región de motivo conservado de TRT de hTRT comprendiendo aproximadamente el tercio medio de mRNA (por ejemplo, para uso como una sonda de hibridación para identificar clones de TRT de, por ejemplo, organismos no humanos) . Los siguientes pares de iniciadores son útiles para amplificar la región de motivos de TRT de ácidos nucleicos de hTRT: iniciadores K304 y TCP1.8 (par 6 de iniciadores) , o iniciadores LT1 y TCP1.15 (par 7 de iniciadores) . Los conjuntos de iniciadores pueden usarse en un experimento de PCR agrupado en el orden conjunto 6 después conjunto 7.

Las condiciones adecuadas de la amplificación de PCR son conocidas por los expertos e incluyen (pero no están limitadas a) 1 unidad Taq polimerasa (Perkin Elmer, Norwalk CT) , 100 !M cada dNTP (dATP, dCTP, dGTP, dTTP) , 1x PCR amortiguador (50 mM KCl, 10 mM Tris, pH 8.3 a temperatura ambiente, 1.5 mM MgCl2, 0.01% gelatina) y 0.5 !M iniciadores, con el período de amplificación por alrededor de 30 ciclos a 94° durante 45 segundos, 55° durante 45 segundos y 72° durante 90 segundos. Los expertos en el arte reconocerán que otras polimerasas de DNA termoestables, las condiciones de reacción y los parámetros de ciclización también proporcionarán amplificación adecuada. Otros métodos de amplificación in vitro adecuados que pueden usarse para obtener ácidos nucleicos de hTRT incluyen, pero no están limitados a, aquellos en el presente, como se describe abajo. Una vez amplificados, los ácidos nucleicos de hTRT pueden clonarse, si se desea, en alguna variedad de vectores usando métodos biológicos moleculares de rutina o detectarse o de otra manera utilizarse en conformidad con los métodos de la invención.

Un experto apreciará que los ácidos nucleicos de hTRT clonados o amplificados obtenidos como se describe antes pueden prepararse o propagarse usando otros métodos, como síntesis química o replicación por transformación en sistemas bacterianos, como E. coli (vea, por ejemplo, Ausubel y otros, arriba) , o sistemas de expresión eucariótica, como mamíferos. Del mismo modo, el ARN de hTRT puede expresarse en conformidad con los métodos presentes in vitro, o en sistemas bacterianos como E. coli usando, por ejemplo, vectores disponibles en el mercado conteniendo promotores reconocidos por una polimerasa de ARN como T7, T3 o SP6, o transcripción de DNA generado por amplificación de PCR usando iniciadores que contienen un promotor de polimerasa de RNA.

La presente invención además proporciona ácidos nucleicos de hTRT alterados o modificados. Un experto reconocerá que los ácidos nucleicos de hTRT clonados o amplificados obtenidos pueden modificarse (por ejemplo, truncarse, derivarse, alterarse) por métodos bien conocidos en el arte (por ejemplo, mutagénesis dirigida al sitio, mutagénesis por rastreo ligador) o simplemente sintetizarse de nuevo como se describe más adelante. Los ácidos nucleicos de hTRT alterados o modificados son útiles para una variedad de aplicaciones, incluyendo, pero no limitadas a, facilitar la clonación o manipulación de un gene o producto génico de hTRT, o expresar un producto génico de hTRT de variante. Por ejemplo, en una realización, previa retención de actividad catalítica la secuencia de genes de hTRT es alterada de tal manera que codifica un polipéptido de hTRT con propiedades o actividades alteradas, como se discute detalladamente abajo, por ejemplo, por mutación en un motivo conservado de hTRT. En otro ejemplo ilustrativo, las mutaciones en la región que codifica la proteína de un ácido nucleico de hTRT pueden introducirse para alterar los patrones de glicosilación, cambiar la preferencia de codón, producir variantes por empalmes, eliminar sitios sensibles a la proteasa, crear dominios antigénicos, modificar la actividad específica y similares. En otras realizaciones, la secuencia de nucleótidos que codifica la hTRT y sus derivados es cambiada sin alterar las secuencias de aminoácidos codificadas, por ejemplo, la producción de transcripciones de ARN teniendo propiedades más convenientes, como mayor eficiencia de traducción o una vida media más larga o más corta, en comparación con las transcripciones producidas de la secuencia que ocurre de manera natural. En otra realización, los codones alterados son seleccionados para aumentar la velocidad a la cual la expresión del péptido ocurre en un huésped de expresión procariótica o eucariótica particular en conformidad con la frecuencia con la cual los codones particulares son utilizados por el huésped. Las útiles técnicas recombinantes in vitro e in vivo que pueden usarse para preparar polinucleótidos de hTRT de variante de la invención se encuentran en Sambrook y otros y Ausubel y otros, ambos arriba.

Los ácidos nucleicos que tienen secuencias flanqueantes (5' ó 3') e intrónicas del gene de hTRT son de interés, entre otras cosas, debido a que contienen promotor y otros elementos de regulación involucrados en la regulación de hTRT y útiles para la expresión de proteínas de hTRT y otras proteínas recombinantes o productos génicos deRNA. Será aparente que, además de las secuencias de ácido nucleico proporcionadas en NÚMEROS DEIDENTIFICACIÓN DE SECUENCIA: 6 y 7, pueden obtenerse fácilmente secuencias intrónicas y flanqueantes de hTRT adicionales usando técnicas biológicas moleculares de rutina. Por ejemplo, la secuencia genómica de hTRT adicional puede obtenerse del clon Lambda G<5 (Número de Acceso de ATCC 209024) , descrito arriba y en el Ejemplo 4. Pueden obtenerse otros clones y secuencias genómicos de hTRT seleccionando una biblioteca genómicahumana usando una sonda de ácido nucleico de hTRT que tiene una secuencia o subsecuencia de NÚMERO DEIDENTIFICACIÓN DE SECUENCIA: 1. Pueden obtenerse clones y secuencias adicionales (por ejemplo, corriente arriba) usando secuencias o subclones etiquetados derivados de AG<5 para sondar bibliotecas adecuadas. Otros métodos útiles para mayor caracterización de secuencias flanqueantes de hTRT incluyen aquellos métodos generales descritos por Gobinda y otros, 1993, PCR Meth. Applic. 2:318; Triglia y otros, 1988, Nucleic Acids Res. 16:8186; Lagerstrom y otros, 1991, PCR Methods Applic. 1:111; y Parker y otros, 1991, Nucleic Acids Res. 19:3055.

Las secuencias intrónicas pueden identificarse por medios de rutina como comparando la secuencia genómica de hTRT con secuencias de cDNA de hTRT (vea, por ejemplo, Ejemplo 3) , por análisis S1 (vea Ausubel y otros, arriba, en el Capítulo 4) , o varios otros medios conocidos en el arte. Las secuencias intrónicas también pueden encontrarse en pre-mRNA (es decir, precursores de mRNA no empalmados o empalmados incompletamente) , las cuales pueden amplificarse o clonarse después de la transcripción inversa de ARN celular.

Cuando se desee, la secuencia de la hTRT u otro ácido nucleico de TRT clonado, amplificado, o de otra manera sintetizado puede determinarse o verificarse usando métodos de clasificación de secuencias de DNA bien conocidos en el arte (vea, por ejemplo, Ausubel y otros, arriba) . Los métodos útiles de clasificación de secuencias emplean estas enzimas como el fragmento de Klenow de DNA polimerasa I, Sequenase (US Biochemical Corp., Cleveland, OH) , Taq DNA polimerasa (Perkin Elmer, Norwalk CT) , polimerasa T7 termoestable (Amersham, Chicago, IL) , o combinaciones de polimerasas recombinantes y exonucleasas de cotejo como el Sistema de Amplificación ELONGASE vendido por Gibco BRL (Gaithersburg, MD) . Cuando se clasifica o se verifica la secuencia de los oligonucleótidos (como oligonucleótido hecho de nuevo por síntesis química) , el método de Maxam y Gilbert, 1980, Meth. Enz. 65:499; Ausubel y otros, arriba, Capítulo 7) .

Las secuencias no traducidas de 5' de hTRT u otros mRNAs de TRT pueden determinarse directamente clonando un hTRT de "tamaño natural" u otro cDNA usando métodos estándar como transcripción inversa de mRNA, seguida por la clonación y clasificación de secuencia del cDNA resultante. Pueden preferirse las bibliotecas de iniciadores oligo (dT) para seleccionar o amplificar los cDNAs de tamaño natural que han sido seleccionados por tamaño para incluir cDNAs más grandes. Las bibliotecas iniciadores aleatorios también son adecuadas y a menudo incluyen una proporción más grande de clones que contienen las regiones 5' de genes. También pueden usarse otros métodos muy conocidos para obtener secuencias de ARN de 5', como el protocolo RACE descrito por Frohman y otros, 1988, Proc. Nat. Acad. Sci. USA 85:8998. Si se desea, el sitio de inicio de transcripción de una hTRT u otro mRNA de hTRT puede determinarse por métodos de rutina usando los ácidos nucleicos proporcionados en el presente (porejemplo, teniendo una secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1) . Un método es el análisis de nucleasa S1 (Ausubel y otros, arriba, usando un DNA etiquetado que tiene una secuencia de la región de 5' de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1.

2) SÍNTESIS QUÍMICA DE ÁCIDOS NUCLEICOS

La presente invención también proporciona polinucleótidos de hTRT (RNA, DNA o modificados) que son producidos por síntesis química directa. Generalmente se prefiere la síntesis química para la producción de oligonucleótidos o para oligonucleótidos y polinucleótidos conteniendo nucleótidos no estándar (por ejemplo, sondas, iniciadores y oligonucleótidos antisentido) . La síntesis química directa de ácidos nucleicos puede realizarse mediante métodos conocidos en el arte, como el método del fosfotriéster de Narang y otros, 1979, Meth. Enzymol. 68:90; el método fosfodiéster de Brown y otros, Meth. Enzymol. 68:109 (1979) ; el método del dietilfosforamidita de Beaucage y otros, Tetra. Lett., 22:1859 (1981) ; y el método de soporte sólido de la Patente de los Estados Unidos Número 4, 458, 066. La síntesis química normalmente produce un oligonucleótido de un solo filamento, el cual puede convertirse en DNA de doble filamento por hibridación con una secuencia complementaria, o por polimerización con un DNA polimerasa y un iniciador de oligonucleótido usando el único filamento como un molde. Un experto reconocerá que mientras que la síntesis química de DNA a menudo está limitada a las secuencias de alrededor de 100 ó 150 bases, pueden obtenerse secuencias más largas mediante la ligación de secuencias más cortas o mediante métodos sintéticos más elaborados.

Se apreciará que los polinucleótidos y oligonucleótidos de hTRT de la invención pueden usarse usando bases no estándar (por ejemplo, distintas a la adenina, citidina, guanina, timina y uridina) o estructuras de columna vertebral no estándar para proporcionar propiedades convenientes (por ejemplo, resistencia a la nucleasa, fijación más apretada, estabilidad o un TM deseado) . Las técnicas para volver los oligonucleótidos resistentes a la nucleasa incluyen aquellas descritas en la publicación PCT WO 94/12633. Puede producirse una amplia variedad de útiles oligonucleótidos modificados, incluyendo oligonucleótidos que tienen una columna vertebral de péptido y ácido nucleico (PNA) (Nielsen y otros, 1991, Science 254:1497) o incorporando ribonucleótidos de 2'-O-metilo, nucleótidos de fosforotioato, nucleótidos de fosfonato de metilo, nucleótidos de fosfotriéster, nucleótidos de fosforotioato, fosforamidatos. Otros útiles oligonucleótidos pueden contener mitades de alquilo y azúcar substituidas de halógeno comprendiendo uno de los siguientes en la posición 2': OH, SH, SCH3, F, OCN, OCH3OCH3, OCH3O (CH2) nCH3, O (CH2) nNH2 o O (CH2) nCH3 donde n es de 1 a 10; alquilo inferior C1 a C10, alquilo inferior substituido, alcarilo o aralquilo; Cl; Br; CN; CF3; OCF3; O-, S-, o N-alquilo; O-, S-, o N-alquenilo; SOCH3; SO2CH3; ONO2; NO2; N3; NH2; heterocicloalquilo; heterocicloalcarilo; aminoalquilamino; polialquilamino; sililo substituido; un grupo de disociación de RNA; un grupo colesterilo; un grupo folato; un grupo reportero; un intercalador; un grupo para mejorar las propiedades farmacocinéticas de un oligonucleótido; o un grupo para mejorar las propiedades farmacodinámicas de un oligonucleótido y otros substituyentes que tienen propiedades similares. Los grupos folato, colesterol y otros que facilitan la absorción de los oligonucleótidos, como análogos de lípidos, pueden conjugarse directamente o a través de un ligador en la posición 2' de cualquier nucleósido o en la posición 3' o 5' del nucleósido terminal 3' o terminal 5', respectivamente. Uno o más de estos conjugados pueden usarse. Los oligonucleótidos también pueden tener mimetismo a los azúcares como ciclobutilos en lugar del grupo pentofuranosilo. Otras realizaciones pueden incluir por lo menos una forma base modificada o "base universal" como inosina, o inclusión de otras bases no estándar como queosina y wibutosina, así como formas de acetil, metil, tio y similarmente modificadas de adenina, citidina, guanina, timina y uridina las cuales no son tan fácilmente reconocidas por endonucleasas endógenas. La invención además proporciona oligonucleótidos que tienen análogos de columna vertebral como fosforamidato, fosforotioato, fosforoditioato, metilfosfonato, fosforamidato, fosfotriéster de alquilo, sulfamato, 3'-tioacetal, metileno (metilimino) , 3'N-carbamato, carbamato de morfolino, fosfonatos de quiral-metilo, nucleótidos con ligamientos entre azúcares de alquilo o cicloalquilo de cadena corta, ligamientos entre azúcares ("columna vertebral") heteroatómicos o heterocíclicos de cadena corta, o columnas vertebrales de CH2-NH-O-CH2, CH2-N (CH3) -OCH2, CH2-O-N (CH3) -CH2, CH2-N (CH3) -N (CH3) -CH2 y O-N (CH3) -CH2-CH2 (donde el fosfodiéster es O-P-O-CH2=, o mezclas de los mismos. También son útiles los oligonucleótidos que tienen estructuras de columna vertebral de morfolino (Patente de los Estados Unidos Número 5, 034, 506.

Las referencias útiles incluyen Oligonucleótidos y Análogos, un Procedimiento Práctico, editado por F. Eckstein, IRL Press en Oxford University Press (1991) ; Estrategias de Antisentido, Anales de la Academia de Ciencias de Nueva York, Volumen 600, Eds. Baserga y Denhardt (NYAS 1992) ; Milligan y otros, 9 de julio de 1993, J. Med. Chem. 36 (14) :1923-1937; Investigación y Aplicaciones de Antisentido (1993, CRC Press) , en su totalidad y específicamente Capítulo 15, por Sanghvi, titulada "Modificaciones de base heterocíclica en ácidos nucleicos y sus aplicaciones en oligonucleótidos antisentido", Terapéuticos de Antisentido, ed. Sudhir Agrawal (Humana Press, Totowa, New Jersey, 1996) .

D) ETIQUETANDO ÁCIDOS NUCLEICOS

A menudo es útil etiquetar los ácidos nucleicos de la invención, por ejemplo, cuando los oligonucleótidos o polinucleótido de hTRT u otros deben usarse como sondas de ácido nucleico. Las etiquetas (vea abajo) pueden incorporarse por diversos medios muy conocidos por los expertos en el arte. En una realización, un ácido nucleico no amplificado (por ejemplo, mRNA, poliA m RNA, cDNA) es etiquetado. Los medios para producir ácidos nucleicos etiquetados son bien conocidos por los expertos en el arte e incluyen, por ejemplo, traducción del níquel, etiquetado de iniciadores aleatorios, etiquetado de extremo (por ejemplo, usando una cinasa) y conjugación o síntesis química (por ejemplo, fotobiotinilación) . En otra realización, la etiqueta se incorpora simultáneamente durante un paso de amplificación en la preparación de los ácidos nucleicos de muestra. De esta manera, por ejemplo, la reacción en cadena de la polimerasa (PCR) u otro método de amplificación de ácidos nucleicos con iniciadores etiquetados o nucleótidos etiquetados proporcionará un producto de amplificación etiquetado. En otra realización, la amplificación de transcripción usando un nucleótido etiquetado (por ejemplo, UTP etiquetado con fluoresceína y/o CTP) incorpora una etiqueta a los ácidos nucleicos transcritos. Un producto de amplificación puede también, o alternativamente, etiquetarse después de terminar la amplificación.

E) OLIGONUCLEÓTIDOS ILUSTRATIVOS

Como se indica arriba y como se discute detalladamente abajo, los oligonucleótidos son usados para una variedad de usos incluyendo como iniciadores, sondas, oligonucleótidos terapéuticos y otros oligonucleótidos antisentido, oligonucleótidos triplex y muchos otros usos como es aparente de esta revelación. El Cuadro 2 proporciona ciertos oligonucleótidos específicos ilustrativos que pueden usarse en la práctica de la invención. Se apreciará que muchos otros oligonucleótidos útiles para su utilización en la invención pueden ser sintetizados por un experto, después de la orientación proporcionada en el presente.

En el Cuadro 2, "sec" significa que el iniciador ha sido usado, o es útil, para secuenciar; "PCR" significa que el iniciador ha sido usado, o es útil, para PCR; "AS" significa que el iniciador ha sido usado, o es útil para inhibición de antisentido de la actividad de telomerasa; "CL" significa que el iniciador ha sido usado, o es útil en la clonación de regiones de genes de hTRT o RNA, "mut" significa que el iniciador ha sido usado, o es útil para construir mutantes de genes o productos génicos de hTRT. "UC" significa "letra mayúscula" y "lc" significa "letra minúscula". Los

apareamientos erróneos y las inserciones (en relación con NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1) se indican subrayando; las supresiones se indican con un "-". Se apreciará que nada de lo contenido en el Cuadro 2 es para limitar el uso de algún oligonucleótido en particular a un solo uso o serie de usos.

CUADRO 2OLIGONUCLEÓTIDOS ÚTILES

USE Iniciador 5'-secuencia-3' Notas ápareamientoSec PCR AS CL MUT

erróneo? * TCP1.1 GTGAAGGCACTGTTCAGCG X X TCP1.2 GTGGATGATTTCTTGTTGG X X TCP1.4 CTGGACACTCAGCCCTTGG X X TCP1.5 GGCAGGTGTGCTGGACACT X X TCP1.6 TTTGATGATGCTGGCGATG X X TCP1.7 GGGGCTCGTCTTCTACAGG Y X X TCPI.8 CAGCAGGAGGATCTTGTAG X X TCP1.9 TGACCCCAGGAGTGGCACG X X

TCP1.10 TCAAGCTGACTCGACACCG X X TCP1.11 CGGCGTGACAGGGCTGC X X TCP1.12 GCTGAAGGCTGAGTGTCC X X TCP1.13 TAGTCCATGTTCACAATCG X X TCP1.14 CTGTGCTGGGCCTGGACGATA X X TCP1.15 CGCGTGGGTGAGGTGAGGTG X X TCP1.16 TTTCCGTGTTGAGTGTTTC X X TCP1.17 GTCACCGTGTTGGGCAGG X X TCP1.19 GCTACCTGCCCAACACGG X X TCP1.20 GCGCGAAGAACGTGCTGG X X TCPI.21 CA-CTGCTCCTTGTCGCCTG Y X X TCP1.22 TTCCCAAGGACTTTGTTGC X X TCPI.24 TGTTCCTCAAGACGCACTG Y X X TCPI.25 TACTGCGTGCGTCGGTATG X X TCP1.26 GGTCTTGCGGCTGAAGTGT X X TCP1.27 TGGTTCACCTGCTGGCACG X X TCP1.28 GTGGTTTCTGTGTGGTGTC X X TCP1.29 GACACCACACAGAAACCAC X X TCP1.30 GTGCCAGCAGGTGAACCAG X X

TCP1.32B GCAGTGCGTCTTGAGGAGC X X TCP1.33 TGGAACCATAGCGTCAGGGAG X X TCP1.34 GGCCTCCCTGACGCTATGGTT X X TCP1.35 GC (GT) CGGCGCTGCCACTCAGG X X TCP1.35t GCTCGGCGCTGCCACTCAGG TCP1.36 ACGCCGAGACCAAGCACTTC X X CUADRO 2 (cont.)

TCP1.38 CCAAAGAGGTGGCTTCTTCG X X TCP1.39 AAGGCCAGCACGTTCTTCGC X X TCP1.40 CACGTTCGTGCGGCGCCTG X X TCP1.41 CCTTCACCACCAGCGTGCG X X TCP1.42 GGCGACGACGTGCTGGTTC X X TCP1.43 GGCTCAGGGGCAGCGCCAC X X TCP1.44 CTGGCAGGTGTACGGCTTC X X TCP1.45 GCGTGGACCGAGTGACCGTGGTTTC X X TCP1.46 GACGTGGTGGCCGCGATGTGG X X TCP1.47 GAAGTCTGCCGTTGCCCAAGAG X X TCP1.48 GACACCACACAGAAACCACGGTCAC X X TCP1.49 CGCCCCCTCCTTCCGCCAGGT X X TCP1.50 CGAAGCCGAAGGCCAGCACGTTCTT X X TCP1.51 GGTGGCCCGAGTGCTGCAGAGG X X TCP1.52 GTAGCTGCGCACGCTGGTGGTGAAG X X TCP1.53 TGGGCGACGACGTGCTGGTTCA X X TCP1.54 TATGGTTCCAGGCCCGTTCGCATCC X X TCP1.55 CCAGCTGCGCCTACCAGGTGTGC X X TCP1.56 GGCCTCCCTGACGCTATGGTTCCAG X X TCP1.57 GGTGCTGCCGCTGGCCACGTTCG X X TCP1.58 TCCCAGGGCACGCACACCAGGCACT X X TCP1.59 GTACAGGGCACACCTTTGGTCACTC X X TCP1.60 TCGACGACGTACACACTCATCAGCC X X TCP1.61 AGCGGCAGCACCTCGCGGTAGTGGC X X TCP1.62 CCACCAGCTCCTTCAGGCAGGACAC X X TCP1.63 CCAGGGCTTCCCACGTGCGCAGCAG X X TCP1.64 CGCACGAACGTGGCCAGCGGCAGCA X X TCP1.65 TGACCGTGGTTTCTGTGTGGTGT X X TCP1.66 CCCTCTTCAAGTGCTGTCTGATTCC X X TCP1.67 ATCGCGGCCACCACGTCCCT X X TCP1.68 TGCTCCAGACACTCGGCCGGTAGAA X X TCP1.69 ACGAAGCCGTACACCTGCCX X TCP1.72 CGACATCCCTGCGTTCTTGGCTTTC X X TCP1.73 CACTGCTGGCCTCATTCAGGG X X TCP1.74 GCGACATGGAGAACAAGC X X TCP1.75 GCAGCCATACTCAGGGACAC X X TCP1.76 CCATCCTCTCCACGCTGCTC X X

CUADRO 2 (cont.)

TCP1.77 GCGATGACCTCCGTGAGCCTG X X

TCP1.78 CCCAGGACAGGCTCACGGA X X

billTCP1 CCTCTTCAAGTGCTGTCTGATTCC X X

billTCP2 CAGCTCGACGACGTACACACTCATC X X

billTCP4 CTGACGTCCAGACTCCGCTTCAT X X

billTCP6 AGCTTGTTCTCCATGTCGCCGTAG X X

rpprim01 GACCTGAGCAGCTCGACGACGTACACACTCATC X X

Lt1 GTCGTCGAGCTGCTCAGGTC X X

Lt2 AGCACGCTGAACAGTGCCTT X X

Lt3 GACCTGAGCAGCTCGACGAC X X

Lt4 AAGGCACTGTTCAGCGTGCT X X

Lt5 CGGCCGAGTGTCTGGAGCAA Y X X

Lt6 GGATGAAGCGGAGTCTGGA X X BamH1Lt7 ATGGATCCGTCGTCGAGCTGCTCAGGTCT Sitio BamH1 Y X X

Sal1Lt8 ATCAGCTGAGCACGCTGAACAGTGCCTTC Sitio Pvu II (no Sal I) Y X X

K303 GTCTCCGTGACATAAAAGAAAGAC X X

K304 GCCAAGTTCCTGCACTGGCT X X

K305 GCCTGTTCTTTTGAAACGTGGTCT X X

K306 XXGCCTGTTCTTTTGAAACGTGGTCT X = biotina, = K305 X X

K311 GTCAAGATGCCTGAGATAGAAC X X

K312 TGCTTAGCTTGTGGGGGTGTCA X X

K313 TGCTTAGCTTGTGGGGGTGTCA X X

K320 GCTGCGTCCTGCTGCGCACGT X X

K321 CAGCGGGGAGCGCGCGGCATC X X

K322 TGGGCCACCAGCGCGCGGAAA X X

slanti.1 CGGCCGCAGCCCGTCAGGCTTGGGG Y X X

slanti.2 CCGACAGCTCCCGCAGCTGCACCC Y X X

slanti.3 CGTACACACTCATCAGCCAGTGCAGGAACTTGGC X X

slanti.4 CGCGCCCGCTCGTAGTTGAGCACGCTGAACAGTGCCTTC X X

slanti.5 GCGGAGTCTGGACGTCAGCAGGGCGGGCCTGGCTTCCCG X X

UTR2 ATTTGACCCACAGGGACCCCCATCCAG X X

FW5 ATGACCGCCCTCCTCGTGAG X X

Nam1 GCCACCCCCGCGATGCC X X

Nam2 AGCCCTGGCCCCGGCCA X X

Nam3 TCCCACGTGCGCAGCAG X X

Nam4 AGCAGGACGCAGCGCTG X X

PE01 CGCGGTAGTGGCTGCGCAGCAGGGAGCGCACGGC X X

PE02

LM101

LM103

LM104

LM105

LM106

LM107

LM108

LM109

LM_FFYT

TCP061:

HUMO1:HUMO2:HUMO3:HUMO4:SLW F1NSLW F1CSLW F2NSLW F2C

CUADRO 2 (cont.)

CCAGGGCTTCCCACGTGCGCAGCAGGACGCAGCGC X X CTAGTCTAGATCA/GCTAGCGTAATCTGGAACATCGTATGSitio Xba I/rótulo HA /hTRTx GGTA/GTCCAGGATGGTCTTGAAGTC en pGRN121 TACCATGGGCTACCCATACGACGTTCCAGATTACGCTCA Se inserta a rótulo HA a un sitio Nde I en X extremo 5' de hTRT TATGAGCGTAATCTGGAACGTCGTATGGGTAGCCCATGG Recoce a LM103 X GTGTACGTCGTCGAGCTCCTCAGGTCTGCCTTTTATGTCCambio = F559A X ACGGAG (phe > ala) GTGTACGTCGTCGAGCTCCTCAGGTCTTTCGCTTATGTCCambio = F560A X ACGGAGACC (phe > ala) CCTCAGGTCTTTCTTTGCTGTCACGGAGACAACGTTTCAACambio = Y561A X AAGAACAG (tyr > ala) GGTCTTTCTTTTATGTCGCGGAGACAACGTTTCAAAAGAACambio = T563A X CAG (thr > ala) CTTTCTTTTATGTCACGGCGACAACGTTTCAAAAGAACA Cambio = E564A X ATGAGTGTGTACGTCGTCGAGCTCCTCAGGTCTACCACGSupresión de FFYVTE X

CAAAAGAACAGGCTCTTTTTC (aa 559-564) GGCTGATGAGTGTGTACGTCGTCGA Complemento para TCP1.61 X X ACGTGGTCTCCGTGACATAAAAGAA Para motivo DD, diseñado para recocer X X X

posiblemente a mTRTAGGTCTTTCTTTTATGTCACGGA Para motivo DD, diseñado para recocer X X X posiblemente a mTRTCACAGACCCCCGTCGCCTGGTC Diseñado para X X X recocer posiblemente a mTRTCGGAGTCTGGACGTCAGCAGGGC Diseñado para X X X recocer posiblemente a mTRTcgcggatccgtaactaaaATGCCGCGCGCTCCCPara construcción de fusión de GST (782 a 1636) X X CGCTGC UC = sec hTRT, lc = sitio de BamH1 + 2 codones de tope ccggaattcgttagttacttaCAAAGAGGTGGCTTPara construcción de fusión de GST (782 a 1636) X X CTTCGGC UC = sec hTRT, lc = sitio de EcoR I + 3 codones de tope SLW F1N/SLW F1C amplifican una pieza de 893 nt de pGRN121 (782 a 1636) cgcggatccgtaactaaaGCCACCTCTTTGGAGPara construcción de fusión de GST (1625 a 2458) X X GGTGCG UC = sec hTRT, lc = sitio de BamH1 + 2 codones de tope ccggaattcgttagttacttaAGACCTGAGCAGCTPara construcción de fusión de GST (1625 a 2458) X X CGACGAC UC = sec hTRT, lc = sitio de EcoR I + 3 codones de tope SLW F2N/SLW F2C amplifican una pieza de 872 nt de pGRN121 (1625 a 2458)

CUADRO 2 (cont.)

SLW F3N cgcggatccgtaactaaaATGAGTGTGTACGPara construcción de fusión de GST (2426 a 3274) X X TCGTCGAG UC = sec hTRT, lc = sitio de BamH1 + 2 codones de tope SLW F3C ccggaattcgttagttacttaGATCCCCTGGCAPara construcción de fusión de GST (2426 a 3274) X X CTGGACG UC = sec hTRT, lc = sitio de EcoR I + 3 codones de tope SLW F3N/SLW F3C amplifican una pieza de 887 nt de pGRN121 (2426 a 3274) SLW F4N cgcggatccgtaactaaaATCCCGCAGGGCPara construcción de fusión de GST (3272 a 4177) X X TCCATCCTC UC = sec hTRT, lc = sitio de BamH1 + 2 codones de tope SLW F4C ccggaattcgttagttacttaGTCCAGGATGGTPara construcción de fusión de GST (3272 a 4177) X X CTTGAAGTC UC = sec hTRT, lc = sitio de EcoR I + 3 codones de tope SLW F4N/SLW F4C amplifican una pieza de 944 nt de pGRN121 (3272 a 4177)

40. 60 GGCATCGCGGGGGTGGCCGGG fosforotioato X 260-280 GGACACCTGGCGGAAGGAGGG fosforotioato X 500-520 GCGTGCCAGCAGGTGAACCAG fosforotioato X 770-790 CTCAGGGGCAGCGCCACGCCT fosforotioato X 885-905 AGGTGGCTTCTTCGGCGGGTC fosforotioato X 1000-1020 GGACAAGGCGTGTCCCAGGGA fosforotioato X 1300-1320 GCTGGGGTGACCGCAGCTCGC fosforotioato X 1520-1540 GATGAACTTCTTGGTGTTCCT fosforotioato X 2110-2130 GTGCGCCAGGCCCTGTGGATA fosforotioato X 2295-2315 GCCCATGGGCGGCCTTCTGGA fosforotioato X 2450-2470 GAGGCCACTGCTGGCCTCATT fosforotioato X 2670-2690 GGGTGAGGTGAGGTGTCACCA fosforotioato X 3080-3110 GCTGCAGCACACATGCGTGAAACCTGTACfosforotioato X

GC 3140-3160 GACGCGCAGGAAAAATGTGGG fosforotioato X 3690-3710 CCGAGCGCCAGCCTGTGGGGA fosforotioato X

55. 75 CAGCGGGGAGCGCGCGGCATC fosforotioato X

151-171 CAGCACCTCGCGGTAGTGGCT fosforotioato X TP1.1 TCAAGCCAAACCTGAATCTGAG X TP1.2 CCCGAGTGAATCTTTCTACGC X TP1.3 GTCTCTGGCAGTTTCCTCATCCC X TP1.4 TTTAGGCATCCTCCCAAGCACA X

IV. PROTEÍNAS Y PÉPTIDOS DE TRT

A) GENERALMENTE

La invención puede comprender la utilización de una amplia variedad de proteínas de hTRT, siendo dichas proteínas útiles para, entre otras cosas, la producción de la actividad de telomerasa, la inhibición de la actividad de telomerasa en una célula, la inducción de una respuesta inmune anti-hTRT, como un reactivo terapéutico, como un estándar o control en un ensayo diagnóstico, como un objetivo en una criba para compuestos capaces de la activación o inhibición de una actividad de hTRT o telomerasa y muchos otros usos que serán aparentes para los expertos o de otra manera se describen en el presente. La hTRT de la invención incluye proteínas funcionalmente activas (útiles, por ejemplo, para conferir la actividad de telomerasa a una célula negativa de telomerasa) y variantes. Variantes inactivos pueden ser útiles, por ejemplo, para inhibir la actividad de telomerasa en una célula. Los polipéptidos hTRT y RNPs de telomerasa (por ejemplo, complejos de ribonucleoproteína comprendiendo las proteínas) pueden presentan una, varias o todas las actividades funcionales de la hTRT que ocurre naturalmente y telomerasa. A continuación estas se discute detalladamente, a título ilustrativo.

En una realización, la proteína de hTRT característica de las composiciones de la invención es un polipéptido quetiene una secuencia como se establece en la Figura 17 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) , o un fragmento de la misma. En otra realización, el polipéptido de hTRT difiere del NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2 por supresiones internas, inserciones, o substituciones conservadoras de los residuos de aminoácidos. En una realización relacionada, la invención comprende polipéptidos de hTRT con similitud substancialal NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2. La invención además comprende polipéptidos de hTRT que son modificados, en relación con la secuencia de aminoácidos del NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2, de alguna manera, por ejemplo, truncados, mutados, derivados, o fundidos a otras secuencias (por ejemplo, para formar una proteína de fusión) . Además, la presente invención proporciona RNPs de telomerasa comprendiendo una proteína de hTRT útil en la invención compuesta con un molde de ARN (por ejemplo, hTR) . En otras realizaciones, una o más proteínas asociadas con la telomerasa se asocia con la proteína de hTRT y/o hTR.

Otras especies de hTRT que ocurren naturalmente o variantes que ocurren de manera natural, comprendenproteínas que tienen la secuencia de, o similitud substancial a NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 5 [Figura 20], NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 10 [Figura 19] y fragmentos, variantes, o derivados de la misma.

Un ejemplo de una variante de hTRT puede resultar del desfase del ribosoma de mRNA codificado por el clon712562 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 3 [Figura 18]) o la hTRT de variante pro90 mostrada en el NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 4 [Figura 20] y por lo tanto ocasionar la síntesis de los polipéptidos de hTRT que contienen todos los motivos de TRT (para un ejemplo general, vea, por ejemplo, Tsuchihashi y otros, 1990, Proc. Natl. Acad. Sci. USA 87:2516; Craigengen y otros, 1987, Cell 50:1; Weiss, 1990, Cell 62:117) . El desfase del ribosoma puede ocurrir cuando las secuencias específicas de mRNA o estructuras secundarias ocasionan que el ribosoma "se atasque" y salte un nucleótido hacia adelante o hacia atrás en la secuencia. De esta manera, un suceso de desfase del ribosoma en el mRNA 712562 podría causar la síntesis de un polipéptido de aproximadamente 523 residuos de aminoácidos. Un suceso de desfase del ribosoma en la secuencia pro90 podría dar como resultado una proteína con aproximadamente 1071 residuos. Se apreciará que las proteínas resultantes del desfase del ribosoma también pueden expresarse mediante técnicas sintéticas o recombinantes.

Las proteínas de TRT humana, los péptidos y las proteínas funcionalmente equivalentes pueden obtenerse mediante purificación, síntesis química, o producción recombinante, como se discute con detalles más adelante.

B) ACTIVIDADES DE LA PROTEÍNA DE TRT

Los polipéptidos de TRT útiles en la invención (incluyendo fragmentos, variantes, productos de alelos alternativos y proteínas de fusión) tienen actividad catalítica y pueden tener una o más, o todas las otras actividades funcionales asociadas con la hTRT nativa. Excepto como se indica, como se usa en el presente, se considera que un polipéptido de hTRT o otro polipéptido de TRT tiene una actividad especificada si la actividad es presentada por la proteína de hTRT sin un ARN asociado (por ejemplo, hTR) o en un complejo de ARN (por ejemplo hTR) asociado con hTRT. La actividad de fijación de hTR de la hTRT es un ejemplo de una actividad asociada con la proteína de hTRT. Los métodos para producir complejos de ácidos nucleicos (por ejemplo, hTR) y los polipéptidos de hTRT de la invención se describen abajo.

La modificación de la proteína de hTRT (por ejemplo, por medios químicos o recombinantes, incluyendo la mutación

o la modificación de un polinucleótido codificando el polipéptido de hTRT o síntesis química de un polinucleótido que tiene una secuencia diferente a una secuencia de polinucleótido nativo) para tener un complemento de actividades diferente a hTRT nativa puede ser útil en aplicaciones terapéuticas o en la selección de moduladores específicos de hTRT o actividad de telomerasa. Además, los ensayos de varias actividades de hTRT pueden ser particularmente útiles para la identificación de agentes (por ejemplo, agentes de modulación de actividad) que interactúan con hTRT

o telomerasa para cambiar la actividad de telomerasa.

Las actividades de hTRT nativa, como se discute abajo, incluyen actividad catalítica de telomerasa (la cual puede ser actividad de procesamiento o no procesamiento) ; procesabilidad de telomerasa; actividad de transcriptasa inversa convencional; actividad nucleolítica; actividad de fijación de iniciador o substrato (telómero o substrato o iniciador de telomerasa sintética) ; actividad de fijación de dNTP; actividad de fijación de ARN (es decir, hTR) ; y actividad de fijación de proteínas (por ejemplo, fijación a proteínas asociadas con telomerasa, proteínas que se fijan al telómero, o a un complejo de DNA telomérico de proteínas) . Sin embargo, se entenderá que ciertos aspectos de la presente invención pueden utilizar composiciones de hTRT sin una actividad de hTRT en particular sino con una actividad útil relacionada con las proteínas de hTRT u otras proteínas de TRT (por ejemplo, ciertos péptidos inmunógenos normalmente cortos, péptidos inhibidores) .

1) ACTIVIDAD CATALÍTICA DE TELOMERASA

Como se usa en el presente, un polipéptido de la invención tiene "actividad catalítica de telomerasa", cuando el polipéptido es capaz de extender un iniciador de DNA que funciona como un substrato de telomerasa agregando una repetición parcial, una repetición o más de una repetición de una secuencia (por ejemplo, TTAGGG) codificada por un ácido nucleico de molde (por ejemplo, hTR) . Esta actividad puede ser de procesamiento o de no procesamiento. La actividad de procesamiento ocurre cuando un RNP de telomerasa agrega múltiples repeticiones a un iniciador o telomerasa antes de que el DNA sea liberado por el complejo de enzimas. La actividad de no procesamiento ocurre cuando la telomerasa agrega una repetición parcial, o sólo una repetición a un iniciador y después es liberada. Sin embargo, in vivo, una reacción de no procesamiento podría agregar múltiples repeticiones por ciclos sucesivos de asociación, extensión y disociación. Esto también puede ocurrir in vitro, pero no se observa normalmente en ensayos estándar debido al exceso molar sumamente grande de iniciador sobre la telomerasa en condiciones de ensayo estándar.

Para caracterizar un polipéptido de hTRT por tener actividad de no procesamiento, se realiza una reacción de telomerasa convencional usando condiciones que favorecen una reacción de no procesamiento, por ejemplo altas temperaturas (es decir, 35-40°C, normalmente 37°C) , bajas concentraciones de dGTP (1 !M o menos) , altas concentraciones de iniciador (5 !M o más altas) y altas concentraciones de dATP/TTP (2 mM o más altas) , con la temperatura y dGTP normalmente teniendo el efecto más grande. Para caracterizar un polipéptido de hTRT por tener actividad de procesamiento, se realiza una reacción de telomerasa convencional usando condiciones que favorecen una reacción de procesamiento (por ejemplo, 27-34°C, normalmente 30°C) , alta concentración de dGTP (10 !M o más alta) , baja concentración de iniciador (1 !M o más baja) y/o bajas concentraciones de dATP y TTP (0.3-1 mM) con la temperatura y concentración de dGTP normalmente siendo las más críticas. Alternativamente, un ensayo de TRAP (para actividad de procesamiento o de procesamiento moderado) o los ensayos de manchado de puntos y manchado de gel (para actividad de procesamiento) pueden usarse. El polipéptido de hTRT de la invención puede poseer una actividad de no procesamiento, pero no una actividad de procesamiento (por ejemplo, si una alteración del polipéptido de hTRT reduce o elimina la habilidad de translocar) , puede ser únicamente de procesamiento, o puede poseer ambas actividades.

a) Actividad de No Procesamiento Una actividad catalítica de telomerasa de no procesamiento puede extender el iniciador de DNA desde la posición donde el extremo 3' recoce el molde de ARN al extremo 5' de la secuencia del molde, normalmente terminando con la adición del primer residuo G (como, por ejemplo, cuando el molde es hTR) . Como se muestra en el Cuadro 2a, el número exacto de nucleótidos agregados depende de la posición del nucleótido terminal 3' del iniciador en la secuencia de repetición de TTAGGG.

CUADRO 2a ACTIVIDAD DE NO PROCESAMIENTO

i) ---------TTAGGGttag (DNA) 3'-----AUCCCAAUC--------5' (RNA) ii) ---------TTAGggttag (DNA) 3'-----AUCCCAAUC--------5' (RNA) En DNA, UC = iniciador, lc = nucleótidos agregados.

Por lo tanto, 4 nucleótidos son agregados al iniciador (i) --TTAGGG mientras que 6 nucleótidos son agregados al iniciador (ii) --TTAG. La primera repetición agregada por la telomerasa en una reacción de procesamiento es equivalente a este paso; sin embargo, en una reacción de procesamiento, la telomerasa realiza un paso de translocación donde el extremo 3' es liberado y fijado de nuevo en la región 3' del molde en una posición suficiente para preparar la adición de otra repetición (vea Morin, 1997, Eur. J. Cancer 33:750) .

Una reacción completamente de no procesamiento produce sólo una banda en un ensayo convencional usando un solo iniciador sintético. Debido a que este resultado también podría producirse por otras enzimas, como una actividad de transferasa terminal, puede ser conveniente en algunas aplicaciones verificar que el producto sea un resultado de una actividad catalítica de telomerasa. Una banda generada de telomerasa (comprendiendo hTRT) puede distinguirse por varias características adicionales. El número de nucleótidos agregados al extremo del iniciador debe ser congruente con la posición del extremo 3' del iniciador. De esta manera, un iniciador --TTAGGG debe tener 4 nucleótidos agregados y un iniciador --TTAG debe tener 6 nucleótidos agregados (vea arriba) . En la práctica, pueden usarse dos o más iniciadores permutados de secuencias los cuales tienen la misma longitud general pero puntos finales 5' y 3' diferentes. Como un ejemplo ilustrativo, la extensión de no procesamiento de iniciadores 5'-TTAGGGTTAGGGTTAGGG y 5'-GTTAGGGTTAGGGTTAGG generará productos cuya longitud absoluta será un nucleótido diferente (4 agregado a 5'-TTAGGGTTAGGGTTAGGG para una longitud total de 22 nt y 5 agregados a 5'GTTAGGGTTAGGGTTAGG para una longitud total de 23 nt) . La dependencia del nucleótido de la reacción debe ser consistente con la posición del final del iniciador. Por lo tanto, un producto de iniciador --TTAGGG debe requerir dGTP, TTP y dATP, pero no dCTP y un producto de iniciador --AGGGTT debe requerir dGTP y dATP, pero no TTP o dCTP. La actividad debe ser sensible al tratamiento previo de RNAasa o nucleasa microcócica (vea Morin, 1989, Cell 59:521) bajo condiciones que degradarán hTR y por lo tanto eliminarán el molde.

b) Actividad de Procesamiento En la práctica, una actividad de procesamiento es observada fácilmente por la apariencia de una escalera de seis nucleótidos en un ensayo convencional, ensayo TRAP, o ensayo de manchado de gel. También puede usarse un ensayo de manchado de puntos, pero no se detecta ninguna escalera en un método tal. El ensayo convencional se describe en Morin, 1989, Cell 59:521, el cual se incorpora en el presente en su totalidad y para todos los propósitos. El ensayo TRAP se describe en la Patente de los Estados Unidos Número 5, 629, 154; vea también, publicación PCT WO 97/15687, publicación PCT WO 95/13381; Krupp y otros, Nucleic Acids Res., 1997, 25:919; y Wright y otros, 1995, Nuc. Acids Res. 23:3794, cada una de las cuales se incorpora en el presente en su totalidad y para todos los propósitos. El ensayo de manchado de puntos puede usarse en un formato en el cual una actividad de no procesamiento, la cual no agrega las 3 o más repeticiones requeridas para hibridación estable de la sonda (CCCUAA) n usada para detectar, es probada con compuestos o variantes de hTRT para determinar si la misma genera procesabilidad, es decir, si la sonda detecta un substrato de telomerasa esperado, entonces el compuesto o mutante es capaz de cambiar la actividad de no procesamiento a una actividad de procesamiento. Pueden usarse otros ensayos para actividad catalítica de procesamiento de telomerasa, por ejemplo, el ensayo de PCR de trayecto de Tatematsu y otros, 1996, Oncogene 13:2265. También puede usarse el ensayo de manchado de gel, una combinación del ensayo convencional y el ensayo de manchado de puntos. En esta variación, se realiza un ensayo convencional sin nucleótido radioetiquetado y con altas concentraciones de dGTP (por ejemplo, 0.1-2 mM) . Después de realizar el ensayo convencional, el DNA sintetizado es separado desnaturalizando PAGE y transferido a una membrana (por ejemplo, nitrocelulosa) . El DNA telomérico (el producto de telomerasa - un iniciador o substrato de telomerasa extendido) puede entonces detectarse por métodos como la hibridación usando sondas de DNA telomérico etiquetado (por ejemplo, sondas conteniendo la secuencia de CCCTAA, como se usa en el ensayo de manchado de puntos, arriba) . Una ventaja de esta técnica es que es más sensible que el ensayo convencional y proporciona información sobre el tamaño de los fragmentos sintetizados y la procesabilidad de la reacción.

c) Determinaciones de actividad La actividad de telomerasa de un polipéptido de hTRT puede determinarse usando un polipéptido de hTRT no purificado, purificado en forma parcial o substancialmente purificado (por ejemplo, en asociación con hTR) , in vitro, o después de la expresión in vivo. Por ejemplo, la actividad de telomerasa en una célula (por ejemplo, una célula expresando un polipéptido de hTRT recombinante de acuerdo con la invención) puede analizarse detectando un aumento o una disminución en la longitud de telómeros. Normalmente, los ensayos para la actividad catalítica de telomerasa se realizan usando una hTRT compuesta con hTR; sin embargo, los RNAs del molde de telomerasa alternativo pueden substituirse, o uno puede realizar ensayos para medir otra actividad, como la fijación de telomerasa e iniciador. Los ensayos para determinar la longitud de telómeros son conocidos en el arte e incluyen hibridación de sondas a DNA telomérico (puede incluirse un paso de amplificación) y análisis de TRF, es decir, el análisis de fragmentos de restricción de DNA telomérico [TRFs] después de la digestión de la endonucleasa de restricción, vea publicación PCT WO 93/23572 y WO 96/41016; Counter y otros, 1992, EMBO J. 11:1921; Allsopp y otros, 1992, Proc. Natl. Acad. Sci. USA 89:10114; Sanno, 1996, Am. J. Clin. Pathol. 106:16 y Sanno, 1997, Neuroendocrinology 65:299.

La actividad catalítica de telomerasa de un polipéptido de hTRT puede determinarse de diversas formas usando los ensayos de arriba y otros ensayos de actividad catalítica de telomerasa. De acuerdo con un método, se expresa la proteína de hTRT (por ejemplo, como se describe abajo) en una célula humana negativa de telomerasa en la cual la hTRT se expresa (es decir, normalmente en la célula o a través de la expresión recombinante) y se determina la presencia o ausencia de la actividad de telomerasa en la célula o lisato de células. Los ejemplos de células negativas de telomerasa son células IMR 90 (ATCC, #CCL-186) o BJ (línea de fibroblastos del prepucio humano; vea, por ejemplo, Feng y otros, 1995, Science 269:1236) . Otros ejemplos incluyen células epiteliales pigmentadas retinales (RPE) , células endoteliales de vena umbilical humana (HUVEC; ATCC #CRL-1730) , células endoteliales aórticas humanas (HAEC; Clonetics Corp., #CC-2535) y células epiteliales mamarias humanas (HME; Hammond y otros, 1984, Proc. Natl. Acad. Sci. USA 81:5435; Stampfer, 1985, J. Tissue Culture Methods 9:107) .

Alternativamente, se expresa el polipéptido de hTRT (por ejemplo, por transfección con un vector de expresión de hTRT) en una célula positiva de telomerasa y se detecta un aumento en la actividad de telomerasa en la célula en comparación con una célula de control no transfectada si el polipéptido tiene actividad catalítica de telomerasa. Generalmente la actividad catalítica de telomerasa en una célula transfectada con un vector de expresión adecuado expresando hTRT será aumentada de manera considerable, como por lo menos alrededor de 2 pliegues, por lo menos alrededor de 5 pliegues, o hasta por lo menos alrededor de 10 pliegues a 100 pliegues o hasta 1000 pliegues más alta que en las células no transfectadas (de control) .

Alternativamente, la proteína de hTRT se expresa en una célula (por ejemplo, una célula negativa de telomerasa en la cual se expresa la hTR) como una proteína de fusión (vea abajo) teniendo una etiqueta o "rótulo de epítopo" para ayudar en la purificación. El RNP puede ser recuperado de la célula usando un anticuerpo que específicamente reconoce el rótulo. Los rótulos preferidos son normalmente cortos o pequeños y pueden incluir un sitio de disociación u otra propiedad que permite que el rótulo sea eliminado del polipéptido de hTRT. Los ejemplos de rótulos adecuados incluyen el epítopo Xpress™ (Invitrogen, Inc., San Diego, CA) y otras mitades que pueden fijarse específicamente por un anticuerpo o ácido nucleico u otro método equivalente como los que describen en el Ejemplo 6. Los rótulos alternativos incluyen aquellos codificados por secuencias insertadas, por ejemplo, al NÚMERO DEIDENTIFICACIÓN DE SECUENCIA: 1 corriente arriba del codón ATG que inicia la traducción de la proteína delNÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2, las cuales pueden incluir la inserción de un (nuevo) codón de iniciación de metionina a la secuencia corriente arriba.

Se apreciará que cuando una variante de hTRT se expresa en una célula (por ejemplo, como una proteína de fusión) y subsecuentemente se aísla (por ejemplo, como un complejo de ribonucleoproteínas) , otras proteínas de la célula (es decir, proteínas asociadas con la telomerasa) pueden asociarse con (directa o indirectamente fijarse a) el complejo aislado. En tales casos, algunas veces será conveniente analizar la actividad de telomerasa para el complejo que contiene hTRT, hTR y las proteínas asociadas.

2) OTRAS ACTIVIDADES DE LA PROTEÍNA DE TELOMERASA O TRT

Los polipéptidos de hTRT de la invención pueden retener una o más actividades de telomerasa, diferentes a las de la actividad catalítica. Estas otras actividades y los métodos para medir estas actividades incluyen (pero no están limitados a) aquellos discutidos a continuación.

a) Actividad de la transcriptasa inversa convencional La actividad de la transcriptasa inversa de telomerasa convencional se describe en, por ejemplo, Morin, 1997, abajo, y Spence y otros, 1995, Science 267:988. Debido a que la hTRT contiene motivos de aminoácidos conservados que son requeridos para la actividad catalítica de la transcriptasa inversa, la hTRT tiene la habilidad de transcribir ciertos RNAs exógenos (por ejemplo, no de hTR) . Un ensayo de RT convencional mide la habilidad de la enzima de transcribir un molde de ARN extendiendo un iniciador de DNA recocido. La actividad de la transcriptasa inversa puede medirse de muchas formas conocidas en el arte, por ejemplo, supervisando el aumento de tamaño de un iniciador de ácido nucleico etiquetado (por ejemplo, ARN o DNA) , o la incorporación de un dNTP etiquetado. Vea, por ejemplo, Ausubel y otros, abajo.

Debido a que la hTRT específicamente se asocia con hTR, puede apreciarse que el molde de iniciador de DNA/RNA para un ensayo de RT convencional puede modificarse para tener características relacionadas con hTR y/o un iniciador de DNA telomérico. Por ejemplo, el ARN puede tener la secuencia (CCCTAA) n, donde n es por lo menos 1, o por lo menos 3, o por lo menos 10 o más. La región (CCCTAA) n puede estar en o cerca del final 5' del ARN (similar a los lugares 5' de las regiones del molde en los RNAs de telomerasa) . Del mismo modo, el iniciador de DNA puede tener un final 3' que contiene partes de la secuencia de telómeros TTAGGG, por ejemplo XnTTAG, XnAGGG, Xn (TTAGGG) qTTAG, etc., donde X es una secuencia no telomérica y n es 8-20, o 6-30 y q es 1-4. El iniciador de DNA puede tener un final 5' que es no complementario al molde de RNA, de tal manera que cuando el iniciador es recocido al RNA, el final 5' del iniciador permanece no fijado. En el arte se conocen modificaciones adicionales de ensayos de transcripción inversa estándar que pueden aplicarse a los métodos.

b) Actividad nucleolítica La actividad nucleolítica de la telomerasa se describe en por ejemplo, Morin, 1997, abajo; Collins y Grieder, 1993, Genes and Development 7:1364. La telomerasa posee una actividad nucleolítica (Joyce y Steitz, 1987, Trends Biochem. Sci. 12:288) ; sin embargo, la actividad de la telomerasa tiene características definidas. La telomerasa elimina de forma preferencial los nucleótidos, generalmente sólo uno, del extremo 3' de un oligonucleótido cuando el extremo 3' del DNA está posicionado en el límite 5' de la secuencia del molde de DNA, en humanos y Tetrahymena, este nucleótido es la primera G de la repetición telomérica (TTAGG en humanos) . La telomerasa elimina de forma preferencial los residuos de G pero tiene actividad nucleolítica en contra de otros nucleótidos. Esta actividad puede ser supervisada. Aquí se describen dos métodos diferentes para fines ilustrativos. Un método implica una reacción de telomerasa convencional con un iniciador que fija toda la secuencia del molde (es decir, terminando en el límite del molde; 5'-TAGGGATTAG en humanos) . La actividad nucleolítica se observa supervisando el reemplazo del último residuo de G con un dGTP radioetiquetado en el ensayo. El reemplazo es supervisado por la apariencia de una banda en el tamaño del iniciador de arranque como se muestra por electrofóresis de gel y autorradiografía.

Un método preferido usa un iniciador de DNA que tiene un final 3' "bloqueado" que no puede extenderse por telomerasa. El iniciador bloqueado de 3' puede usarse en un ensayo estándar de telomerasa pero no se extenderá a menos que el nucleótido 3' sea eliminado por la actividad nucleolítica de la telomerasa. La ventaja de este método es que la actividad de la telomerasa puede ser supervisada por alguno de los diversos métodos estándar y la señal es fuerte y fácil de cuantificar. El bloqueo del final 3' del iniciador puede realizarse en varias formas. Un método es la adición de un residuo de 3'-deoxi-dNTP en el final 3' del iniciador usando técnicas estándar de síntesis de oligonucleótidos. Este final tiene un 2' OH pero no el 3' OH requerido para la telomerasa. Existen otros medios para bloquear el límite 3', por ejemplo, un final 3' dideoxi, un final 3'-amina y otros. Un ejemplo de un iniciador para un ensayo nucleolítico de hTRT es 5'-TTAGGGTTAGGGTTA (G3'H) donde el último residuo denota un residuo de 3'deoxi-guanosina (Glen Research, Sterling, VA) . Los expertos en el arte conocen muchas otras variaciones para un iniciador adecuado basado en le revelación.

c) Actividad de fijación de iniciador (telómero)

La actividad de fijación de iniciador de telomerasa (telómero) se describe en, por ejemplo, Morin, 1997, abajo; Collins y otros, 1995, Cell 81:677; Harrington y otros, 1995, J. Biol. Chem. 270:8893. Se cree que la telomerasa tiene dos sitios los cuales fijan un iniciador de DNA telomérico. Los motivos de RT asociados con la fijación del iniciador indican que la hTRT y/o hTRT/hTR posee actividad de fijación de iniciador de DNA. Existen varias formas de analizar la actividad de fijación del iniciador; sin embargo, un paso común a la mayoría de los métodos es la incubación de un iniciador de DNA etiquetado con hTRT o hTRT/hTR u otras combinaciones de TRT/TR bajo condiciones de fijación adecuadas. También, la mayoría de los métodos emplean un medio para separar DNA no fijado del DNA fijado a la proteína; esos métodos incluyen lo siguiente.

i) Ensayos de desplazamiento de gel (también llamados ensayos electroforéticos/de desplazamiento de movilidad) son aquellos en los cuales el iniciador de DNA no fijado se separa del iniciador de DNA fijado a la proteína por electrofóresis en un gel no desnaturalizante (Ausubel y otros, arriba) .

ii) Los ensayos de fijación de matriz incluyen diversas variaciones a la técnica básica, la cual implica la fijación de la hTRT o complejo de hTRT/hTR a una matriz (por ejemplo, nitrocelulosa) , antes o después de la incubación con el iniciador etiquetado. Fijando la hTRT a una matriz, el iniciador no fijado puede separarse mecánicamente del iniciador fijado. El DNA residual no fijado puede eliminarse lavando la membrana antes de la cuantificación. Los expertos reconocen que hay varios medios de acoplar proteínas a dichas matrices, soportes sólidos y membranas, incluyendo reticulación química, fotoquímica, UV, anticuerpo/epítopo e interacciones (hidrófobas, electrostáticas, etc.) no covalentes.

El iniciador de DNA puede ser cualquier DNA con una afinidad a la telomerasa, como, por ejemplo, un iniciador de DNA telomérico como (TTAGGG) n, donde n podría ser 1-10 y normalmente es 3-5. Los finales 3' y 5' pueden terminar en cualquier lugar de la secuencia de repetición. El iniciador también puede tener extensiones 5' o 3' de DNA no telomérico que podría facilitar el etiquetado o la detección. El iniciador también puede derivarse, por ejemplo, para facilitar la detección o el aislamiento.

d) Actividad de fijación de dNTP

La actividad de fijación de dNTP de telomerasa se describe en, por ejemplo, Morin, 1997, abajo; Spence y otros, arriba. La telomerasa requiere dNTPs para sintetizar DNA. La proteína de hTRT tiene una actividad de fijación de nucleótido y puede analizarse para fijación de dNTP en una forma similar a las proteínas de fijación de nucleótidos (Kantrowitz y otros, 1980, Trends Biochem. Sci. 5:124) . Normalmente, puede supervisarse la fijación de un dNTP etiquetado o análogo de dNTP ya que es conocido en el arte para proteínas de RT de no telomerasa.

e) Actividad de fijación de ARN (es decir, hTR)

La actividad de fijación de ARN (es decir, hTR) de telomerasa se describe en por ejemplo, Morin, 1997, arriba; Harrington y otros, 1997, Science 275:973; Collins y otros, 1995, Cell 81:677. La actividad de fijación de ARN de una proteína de TRT puede analizarse en una forma similar al ensayo de fijación de iniciador de DNA descrito arriba, usando una sonda de ARN etiquetado. Los métodos para separar ARN fijado y no fijado y para detectar ARN son bien conocidos en el arte y pueden aplicarse a los ensayos de actividad en una forma similar a la descrita para el ensayo de fijación de iniciador de DNA. El ARN puede ser hTR de tamaño natural, fragmentos de hTR u otros RNAs demostrados los cuales demuestren tener una afinidad a la telomerasa o hTRT. Vea la Patente de los Estados Unidos Número 5, 583, 016 y Publicación PCT Número 96/40868.

3) MOTIVOS DE TELOMERASA COMO OBJETIVOS

La presente invención, como se indica arriba, prevé además de la hTRT recombinante con un complemento total (como se describe abajo) de actividades, polipéptidos de hTRT que tienen menos del complemento total de las actividades de telomerasa de la telomerasa que ocurre naturalmente o proteínas de hTRT u otras proteínas de TRT.

Se apreciará además que, en vista de la revelación en el presente de la RT y los motivos específicos de telomerasa de TRT, la alteración o mutación de residuos de aminoácidos conservados, como los que se encuentran en las secuencias de motivos discutidos arriba, dará como resultado mutantes de pérdida de actividad útiles para uso terapéutico, selección y caracterización de medicamentos y otros usos. Por ejemplo, como se describe en el Ejemplo 1, la supresión de motivos B al D en los dominios de RT del gene de TRT endógena en S. pombe ocasionó células haploides en las cuales el telómero se redujo progresivamente hasta el punto donde la hibridación de una sonda de telómero a repeticiones teloméricas se volvió casi indetectable, indicando una pérdida de actividad catalítica de telomerasa. Del mismo modo, la alteración en el sitio WxGxS del motivo E pueden afectar la fijación o función del iniciador de DNA de telomerasa.

Las alteraciones de los aminoácidos en los motivos A, B' y C pueden afectar la actividad catalítica de telomerasa. La mutación del motivo DD de hTRT puede reducir considerablemente o anular la actividad de telomerasa (vea el Ejemplo 16) .

C) SÍNTESIS DE POLIPÉPTIDOS DE hTRT Y OTROS DE POLIPÉPTIDOS DE TRT

Existen una variedad de métodos para hacer los polipéptidos de hTRT y otros polipéptidos de TRT revelados en el presente. En las siguientes partes, se describe detalladamente la síntesis química y la expresión recombinante de las proteínas de hTRT, incluyendo proteínas de fusión.

1) SÍNTESIS QUÍMICA

La invención puede implicar polipéptidos de hTRT sintetizados, total o parcialmente, usando métodos químicos generales bien conocidos en el arte (vea por ejemplo, Caruthers y otros, 1980, Nucleic Acids Res. Symp. Ser., 215223; y Horn y otros, 1980, Nucleic Acids Res. Symp. Ser., 225-232) . Por ejemplo, la síntesis de péptidos puede realizarse usando varias técnicas de fase sólida (Roberge y otros, 1995, Science 269:202) , incluyendo síntesis automatizada (por ejemplo, usando el Sintetizador de Péptidos Perkin Elmer ABI 431A en conformidad con las instrucciones proporcionadas por el fabricante) . Cuando se desea la proteína de tamaño natural, los polipéptidos más cortos pueden fundirse por condensación del final de amino de una molécula con el final de carboxilo de la otra molécula para formar un enlace de péptido.

El péptido recién sintetizado puede purificarse substancialmente, por ejemplo, por cromatografía líquida preparatoria de alto rendimiento (por ejemplo, Creighton, PROTEINS, STRUCTURES AND MOLECULAR PRINCIPLES, WH Freeman and Co., Nueva York, NY [1983]) . La composición de los péptidos sintéticos (o algunos otros péptidos o polipéptidos) puede confirmarse por análisis de aminoácidos o clasificación de secuencia (por ejemplo, el procedimiento de degradación de Edman; Creighton, arriba) . De manera importante, la secuencia de aminoácidos de hTRT, o una parte de la misma, puede alterarse durante la síntesis directa y/o combinarse usando métodos químicos con secuencias de otras proteínas o de otra manera, o una parte de las mismas o para algún propósito, a fin de producir un polipéptido de variante.

2) EXPRESIÓN RECOMBINANTE DE PROTEÍNAS DE hTRT Y OTRAS PROTEÍNAS DE TRT

Se describirán a continuación métodos, reactivos, vectores y células útiles para la expresión de polipéptidos de hTRT y ácidos nucleicos usando sistemas de expresión recombinante in vitro (libre de células) , ex vivo o in vivo (a base de células u organismos) . La expresión de la proteína de hTRT, o fragmento de la misma, comprende la inserción de la secuencia de codificación a un vector de expresión adecuado (es decir, un vector que contiene los elementos necesarios para la transcripción y traducción de la secuencia de codificación insertada requerida para el sistema de expresión empleado) . Un polinucleótido substancialmente idéntico en secuencia a una secuencia de codificación de gene de hTRT, por lo menos 25 nucleótidos, y de preferencia para muchas aplicaciones, de 50 a 100 nucleótidos o más, de los cDNAs de hTRT o genes de la invención, la cual puede ser vinculada de manera manejable a un promotor para formar una unidad de transcripción capaz de expresar un polipéptido de hTRT. Los métodos bien conocidos por los expertos en el arte pueden usarse para construir los vectores de expresión que contienen una secuencia de hTRT y controles de transcripción o traducción adecuados (vea, por ejemplo, Sambrook y otros, arriba, Ausubel y otros, arriba y esta revelación) .

Los polipéptidos de hTRT incluyen proteínas de fusión que contienen polipéptidos de hTRT o fragmentos de la proteína de hTRT. Las proteínas de fusión normalmente se producen por medios recombinantes, aunque también pueden hacerse por síntesis química. Las proteínas de fusión pueden ser útiles en proporcionar expresión mejorada de las construcciones de polipéptidos de hTRT, o en producir polipéptidos de hTRT que tienen otras propiedades convenientes, por ejemplo, comprendiendo una etiqueta (como un grupo reportero enzimático) , grupo de fijación, o epítopo de anticuerpo. En el Ejemplo 15, abajo, se describe una proteína de fusión ejemplar, comprendiendo secuencias de hTRT y proteína de fluoresceína verde mejorada (EGFP) . Será aparente para los expertos en el arte que los usos y aplicaciones discutidos en el Ejemplo 15 y en otra parte en el presente no están limitados a la proteína de fusión en particular, sino que son ilustrativos de los usos de varias construcciones de fusión.

Los sistemas de proteína de fusión también pueden usarse para facilitar la producción y aislamiento eficiente de proteínas o péptidos de hTRT. Por ejemplo, la parte de la secuencia de no hTRT de la proteína de fusión comprende un péptido corto que puede fijarse específicamente a una molécula inmovilizada de tal manera que la proteína de fusión puede separarse de componentes no ligados (como proteínas no relacionadas en un lisato de células) . Un ejemplo es una secuencia de péptido que está fijada por un anticuerpo específico. Otro ejemplo, es un péptido que comprende trechos de polihistidina por ejemplo (His) 6 o secuencias de histidina-triptófano que pueden ligarse por una resina que contiene iones de níquel o cobre (es decir, cromatografía de afinidad de metal y quelato) . Otros ejemplos incluyen dominios o fragmentos de Proteína A, los cuales permiten la purificación en inmunoglobulina inmovilizada y el dominio utilizado en el sistema de purificación de extensión/afinidad FLAGS (Immunex Corp., Seattle, WA) . La proteína de fusión puede incluir un sitio de disociación de manera que la secuencia de polipéptidos de hTRT u otros polipéptidos de TRT puede separarse fácilmente de la secuencia de péptidos o proteínas no de hTRT. En este caso, la disociación puede ser química (por ejemplo, bromuro de cianógeno, 2- (2-nitrofenilsulfenil) -3metil-3'-bromoindoleno, hidroxilamina, o pH bajo) o enzimática (por ejemplo, Factor Xa, enterocinasa) . La elección de los sistema de fusión y disociación puede depender, en parte, de la parte (es decir, la secuencia) del polipéptido de hTRT que se está expresando. Las proteínas de fusión generalmente se describen en Ausubel y otros, arriba, Capítulo 16, Kroll y otros, 1993, DNA Cell Biol. 12:441 y el Catálogo 1997 de Invitrogen (Invitrogen Inc., San Diego, CA) . En el Ejemplo 6, abajo, se proporcionan otras proteínas de fusión ejemplares con rótulos de epítopos o rótulos y sitios de disociación.

Los expertos en el arte apreciarán que, aunque los sistemas de expresión discutidos en esta parte se enfocan en la expresión de polipéptidos de hTRT, las mismas células, vectores y métodos o similares pueden usarse para expresar los polinucleótidos de hTRT, incluyendo polinucleótidos con sentido y antisentido sin desear necesariamente la producción de polipéptidos de hTRT. Normalmente, la expresión de un polipéptido requiere un codón de iniciación adecuado (por ejemplo, metionina) , configuración de lectura abierta y señales de regulación de traducción (por ejemplo, un sitio de fijación de ribosoma, un codón de terminación) los cuales pueden omitirse cuando no sea desea la traducción de una secuencia de ácido nucleico para producir una proteína.

La expresión de polipéptidos y polinucleótidos de hTRT puede realizarse para lograr alguno de los diversos beneficios relacionados. Un beneficio ilustrativo es la expresión de polipéptidos de hTRT que son aislados subsecuentemente de la célula en la cual se expresan (por ejemplo para la producción de grandes cantidades de hTRT para uso como una vacuna o en la selección de aplicaciones para identificar compuestos que modulan la actividad de telomerasa) . Un segundo beneficio ilustrativo es la expresión de hTRT en una célula para cambiar el fenotipo de la célula (como en las aplicaciones de terapia génica) . Las células no mamíferas pueden usarse para la expresión de hTRT para purificación, mientras que las células eucarióticas especialmente mamíferas (por ejemplo, células humanas) pueden usarse no sólo para aislamiento y purificación de hTRT sino también para expresión de hTRT cuando se desea un cambio en el fenotipo en una célula (por ejemplo, para efectuar un cambio en la capacidad de proliferación como en las aplicaciones de terapia génica) . A manera de ilustración y no limitación, los polipéptidos de hTRT pueden expresarse en una célula huésped para aumentar la capacidad de proliferación de una célula (por ejemplo, inmortalizar una célula) y, a la inversa, los polinucleótidos antisentido de hTRT o polipéptidos inhibidores normalmente se pueden expresarse para reducir la capacidad de proliferación de una célula (por ejemplo, de una célula positiva de telomerasa de tumor maligno) . Numerosas aplicaciones específicas se describen en el presente, por ejemplo, en la discusión de la utilización de la invención para aplicaciones terapéuticas, abajo.

Los útiles sistemas de expresión ilustrativos (células, elementos de regulación, vectores) de la presente invención incluyen diversos sistemas libres de células como sistemas de lisato de reticulocitos y germen de trigo usando polinucleótidos de hTRT en conformidad con métodos generales bien conocidos en el arte (vea, por ejemplo, Ausubel y otros, arriba en el Capítulo 10) . En realizaciones alternativas, la invención proporciona reactivos y métodos para expresar hTRT en células procarióticas o eucarióticas. De esta manera, la presente invención proporciona ácidos nucleicos codificando polinucleótidos, proteínas, subsecuencias de proteínas, o proteínas de fusión de hTRT que pueden expresarse en bacterias, hongos, plantas, insectos y animales, incluyendo sistemas de expresión de células humanas conocidos en el arte, incluyendo células aisladas, líneas de células, cultivos de células, tejidos y organismos enteros. Como lo entenderán los expertos, los polinucleótidos de hTRT introducidos a un sistema de expresión de células huésped o libre de células generalmente estarán vinculados de una manera manejable a secuencias de control de expresión adecuadas para cada sistema de células huésped o libre de células.

Los útiles sistemas de expresión de bacteriana incluyen E. coli, bacilos (como Bacillus subtilus) , otras enterobacterias (como Salmonella, Serratia y varias especies Pseudomonas) u otros huéspedes bacterianos (por ejemplo, Streptococcus cremoris, Streptococcus lactis, Streptococcus thermophilus, Leuconostoc citrovorum, Leuconostoc mesenteroides, Lactobacillus acidophilus, Lactobacillus lactis, Bifidobacterium bifidum, Bifidobacterium breve y Bifidobacterium longum) . Las construcciones de expresión de hTRT útiles en procariotas incluyen bacteriófago recombinante, vectores de expresión de DNA de plásmido o cósmido, o similares y normalmente incluyen secuencias de promotores. Los promotores ilustrativos incluyen promotores capaces de ser inducidos, como el promotor lac, el promotor híbrido lacZ del fagémido Bluescript7 [Stratagene, La Jolla, CA] o pSport1 [Gibco BRL]; sistemas de promotores de fagos lambda; un sistema de promotores de triptófano (trp) ; e híbridos de ptrp-lac y similares. Las construcciones de expresión bacteriana incluyen opcionalmente un sitio de fijación de ribosoma y secuencias de regulación de señales de terminación de transcripción. Los ejemplos ilustrativos de vectores específicos útiles para expresión incluyen, por ejemplo, pTrcHis2 (Invitrogen, San Diego, CA) , pThioHis A, B y C y muchos otros conocidos en el arte o que pueden desarrollarse (vea, por ejemplo, Ausubel) . Los vectores útiles para bacterias incluyen aquellos que facilitan la producción de proteínas de fusión de hTRT. Los vectores útiles para expresión de alto nivel de proteínas de fusión en células bacterianas incluyen, pero no están limitados a, los vectores multifuncionales de clonación y expresión de E. coli como Bluescript7 (Stratagene) , indicados arriba, en los cuales la proteína de hTRT que codifica secuencias, una proteína de fusión de hTRT o un fragmento de hTRT puede ligarse al vector en la configuración con secuencias para el Met terminal de aminos y los 7 residuos subsecuentes de 1galactosidasa de manera que se produce una proteína híbrida (por ejemplo, vectores pIN; Van Heeke y Schuster, 1989, J. Biol. Chem., 264:5503) . Los vectores como vectores pGEX (por ejemplo, pGEX-2TK; Pharmacia Biotech) también pueden usarse para expresar polipéptidos extraños, como proteína de hTRT, como proteínas de fusión con S-transferasa de glutationa (GST) . Las proteínas de fusión pueden purificarse de células lisadas por medio de la adsorción a cuentas de glutationa-agarosa seguida por la elución en la presencia de glutationa libre. Las proteínas hechas en estos sistemas a menudo incluyen sitios de disociación de enterocinasa, trombina o proteasa de factor Xa de manera que el polipéptido clonado de interés pueda liberarse de la mitad de GST a discreción, según sea útil en la purificación u otras aplicaciones. Otros ejemplos son las proteínas de fusión que comprenden hTRT y la Proteína de Fijación de Maltosa (MBP) de E. coli o tioredoxina de E. coli. En el Ejemplo 6, abajo, se proporcionan los ejemplos ilustrativos de las construcciones de expresión de hTRT útiles en células bacterianas.

La invención prevé polipéptidos de hTRT expresados en sistemas de hongos, como Dictyostelium y, de preferencia, levadura, como Saccharomyces cerevisiae, Pichia pastoris, Torulopsis holmil, Saccharomyces fragilis, Saccharomyces lactis, Hansenula polymorpha y Candida pseudotropicalis. Cuando la hTRT se expresa en levadura, está disponible una cantidad de vectores adecuados, incluyendo vectores de plásmidos y cromosomas artificiales de levadura (YACs) . Los vectores normalmente incluyen secuencias de control de expresión, como promotores constitutivos o capaces de ser inducidos (por ejemplo, como factor alfa, oxidasa de alcohol, PGH y cinasa de 3fosfoglicerato u otras enzimas glicolíticas) y un origen de replicación, secuencias de terminación y similares, según se desee. Los vectores adecuados para uso en Pichia incluyen pPICZ, His6/pPICZB, pPICZalfa, pPIC3.5K, pPIC9K, pA0815, pGAP2A, B y C, pGAP2alfa, A, B y C (Invitrogen, San Diego, CA) y muchos otros conocidos en el arte o que se desarrollarán. El vector His6/pPICZB (Invitrogen, San Diego, CA) puede utilizarse para expresar una proteína de fusión de His6-hTRT en la levadura Pichia pastoris. Un ejemplo de un vector útil en Saccharomyces es pYES2 (Invitrogen, San Diego, CA) . En el Ejemplo 6, abajo, se proporcionan ejemplos ilustrativos de construcciones de expresión de hTRT útiles en la levadura.

Los polipéptidos de hTRT también pueden expresarse en sistemas celulares de plantas transfectados con vectores de expresión de plantas o virus de plantas (por ejemplo, virus de mosaico de coliflor, CaMV; virus de mosaico de tabaco, TMV) o transformados con vectores de expresión bacteriana (por ejemplo, Ti o plásmido pBR322) . En casos donde se usen vectores de expresión de virus de plantas, la expresión de una secuencia que codifica la hTRT puede ser impulsada por uno de diversos promotores. Por ejemplo, los promotores virales como los promotores 35S y 19S de CaMV (Brisson y otros, 1984, Nature 310:511-514) pueden usarse solos o en combinación con la secuencia omega líder de TMV (Takamatsu y otros, 1987, EMBO J., 6:307-311) . Alternativamente, pueden usarse promotores de plantas como los que forman el gene de subunidad pequeña de RUBISCO (Coruzzi y otros, 1984, EMBO J., 3:1671-1680; Broglie y otros, 1984, Science 224:838-843) o promotores resistentes al calor y golpes (Winter y Sinibaldi, 1991, Results Probl. Cell Differ., 17:85) , o promotores de almacenamiento de genes de proteína. Estas construcciones pueden introducirse a células de plantas por transformación directa de DNA o transfección mediada por patógenos (para revisión de dichas técnicas, vea Hobbs o Murr y , 1992, en McGraw Hill Yearbook of Science and Technology, McGraw Hill New York, NY, pág. 191-196 [1992]; o Weissbach y Weissbach, 1988, Methods for Plant Molecular Biology (Métodos para Biología Molecular de las Plantas) , Academic Press, New York, NY, pág. 421-463) .

Otro sistema de expresión proporcionado por la invención para la expresión de la proteína de hTRT es un sistema de insectos. Un sistema preferido usa un promotor de polihedrina de baculovirus. En un sistema tal, el virus de polihedrosis nuclear Autographa californica (AcNPV) se usa como un vector para expresar genes extraños en células de Spodoptera frugiperda o en larvas de Trichoplusia. La secuencia que codifica el gene de interés puede clonarse en una región no esencial del virus, como el gene de polihedrina y ponerse bajo control del promotor de polihedrina. La inserción satisfactoria de la secuencia, por ejemplo, codificando la proteína de hTRT, volverá inactivo el gene de polihedrina y producirá una proteína de cubierta careciendo de virus recombinantes. Los virus recombinantes se usan entonces para infectar las células de S. frugiperda o larvas de Trichoplusia, en las cuales la secuencia de hTRT se expresa después (vea, para métodos generales, Smith y otros, J. Virol., 46:584 [1983]; Engelhard y otros, Proc. Natl. Acad. Sci. 91:3224-7 [1994]) . Los vectores útiles para expresión de baculovirus incluyen pBlueBacHis2 A, B y C, pBlueBac4.5, pMelBacB y muchos otros conocidos en el arte o que se desarrollarán. En el Ejemplo 6, abajo, se proporcionan ejemplos ilustrativos de las construcciones de expresión de hTRT útiles en las células de insectos.

La presente invención también proporciona sistemas de expresión en mamíferos y células mamíferas. Como se indica arriba, los polinucleótidos de hTRT pueden expresarse en células mamíferas (por ejemplo, células humanas) para la producción de cantidades considerables de polipéptidos de hTRT (por ejemplo, para purificación) o para cambiar el fenotipo de una célula de objetivo (por ejemplo, para fines de terapia génica, inmortalización de células, u otros) . En el último caso, el polinucleótido de hTRT expresado puede o no codificar un polipéptido con una actividad catalítica de telomerasa. Es decir, la expresión puede ser de un polinucleótido con sentido o antisentido, un polipéptido inhibidor o estimulador, un polipéptido con cero, una o más actividades de telomerasa y otras combinaciones y variantes reveladas en el presente o aparentes para los expertos en la revisión de esta revelación.

Las células huésped de cultivos de tejido mamífero adecuados para expresar los ácidos nucleicos de la invención incluyen una célula animal o humana normal mortal o anormal inmortal, incluyendo: línea CV1 de riñón de mono transformada por SV40 (COS-7, ATCC CRL 1651) ; línea de riñón de embrión humano (293; Graham y otros, J. Gen. Virol. 36:59 (1977) ) ; células de riñón de hámster bebé (BHK, ATCC CCL 10) ; CHO (ATCC CCL 61 y CRL 9618) ; células Sertoli de ratón (TM4, Mather, Biol. Reprod. 23:243-251 (1980) ) ; células de riñón de mono (CV1 ATCC CCL 70) ; células de riñón de mono verde africano (VERO-76, ATCC CRL 1587) ; células de carcinoma cervical humano (HeLa, ATCC CCL 2) ; células de riñón canino (MDCK, ATCC CCL 34) ; células de hígado de rata búfalo (BRL 3A, ATCC CRL 1442) ; células de pulmón humano (W138, ATCC CCL 75) ; células de hígado humano (Hep G2, HB 8065) ; tumor mamario de ratón (MMT 060562, ATCC CCL51) ; células TRI (Mather y otros, Annals N.Y. Acad. Sci. 383:44-46 (1982) ; células MDCK (ATCC CCL 34 y CRL 6253) ; células HEK 293 (ATCC CRL 1573) ; y células WI-38 (ATCC CCL 75; ATCC: American Type Culture Collection, Rockville, MD) . El uso de cultivo celular de tejido mamífero para expresar polipéptidos se discute generalmente en Winnacker, From Genes to Clones (De Genes a Clones) (VCH Publishers, N.Y., N.Y., 1987) .

Para células huésped mamíferas, se proporcionan sistemas de expresión virales y no virales. Los vectores y sistemas no virales incluyen plásmidos y vectores episómicos, normalmente con un cassette de expresión para expresar una proteína o ARN y cromosomas artificiales humanos (vea, por ejemplo, Harrington y otros, 1997, Nat. Genet. 15:345) . Por ejemplo, los vectores no virales útiles para expresión de polinucleótidos y polipéptidos de hTRT en células mamíferas (por ejemplo, humanas) incluyen pcDNA3.1/His, pEBVHis A, B y C (Invitrogen, San Diego, CA) , vectores de MPSV, otros descritos en el Catálogo 1997 de Invitrogen (Invitrogen Inc., San Diego, CA) , el cual se incorpora en su totalidad en el presente y muchos otros conocidos en el arte por otras proteínas. En el Ejemplo 6, abajo, se proporcionan ejemplos ilustrativos de construcciones de expresión de hTRT útiles en células mamíferas.

Los vectores virales útiles incluyen vectores basados en retrovirus, adenovirus, virus adenoasociados, virus del herpes, vectores basados en SV40, virus del papiloma, virus HBP Epstein Barr, vectores de virus de vaccinia y virus Semliki Forest (SFV) . SPF y los vectores de vaccinia generalmente se discuten en Ausubel y otros, arriba, Capítulo 16. Estos vectores a menudo están compuestos de dos componentes, un genomio viral modificado y una estructura de cubierta rodeándolo (vea generalmente Smith, 1995, Annu. Rev. Microbiol. 49:807) , aunque algunas veces los vectores virales son introducidos en forma descubierta o cubiertos con proteínas distintas a las proteínas virales. Sin embargo, el ácido nucleico viral en un vector puede cambiarse de muchas maneras, por ejemplo, cuando se diseñan para terapia génica. Las metas de estos cambios son imposibilitar el crecimiento del virus en las células de objetivo manteniendo al mismo tiempo su habilidad de crecer en forma de vector en empaquetamiento disponible o células ayudante, para proporcionar espacio dentro del genomio viral para inserción de secuencias de DNA exógeno y para incorporar nuevas secuencias que codifican y posibilitan la expresión adecuada del gene de interés. Por lo tanto, los ácidos nucleicos del vector generalmente comprenden dos componentes: secuencias virales cis-impulsoras esenciales para replicación y empaquetamiento en una línea ayudante y la unidad de transcripción para el gene exógeno. Otras funciones virales se expresan en trans en un empaquetamiento específico o línea de células ayudantes. Los vectores adenovirales (por ejemplo, para uso en terapia génica humana) se describen en, por ejemplo, Rosenfeld y otros, 1992, Cell 68:143; publicaciones PCT WO 94/12650; 94/12649; y 94/12629. En casos donde se usa un adenovirus como un vector de expresión, una secuencia codificando hTRT puede ligarse a un complejo de transcripción/traducción de adenovirus que consta del promotor reciente y la secuencia tripartita líder. La inserción en una región E1 o E3 no esencial del genomio viral dará como resultado un virus viable capaz de expresarse en células huésped infectadas (Logan y Shenk, 1984, Proc. Natl. Acad. Sci., 81:3655) . Los vectores retrovirales defectuosos en replicación que albergan una secuencia de polinucleótidos terapéuticos como parte del genomio retroviral se describen en, por ejemplo, Miller y otros, 1990, Mol. Cell. Biol. 10:4239; Kolberg, 1992, J. NIH Res. 4:43; y Cornetta y otros, 1991, Hum. Gene Ther. 2:215.

En sistemas de células mamíferas, con frecuencia son adecuados los promotores de genes mamíferos o de virus mamíferos. Los promotores adecuados pueden ser constitutivos, específicos en el tipo de célula, específicos en etapa y/o modulables o regulables (por ejemplo, por mediante hormonas como glucocorticoides) . Los promotores útiles incluyen, pero no están limitados a, el promotor de metalotioneina, el principal promotor reciente constitutivo de adenovirus, el promotor de MMTV capaz de ser inducido por dexametasona, el promotor SV40, el promotor MRP polIII, el promotor constitutivo MPSV, el promotor CMV capaz de ser inducido por tetraciclina (como el promotor CMV humano prematuro inmediato) , el promotor constitutivo CMV y combinaciones de promotor-intensificador conocidas en el arte.

También pueden requerirse o desearse otros elementos de regulación para la expresión eficiente de un polinucleótido de hTRT y/o traducción de una secuencia codificando proteínas de hTRT. Para la traducción, estos elementos normalmente incluyen un codón de iniciación ATG y sitio adyacente de fijación de ribosoma u otras secuencias. Para secuencias que codifican la proteína de hTRT, siempre y cuando su codón de iniciación y secuencias de promotor corriente arriba se inserten a un vector de expresión, es posible que no se requieran señales de control de traducción u otras señales adicionales. Sin embargo, en casos donde sólo la secuencia de codificación, o una parte de la misma, se inserta, a menudo pueden proporcionarse señales de control exógenas de transcripción y/o traducción (por ejemplo, el promotor, sitio de fijación de ribosoma y codón de iniciación de ATG) . Además, el codón de iniciación normalmente debe estar en la configuración de lectura correcta para asegurar la traducción de la proteína deseada. Los elementos exógenos de transcripción y los codones de iniciación pueden ser de varios orígenes, tanto naturales, como sintéticos. Además, la eficiencia de la expresión puede intensificarse mediante la inclusión de intensificadores adecuados para el sistema de células en uso (Scharf y otros, 1994, Results Probl. Cell Differ. 20:125; y Bittner y otros, 1987, Meth. Enzymol., 153:516) . Por ejemplo, el intensificador SV40 o intensificador CMV puede usarse para aumentar la expresión en células huésped mamíferas.

La expresión de productos génicos de hTRT también pueden ser afectados (aumentados) por la activación de un promotor o intensificador de hTRT en una célula como célula humana, por ejemplo, una línea de células negativas de telomerasa. La activación puede realizarse en una variedad de formas, incluyendo la administración de un agente de activación del promotor exógeno, o la inhibición de un componente celular que suprime la expresión del gene de hTRT. Se apreciará que, a la inversa, la inhibición de la función del promotor, como se describe abajo, reducirá la expresión del gene de hTRT.

La invención proporciona una expresión capaz de ser inducida y reprimida de polipéptidos de hTRT usando dicho sistema como el Sistema de Expresión Capaz de Ser Inducido por Ecdisona (Invitrogen) y los sistemas regulados de tetraciclina Tet-On y Tet-Off de Clontech. El sistema de expresión capaz de ser inducido por ecdisona usa el análogo de ecdisona de hormona esteroide, muristerona A, para activar la expresión de una proteína recombinante a través de un receptor nuclear heterodimérico (No y otros, 1996 Proc. Natl. Acad. Sci. USA 93:3346) . En una realización de la invención, la hTRT es clonada en el vector pIND (Clontech) , el cual contiene cinco elementos de respuesta de ecdisona modificada (E/GREs) corriente arriba de un promotor de resistencia mínima al calor y golpes y el sitio de clonación múltiple. La construcción es entonces transfectada en líneas de células expresando de manera estable el receptor de ecdisona. Después de la transfección, las células son tratadas con muristerona A para inducir la expresión intracelular de pIND. En otra realización de la invención, el polipéptido de hTRT se expresa usando los sistemas de expresión Tet-on y Tet-off (Clontech) para proporcionar expresión regulada de genes de alto nivel (Gossen y otros, 1992, Proc. Natl. Acad. Sci. USA 89:5547; Gossen y otros, 1995, Science 268:1766) .

Los vectores de hTRT de la invención pueden introducirse a una célula, tejido, órgano, paciente o animal mediante una variedad de métodos. Los vectores de expresión de ácido nucleico (normalmente dsDNA) de la invención pueden ser transferidos a la célula huésped elegida por métodos bien conocidos como la transformación de cloruro de calcio (para sistemas bacterianos) , electroporación, tratamiento de fosfato de calcio, transformación mediada por liposomas, inyección y microinyección, métodos balísticos, virosomas, inmunoliposomas, conjugados de policatión:ácido nucleico, DNA descubierto, viriones artificiales, fusión a la proteína estructural del virus del herpes VP22 (Elliot y O'Hare, Cell 88:223) , absorción intensificada de agentes de DNA y transducción ex vivo. Los útiles métodos de transferencia de DNA mediada por liposomas se describen en las Patente de los Estados Unidos Números 5, 049, 386, 4, 946, 787 y 4, 897, 355; publicaciones de PCT WO 91/17424, WO 91/16024; Wang y Huang, 1987, Biochem. Biophys. Res. Commun. 147:980; Wang y Huang, 1989, Biochemistr y 28:9508; Litzinger y Huang, 1992, Biochem. Biophys. Acta 1113:201; Gao y Huang, 1991, Biochem. Biophys. Res. Commun. 179:280. Los inmunoliposomas se han descrito como portadoras de polinucleótidos exógenos (Wang y Huang, 1987, Proc. Natl. Acad. Sci. U.S.A. 84:7851; Trubetskoy y otros, 1992, Biochem. Biophys. Acta 1131:311) y pueden tener especificidad mejorada de tipo de célula en comparación con los liposomas en virtud de la inclusión de anticuerpos específicos que presumiblemente se fijan a antígenos superficiales en tipos de células específicos. Behr y otros, 1989, Proc. Natl. Acad. Sci. U.S.A. 86:6982 reportan el uso de lipopoliamina como un reactivo para mediar la transfección, sin necesidad de fosfolípido adicional para formar liposomas. Los métodos de entrega adecuados serán seleccionados por profesionales en vista de las prácticas aceptables y los requisitos de regulación (por ejemplo, para terapia génica o producción de líneas de células para la expresión de proteínas recombinantes) . Se apreciará que los métodos de entrega arriba incluidos pueden usarse para la transferencia de ácidos nucleicos a células para fines de terapia génica, transferencia a células de cultivo de tejido y similares.

Para la producción prolongada de gran rendimiento de proteínas recombinantes, a menudo se deseará la expresión estable. Por ejemplo, las líneas de células que expresan de manera estable la hTRT pueden prepararse usando vectores de expresión de la invención los cuales contienen orígenes virales de replicación o elementos de expresión endógenos y un gene de marcador seleccionable. Después de la introducción del vector, puede dejarse que las células crezcan por 1-2 días en un medio enriquecido antes de que sean cambiadas a un medio selectivo. El propósito del marcador seleccionable es conferir resistencia a la selección y su presencia permite el crecimiento de células las cuales expresan satisfactoriamente las secuencias introducidas en el medio selectivo. Las células resistentes, transfectadas de manera estable pueden proliferarse usando técnicas de cultivo de tejido adecuadas para el tipo de células. Puede incluirse un paso de amplificación, por ejemplo, por administración de metiltrexato a células transfectadas con gene de DHFR de acuerdo con métodos bien conocidos en el arte.

Además, puede elegirse una cepa de células huésped por su habilidad de modular la expresión de las secuencias insertadas o de procesar la proteína expresada en la forma deseada. Dichas modificaciones del polipéptido incluyen, pero no están limitadas a, acetilación, carboxilación, fosforilación, lipidación y acilación. El procesamiento posterior a la traducción también puede ser importante para la inserción, plegadura y/o función correcta. Las células huésped diferentes tienen maquinaria celular y mecanismos característicos específicos para cada célula para las actividades posteriores a la traducción y por lo tanto puede elegirse una célula en particular para asegurar la modificación correcta y el procesamiento de la proteína extraña introducida.

Animales transgénicos pueden ser producidos (es decir, mamíferos transgénicos para una secuencia de gene de TRT humana u otra secuencia gene de TRT) expresando un polinucleótido o polipéptido de hTRT u otro polinucleótido o polipéptido de TRT. La hTRT puede ser secretada a la lecha de un mamífero transgénico como una vaca, cabra, o conejo. Los métodos para la producción de estos animales se encuentran, por ejemplo, en Heyneker y otros, PCT WO 91/08216.

Las composiciones de proteínas y complejos de hTRT de la invención, incluyendo aquellos hechos usando los sistemas de expresión revelados arriba en el presente, pueden purificarse usando una variedad de métodos generales conocidos en el arte. Un experto en el arte reconocerá que después de la síntesis química, la expresión biológica o la purificación, la proteína de hTRT puede poseer una conformación diferente a la conformación nativa de la telomerasa que ocurre naturalmente. En algunos casos, puede ser útil o hasta necesario desnaturalizar (por ejemplo, incluyendo la reducción de disulfuro u otros ligamientos) el polipéptido y después hacer que el polipéptido vuelva a plegarse en la conformación preferida. La replegadura productiva también puede requerir la presencia de hTR (o fragmentos de hTR) . Los métodos para reducir y desnaturalizar proteínas e inducir la replegadura son bien conocidos por los expertos en el arte (vea, por ejemplo, Debinski y otros, 1993, J. Biol. Chem., 268:14065; Kreitman y Pastan, 1993, Bioconjug. Chem., 4:581; y Buchner y otros, 1992, Anal. Biochem., 205:263; y McCaman y otros, 1985, J. Biotech. 2:177) . Vea también la Publicación PCT WO 96/40868, abajo.

D) COMPLEJOS DE TRT HUMANA Y ARN DE TELOMERASA HUMANA, PROTEÍNAS ASOCIADAS CON LATELOMERASA Y OTRAS BIOMOLÉCULAS PRODUCIDAS POR COEXPRESIÓN Y OTROS MEDIOS

Los polipéptidos de hTRT de la invención pueden asociarse in vivo e in vitro con otras biomoléculas, incluyendo RNAs (por ejemplo, DNA telomérico [T2AG3]N) y nucleótidos, como trifosfatos de (deoxi) ribonucleótidos. Estas asociaciones pueden aprovecharse para analizar la presencia o función de hTRT, para identificar o purificar moléculas de hTRT o asociadas con la telomerasa y para analizar la estructura o función de hTRT o telomerasa en conformidad con los métodos de la presente invención.

En una realización, la presente invención proporciona hTRT compuesta con (por ejemplo, asociada con o fijada a) un ácido nucleico, generalmente un RNA, por ejemplo para producir una holoenzima de telomerasa. En una realización, el ARN ligado es capaz de actuar como un molde para la síntesis de DNA mediada por telomerasa. Los ejemplos de RNAs que pueden estar compuestos con el polipéptido de hTRT incluyen un ARN de telomerasa que ocurre naturalmente de célula huésped (por ejemplo, hTR; Patente de los Estados Unidos Número 5, 583, 016) , una subsecuencia o dominio de hTR, un ARN sintético, u otros RNAs. El complejo de proteínas de RNA-hTRT (un RNP) normalmente presenta una o más actividades de telomerasa, como actividades catalíticas de telomerasa. Estos RNPs de hTRT-hTR (u otros complejos de hTRT-RNA) pueden producirse por una variedad de métodos, como se describe abajo para fines ilustrativos, incluyendo reconstitución in vitro, por coexpresión de hTRT o hTR (u otro RNA) in vitro (es decir, en un sistema libre de células) , reconstitución in vivo, o reconstitución ex vivo.

De esta manera, la presente invención proporciona, en una realización, un complejo de hTRT-hTR (u otro complejo de hTRT-RNA) formado in vitro mezclando componentes purificados por separado ("reconstitución in vitro"; vea, por ejemplo, Patente de los Estados Unidos Número 5, 583, 016 para una descripción de reconstitución, vea también Autexier y otros, EMBO J. 15:5928) .

En una realización alternativa, la invención proporciona RNPs de telomerasa producidos por coexpresión del polipéptido de hTRT y un ARN (por ejemplo, hTR) in vitro en un sistema de transcripción y traducción libre de células (por ejemplo, germen de trigo o lisato de reticulocito de conejo) . Como se muestra en el Ejemplo 7, la coexpresión in vitro de un polipéptido de hTRT recombinante y hTR da como resultado la producción de actividad catalítica de telomerasa (medida por un ensayo de TRAP) .

La presente invención además proporciona RNPs de telomerasa producidos por expresión del polipéptido de hTRT en una célula, por ejemplo, una célula mamífera, en la cual la hTR se expresa naturalmente o en la cual la hTR (u otro ARN capaz de formar un complejo con la proteína de hTRT) se introduce o se expresa por medios recombinantes. De esta manera, en una realización, la hTRT se expresa en una célula humana negativa de telomerasa en la cual la hTR está presente (por ejemplo, células BJ o IMP90) , permitiendo que las dos moléculas se junten en un RNP. En otra realización, la hTRT se expresa en una célula humana o no humana en la cual la hTR se expresa de manera recombinante. Los métodos para expresión de hTR en una célula se encuentran en la Patente de los Estados Unidos 5, 583, 016. Además, un clon conteniendo un cDNA codificando el componente de telomerasa de ARN se ha colocado en depósito como pGRN33 (ATCC 75926) . Las secuencias genómicas que codifican el componente de ARN de telomerasa humana también están en depósito en el inserto de ~15 kb SauIIIA1 a HindIII del clon lambda 28-1 (ATCC 75925) . Para expresión en células eucarióticas, la secuencia de hTRT normalmente estará vinculada de manera manejable a una secuencia de iniciación de transcripción (sitio de fijación de polimerasa de RNA) y secuencias de terminación de transcripción (vea, por ejemplo, Publicación PCT WO 96/01835; Feng y otros, 1995, Science 269:1236) .

Polipéptidos de hTRT producidos de manera recombinante o substancialmente purificados pueden ser coexpresados y/o asociados con las llamadas "proteínas asociadas con la telomerasa". Por lo tanto la hTRT puede ser coexpresada o compuesta con otras proteínas (por ejemplo, proteínas asociadas con la telomerasa) . Las proteínas asociadas con la telomerasa son aquellas proteínas que se copurifican con telomerasa humana y/o que pueden desempeñar un papel en la modulación de la función o actividad de la telomerasa, por ejemplo participando en la asociación de la telomerasa con DNA telomérico. Los ejemplos de proteínas asociadas con la telomerasa incluyen (pero no están limitadas a) las siguientes proteínas y/o sus homólogos humanos: nucleolina (vea, Srivastava y otros, 1989, FEBS Letts. 250:99) ; EF2H (homólogo de alargamiento factor 2; vea Nomura y otros, 1994, DNA Res. (Japón) 1:27, Número de Admisión de GENBANK D21163) ; TP1/TLP1 (Harrington y otros, 1997, Science 275:973; Nakayama, 1997, Cell 88:875) ; el homólogo humano de p95 de Tetrahymena o p95 mismo (Collins y otros, 1995, Cell 81:677) ; TPC2 (una proteína de regulación de longitud de telómeros; número de admisión de ATCC 97708; TPC3 (también una proteína de regulación de longitud de telómeros; número de admisión de ATCC 97707; proteína B de fijación de DNA (dbpB; Horwitz y otros, 1994, J. Biol. Chem. 269:14130; y Factores de Fijación Repetitiva de Telómeros (TRF 1 y 2; Chang y otros, 1995, Science 270:1663; Chong y otros, 1997, Hum. Mol. Genet. 6:69) ; EST1, 3 y 4 (Lendvay y otros, 1996, Genetics 144:1399, Nugent y otros, 1996, Science 274:249, Lundblad y otros, 1989, Cell 57:633) ; y Factor de "casquillo de extremo" (Cárdenas y otros, 1993, Genes Dev. 7:883) .

Las proteínas asociadas con la telomerasa pueden identificarse en la base de la copurificación con, o fijación a, la proteína de hTRT o el RNP de hTRT-hTR. Alternativamente, pueden identificarse en la base de la fijación de una proteína de fusión de hTRT, por ejemplo, una proteína de fusión de GST-hTRT o similar, como la determina la purificación de afinidad (vea, Ausubel y otros, Capítulo 20) . Una técnica particularmente útil para tener acceso a las interacciones de proteína-proteína, la cual es aplicable para identificar las proteínas asociadas con la hTRT, es el método de selección de dos híbridos de Chien y otros (Proc. Natl. Acad. Sci. USA 88:9578 [1991]; vea también Ausubel y otros, arriba, en el Capítulo 20) . Esta selección identifica interacciones de proteína-proteína in vivo a través de la reconstitución de un activador de transcripción, la proteína de transcripción Gal4 de levadura (vea, Fields y Song, 1989, Nature 340:245. El método se basa en las propiedades de la proteína Gal4 de levadura, la cual consta de dominios separables responsables de la fijación de DNA y activación de transcripción. Se construyen polinucleótidos, generalmente vectores de expresión, codificando proteínas de dos híbridos. Un polinucleótido comprende el dominio de fijación de DNA de Gal4 de levadura fundido a una secuencia de polipéptidos de una proteína que se probará para una interacción de hTRT (por ejemplo, nucleolina o EF2H) . Alternativamente, el dominio de fijación de DNA de Gal4 de levadura se funde a cDNAs de una célula humana, creando así una biblioteca de proteínas humanas fundidas al dominio de fijación de DNA de Gal4 para seleccionar las proteínas asociadas con la telomerasa. El otro polinucleótido comprende el dominio de activación de Gal4 fundido a una secuencia de polipéptidos de hTRT. Las construcciones son introducidas a una célula huésped de levadura. En la expresión, la fijación intermolecular entre la hTRT y la proteína de prueba puede reconstituir el dominio de fijación de DNA de Gal4 con el dominio de activación de Gal4. Esto conduce a la activación de transcripción de un gene reportero (por ejemplo, lacZ, HIS3) vinculado de manera manejable a un sitio de fijación de Gal4. Seleccionando o analizando el reportero, pueden identificarse las colonias de genes de células que contienen una proteína de interacción de hTRT o proteína asociada con la telomerasa. los expertos apreciarán que existen numerosas variaciones de la selección de 2 híbridos, por ejemplo, el sistema LexA (Bartel y otros, 1993, en Cellular Interactions in Development: A Practical Approach (Interacciones Celulares en Desarrollo: Un Procedimiento Práctico) Ed. Hartley, D.A. (Oxford Univ. Press) pág. 153-79.

Otro método útil para identificar proteínas asociadas con la telomerasa es un sistema de tres híbridos (vea, por ejemplo, Zhang y otros, 1996, Anal. Biochem. 242:68; Licitra y otros, 1996, Proc. Natl. Acad. Sci. USA 93:12817) . El componente de ARN de telomerasa puede utilizarse en este sistema con la proteína de TRT o hTRT y una proteína de prueba. Otro método útil para identificar proteínas de interacción, particularmente (es decir, proteínas que heterodimerizan o forman heteromultimeros) , es el sistema de selección interactiva de E. coli/BCCP (vea, Germino y otros, (1993) Proc. Natl. Acad. Sci. U.S.A. 90:933; Guarente (1993) Proc. Natl. Acad. Sci. (U.S.A.) 90:1639) .

Complejos de proteínas de fijación de telómeros (las cuales pueden o no ser proteínas asociadas con la telomerasa) pueden ser producidos con hTRT (la cual puede o no estar compuesta con hTR, otros RNAs, o una o más proteínas asociadas con telomerasa) . Los ejemplos de proteínas de fijación de telómeros incluyen TRF1 y TRF2 (arriba) ; rnpA1, rnpA2, RAP1 (Buchman y otros, 1988, Mol. Cell. Biol. 8:210, Buchman y otros, 1988, Mol. Cell. Biol. 8:5086) , SIR3 y SIR4 (Aparicio y otros, 1991, Cell 66:1279) , TEL1 (Greenwell y otros, 1995, Cell 82:823; Morrow y otros, 1995, Cell 82:831) ; ATM (Savitsky y otros, 1995, Science 268:1749) , factor de "casquillo de extremo" (Cárdenas y otros, 1993, Genes Dev. 7:883) y homólogos humanos correspondientes. Los complejos antes mencionados pueden producirse generalmente como se describe arriba para los complejos de proteínas de hTRT y hTR o asociadas con la telomerasa, por ejemplo, por mezcla o coexpresión in vitro o in vivo.

V. ANTICUERPOS Y OTROS AGENTES DE FIJACIÓN

En un aspecto relacionado, la presente invención proporciona anticuerpos que son específicamente inmunoreactivos con hTRT, incluyendo anticuerpos policlonales y monoclonales, fragmentos de anticuerpos, anticuerpos de una sola cadena, anticuerpos humanos y quiméricos, incluyendo anticuerpos o fragmentos de anticuerpos fundidos a proteínas de cubierta de fagos o superficie de células y otros conocidos en el arte y descritos en el presente. Los anticuerpos de la invención pueden específicamente reconocer y fijar polipéptidos que tienen una secuencia de aminoácidos que es idéntica de manera substancial a la secuencia de aminoácidos establecida en la Figura 17 (NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) , o un fragmento inmunogénico de la misma o epítopo en la proteína definida por el mismo. Los anticuerpos de la invención pueden presentar una afinidad de fijación específica a hTRT de por lo menos alrededor de 107, 108, 109, o 1010 M-1 y pueden ser policlonales, monoclonales, recombinantes o de otra manera producidos. La invención también proporciona anticuerpos anti-hTRT que reconocen un epítopo de conformación de hTRT (por ejemplo, un epítopo en la superficie de la proteína de hTRT o un RNP de telomerasa) . Si se desea, pueden identificarse posibles epítopos de conformación mediante análisis asistido por computadora de la secuencia de proteínas de hTRT, comparación con la conformación de transcriptasas inversas relacionadas, como la subunidad p66 de HIV-1 (vea, por ejemplo, Figura 3) , o empíricamente. Los anticuerpos anti-hTRT que reconocen epítopos de conformación tienen utilidad, entre otras cosas, en la detección y purificación de telomerasa humana y en el diagnóstico y tratamiento de enfermedades humanas.

Para la producción de anticuerpos anti-hTRT, pueden inmunizarse huéspedes como cabras, borregos, vacas, cobayos, conejos, ratas, o ratones mediante la inyección de proteína de hTRT o una parte, fragmento u oligopéptido de la misma que retiene propiedades inmunogénicas. En la selección de polipéptidos de hTRT para inducción de anticuerpos, uno no necesita retener la actividad biológica; sin embargo, el fragmento de proteína, u oligopéptido debe ser inmunogénico, y de preferencia antigénico. La inmunogenicidad puede determinarse inyectando un polipéptido y adyuvante a un animal (por ejemplo, un conejo) y analizando la apariencia de anticuerpos dirigidos contra el polipéptido inyectado (vea, por ejemplo, Harlow y Lane, Antibodies: A Laborator y Manual (Anticuerpos: Un Manual de Laboratorio) , Cold Spring Harbor Laborator y , New York (1988) , el cual se incorpora en su totalidad y para todos los propósitos, por ejemplo, en el Capítulo 5) . Los péptidos usados para inducir anticuerpos específicos normalmente tienen una secuencia de aminoácidos que consta de por lo menos cinco aminoácidos, de preferencia por lo menos 8 aminoácidos, de manera más preferible por lo menos 10 aminoácidos. Generalmente imitarán o tendrán identidad substancial de secuencia a toda o una parte contigua de la secuencia de aminoácidos de laproteína de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2. Las trayectos cortos de los aminoácidos de la proteína de hTRT pueden fundirse con los aminoácidos de otra proteína, como hemocianina de lapa en U y un anticuerpo anti-hTRT producido en contra de la molécula quimérica. Dependiendo de la especie huésped, pueden usarse varios adyuvantes para aumentar la respuesta inmunológica.

El antígeno es presentado al sistema inmune de una manera determinada por métodos adecuados para el animal. Estos y otros parámetros son generalmente bien conocidos por los especialistas en inmunología. Normalmente, las inyecciones se aplican en las plantas de los pies, por vía intramuscular, intradérmica, de manera nodal en la perilinfa o intraperitoneal. Las inmunoglobulinas producidas por el huésped pueden precipitarse, aislarse y purificarse por métodos de rutina, incluyendo la purificación de afinidad.

En el Ejemplo 8 se proporcionan ejemplos ilustrativos de péptidos de hTRT inmunogénicos. Además, el Ejemplo 8 describe la producción y el uso de anticuerpo policlonales anti-hTRT.

A) ANTICUERPOS MONOCLONALES

Los anticuerpos monoclonales para proteínas y péptidos de hTRT pueden prepararse en conformidad con los métodos de la invención usando cualquier técnica que proporcione la producción de moléculas de anticuerpo por líneas de células continuas en cultivo. Estas técnicas incluyen, pero no están limitadas a, la técnica de hibridoma originalmente descrita por Koehler y Milstein (Nature 256:495 [1975]) , la técnica de hibridoma de células B humanas (Kosbor y otros, 1983, Immunol. Today 4:72; Cote y otros, 1983, Proc. Natl. Acad. Sci. USA, 80:2026) y la técnica de hibridoma de EBV (Cole y otros, Monoclonal Antibodies and Cancer Therapy (Anticuerpos Monoclonales y Terapia de Cáncer) , Alan R. Liss Inc., New York, NY, pág. 77-96 [1985]) .

En una realización, se seleccionan animales adecuados y se sigue el protocolo de inmunización correcto. La producción de anticuerpos monoclonales no humanos, por ejemplo, murino, lagomorfo, equino, es bien conocida y puede realizarse, por ejemplo, inmunizando un animal con una preparación que contiene hTRT o fragmentos de la misma. En un método, después del período de tiempo adecuado, el bazo de los animales es extirpado y las células individuales del bazo son fundidas, normalmente, a células de mieloma inmortalizadas bajo condiciones de selección adecuadas. Después, las células son separadas clonalmente y el producto sobrenadante de cada clon (por ejemplo, hibridoma) es probado para la producción de un proteína adecuado específico para la región deseada del antígeno. Las técnicas para producir anticuerpos son bien conocidas en el arte. Vea, por ejemplo, Goding y otros, Monoclonal Antibodies: Principles and Practice (Anticuerpos Monoclonales: Principios y Práctica) (Segunda edición) Acad. Press, N.Y. y Harlow y Lane, arriba, cada uno de los cuales se incorpora en su totalidad y para todos los propósitos. Otras técnicas adecuadas implican la exposición in vitro de linfocitos a los polipéptidos antigénicos o alternativamente, a la selección de bibliotecas de anticuerpos en vectores de fagos o similares (vea abajo) .

B) ANTICUERPOS HUMANOS

En otro aspecto de la invención, se proporcionan anticuerpos humanos en contra de un polipéptido de hTRT. También pueden hacerse anticuerpos monoclonales humanos en contra de un antígeno conocido usando animales transgénicos que tienen elementos de un sistema inmune humano (vea, por ejemplo, Patentes de los Estados Unidos Números 5, 569, 825 y 5, 545, 806, ambas se incorporan por referencia en su totalidad para todos los propósitos) o usando células periféricas de sangre humana (Casali y otros, 1986, Science 234:476) . Algunos anticuerpos humanos son seleccionados por experimentos de fijación competitivos, o de otra manera, por tener la misma especificidad de epítopo que un anticuerpo de ratón particular.

En una realización alternativa, pueden producirse anticuerpos humanos a un polipéptido de hTRT seleccionando una biblioteca de DNA de células B humanas de acuerdo con el protocolo general resumido por Huse y otros, 1989, Science 246:1275, el cual se incorpora por referencia. Se seleccionan anticuerpos que se fijan al polipéptido de hTRT. Las secuencias que codifican estos anticuerpos (o se fijan a fragmentos) son después clonados y amplificados. El protocolo descrito por Huse a menudo se usa con tecnología de visualización de fagos.

C) ANTICUERPOS HUMANIZADOS O QUIMÉRICOS

La invención también proporciona anticuerpos de hTRT que se hacen quiméricos, humanos o humanizados, para reducir su posible antigenicidad, sin reducir su afinidad a su objetivo. La preparación de anticuerpos quiméricos, humanos y humanizados se ha descrito en el arte (vea, por ejemplo, Patentes de los Estados Unidos Números 5, 585, 089 y 5, 530, 101; Queen y otros, 1989, Proc. Natl. Acad. Sci USA 86:10029; y Verhoeyan y otros, 1988, Science 239:1534; cada uno de los cuales se incorpora por referencia en su totalidad y para todos los propósitos) . Las inmunoglobulinas humanizadas tienen regiones de esquema variable substancialmente de una inmunoglobulina humana (llamada una inmunoglobulina aceptante) y complementariedad determinando regiones substancialmente de una inmunoglobulina no humana (por ejemplo, de ratón) (llamada la inmunoglobulina donante. La región o regiones constantes, si están presentes, son también substancialmente de una inmunoglobulina humana.

En algunas aplicaciones, como la administración a pacientes humanos, los anticuerpos humanizados (así como humanos) anti-hTRT de la presente invención ofrecen varias ventajas sobre los anticuerpos de murino u otras especies: (1) el sistema inmune humano no debería reconocer el esquema o región constante del anticuerpo humanizado como extraño y por lo tanto la respuesta del anticuerpo contra un anticuerpo inyectado tal no debería ser menor que contra un anticuerpo de ratón totalmente extraño o un anticuerpo quimérico parcialmente extraño; (2) debido a que la parte efectora del anticuerpo humanizado es humana, puede interactuar mejor con otras partes del sistema inmune humano; y (3) los anticuerpos humanizados inyectados tienen una vida media esencialmente equivalente a anticuerpos humanos que ocurren de manera natural, permitiendo dosis más pequeñas y menos frecuentes que los anticuerpos de otras especies. De acuerdo con lo implícito de lo anterior, los anticuerpos antihTRT tienen aplicaciones en el tratamiento de enfermedades, es decir, para concentrarse en células positivas de telomerasa.

D) VISUALIZACIÓN DE FAGOS

La presente invención también proporciona anticuerpos anti-hTRT (o composiciones de fijación) producidos por métodos de visualización de fagos (vea, por ejemplo, Dower y otros, WO 91/17271 y McCafferty y otros, WO 92/01047; y Vaughan y otros, 1996, Nature Biotechnology, 14:309; cada uno de los cuales se incorpora por referencia en su totalidad para todos los propósitos) . En estos métodos, se producen bibliotecas de fagos en las cuales los miembros muestran anticuerpos diferentes en su superficie exterior. Los anticuerpos generalmente se muestran como fragmentos Fv o Fab. Los anticuerpos que muestran fagos con una especificidad deseada son seleccionados por enriquecimiento de afinidad a un polipéptido de hTRT.

En una variación del método de visualización de fagos, pueden producirse anticuerpos humanizados que tienen la especificidad de fijación de un anticuerpo de murino seleccionado. En este método, la región variable de cadena pesada o ligera del anticuerpo de murino seleccionado se usa como un material inicial. Si, por ejemplo, una región variable de cadena ligera se selecciona como el material inicial, se construye una biblioteca de fagos en la cual los miembros muestran la misma región variable de cadena ligera (es decir, el material inicial de murino) y una región variable de cadena pesada diferente. Las regiones variables de cadena pesada se obtienen de una biblioteca de regiones variables humanas de cadena pesada reagrupadas. Se selecciona un fago mostrando fijación firme específica para el polipéptido de hTRT (por ejemplo, por lo menos 108 y de preferencia por lo menos 109 M-1) . La región variable humana de cadena pesada de este fago sirve entonces como un material inicial para construir otra biblioteca de fagos. En esta biblioteca, cada fago muestra la misma región variable de cadena pesada (es decir, la región identificada de la primera biblioteca de visualización) y una región variable de cadena ligera diferente. Las regiones variables de cadena ligera se obtienen de una biblioteca de regiones variables humanas de cadena ligera reagrupadas. Otra vez, se seleccionan fagos que muestra fijación firme específica. Estos fagos muestran las regiones variables de anticuerpos anti-hTRT completamente humanos. Estos anticuerpos generalmente tienen la misma especificidad de epítopo o similar que el material inicial de murino.

E) ANTICUERPOS HÍBRIDOS

La invención también proporciona anticuerpos híbridos que comparten la especificidad de anticuerpos en contra de un polipéptido de hTRT pero también son capaces de la fijación específica a una segunda mitad. En estos anticuerpos híbridos, un par de cadena pesada y ligera generalmente es de un anticuerpo anti-hTRT y el otro par de un anticuerpo elevado contra otro epítopo o proteína. Esto da como resultado la propiedad de valencia multifuncional, es decir, la habilidad de fijar por lo menos dos epítopos diferentes simultáneamente, donde por lo menos un epítopo es el epítopo al cual el anticuerpo anticomplejo se fija. Estos híbridos pueden formarse por fusión de hibridomas produciendo los anticuerpos componentes respectivos, o por técnicas recombinantes. Estos híbridos pueden usarse para llevar un compuesto (es decir, un medicamento) a una célula positiva de telomerasa (es decir, un agente citotóxico se entrega a una célula de cáncer) .

Las inmunoglobulinas de la presente invención también pueden fundirse a regiones funcionales de otros genes (por ejemplo, enzimas) para producir proteínas de fusión (por ejemplo, inmunotoxinas) teniendo útiles propiedades.

F) ANTICUERPOS ANTIIDIOTIPO

También son útiles los anticuerpos antiidiotipo los cuales pueden aislarse por los procedimientos anteriores. Los anticuerpos antiidiotipo pueden prepararse, por ejemplo, por inmunización de un animal con el anticuerpo primario (es decir, anticuerpos anti-hTRT o sus fragmentos que se fijan a hTRT) . Para anticuerpos anti-hTRT, se seleccionan anticuerpos antiidiotipo cuya fijación al anticuerpo primario es inhibida por un polipéptido de hTRT o fragmentos del mismo. Debido a que tanto el anticuerpo antiidiotipo, como el polipéptido de hTRT o sus fragmentos fijan la inmunoglobulina primaria, la inmunoglobulina antiidiotipo puede representar la "imagen interna" de un epítopo y de esta manera puede substituir el polipéptido de hTRT en ensayos o puede usarse para fijar (es decir, inactivar) los anticuerpos anti-hTRT, por ejemplo, en un paciente. Los anticuerpos antiidiotipo también pueden interactuar con proteínas asociadas con la telomerasa. La administración de estos anticuerpos puede afectar la función de la telomerasa valorando o compitiendo con la hTRT en la fijación a las proteínas asociadas con la hTRT.

G) GENERAL

Los anticuerpos de la invención pueden ser de algún isotipo, por ejemplo, IgM, IgD, IgG, IgA e IgE, con IgG, IgA e IgM a menudo preferidos. Los anticuerpos humanizados pueden comprender secuencias de más de una clase o isotipo.

En otra realización de la invención, se proporcionan fragmentos de los anticuerpos intactos arriba descritos. Normalmente, estos fragmentos pueden competir con el anticuerpo intacto del cual se derivaron para fijación específica al polipéptido de hTRT y fijarse con una afinidad de por lo menos 107, 108, 109 ó 1010 M-1, o 1010 M-1. Los fragmentos de anticuerpos incluyen cadenas pesadas separadas, cadenas ligeras Fab, Fab' F (ab') 2, Fabc y Fv. Los fragmentos pueden producirse por separación enzimática o química de inmunoglobulinas intactas. Por ejemplo, un fragmento de F (ab') 2 puede obtenerse de una molécula IgG por digestión proteolítica con pepsina con pH 3.0-3.5 usando métodos estándar como los que se describen en Harlow y Lane, arriba. Los fragmentos de Fab pueden obtenerse de fragmentos de F (ab') 2 por reducción limitada, o de anticuerpo entero por digestión con papaína en la presencia de agentes reductores (vea generalmente, Paul, W., ed. Fundamental Immunology 2nd Edition (Inmunología Fundamental, Segunda Edición) , Raven Press, N.Y., 1989, Capítulo 7, incorporado por referencia en su totalidad para todos los propósitos) . Los fragmentos también pueden producirse por técnicas de DNA recombinante. Los segmentos de ácidos nucleicos codificando fragmentos seleccionados son producidos por digestión de secuencias de codificación de tamaño natural con enzimas de restricción, o por síntesis de nuevo. Con frecuencia los fragmentos son expresados en forma de proteínas de fusión con cubierta de fagos.

Muchas de las inmunoglobulinas arriba descritas pueden sufrir substituciones, adiciones o supresiones de aminoácidos no críticas en regiones tanto variables, como constantes, sin pérdida de especificidad de fijación o funciones de efector, o reducción intolerable de la afinidad de fijación (es decir, abajo de aproximadamente 107 M-1) . Generalmente, las inmunoglobulinas que incorporan dichas alteraciones presentan identidad de secuencia substancial a una inmunoglobulina de referencia de la cual se derivaron. Puede seleccionarse una inmunoglobulina mutada teniendo la misma especificidad y mayor afinidad comparada con una inmunoglobulina de referencia de la cual se derivó. La tecnología de visualización de fagos ofrece útiles técnicas para seleccionar dichas inmunoglobulinas. Vea, por ejemplo, Dower y otros, WO 91/17271 McCafferty y otros, WO 92/01047; y Huse, WO 92/06204.

Los anticuerpos de la presente invención pueden usarse con o sin modificación. Con frecuencia, los anticuerpos serán etiquetados uniendo, de manera covalente o no covalente, una etiqueta detectable. Como las entidades de fijación etiquetadas, los anticuerpos de la invención son particularmente útiles en aplicaciones de diagnóstico.

Los anticuerpos anti-hTRT de la invención pueden purificarse usando métodos bien conocidos. Los anticuerpos enteros, sus dímeros, cadenas individuales ligeras y pesadas, u otras formas de inmunoglobulinas de la presente invención pueden purificarse usando los métodos y reactivos de la presente invención en conformidad con procedimientos estándar del arte, incluyendo precipitación de sulfato de amonio, columnas de afinidad, cromatografía de columnas, electrofóresis de gel y similares (vea generalmente Scopes, Protein Purification: Principles and Practice 3rd Edition (Purificación de Proteínas: Principios y Práctica, Tercera Edición) (Springer-Verlag, N.Y., 1994) ) . Se prefieren inmunoglobulinas substancialmente puras de por lo menos alrededor de 90% a 95%, o hasta 98 a 99% o más homogeneidad.

VI. PURIFICACIÓN DE TELOMERASA HUMANA

La presente invención permite telomerasa humana aislada de pureza sin precedentes. En particular, la presente invención permite: hTRT purificada de origen recombinante o no recombinante; complejos de hTRT-hTR purificada (es decir, RNPs) de origen recombinante, no recombinante, o mixto, opcionalmente comprendiendo una o más proteínas asociadas con la telomerasa; telomerasa humana purificada que ocurre de manera natural; y similares. Además, la invención proporciona métodos y reactivos para purificar de una manera parcial, substancial o aumentada las moléculas y complejos anteriores, incluyendo variantes, proteínas de fusión, proteínas que ocurren naturalmente y similares (llamados en conjunto como "hTRT y/o complejos de hTRT") .

Antes de la presente revelación, se han hecho intentos por purificar el complejo de enzimas de telomerasa para la homogeneidad que se había cumplido con éxito limitado. Los métodos proporcionados en las aplicaciones antes incluidas proporcionan purificación de la telomerasa por aproximadamente hasta 60, 000 pliegues o más en comparación con extractos celulares crudos. La presente invención proporciona hTRT y complejos de hTRT de pureza aún mayor, en parte, en virtud de los nuevos reactivos de inmunoafinidad (por ejemplo, anticuerpos antihTRT) de la presente invención y/o los reactivos, células y métodos proporcionados en el presente para expresión recombinante de hTRT. La expresión recombinante de hTRT y complejos de hTRT facilita la purificación debido a que pueden producirse las moléculas deseadas en niveles mucho más altos que los encontrados en la mayoría expresando células que ocurren de manera natural y/o debido a que puede modificarse la molécula de hTRT recombinante (por ejemplo, por fusión con un rótulo de epítopo) de tal manera que puede purificarse fácilmente.

Se reconocerá que la telomerasa que ocurre naturalmente puede purificarse de una célula positiva de telomerasa y la hTRT recombinante y complejos de hTRT pueden expresarse y purificarse, entre otras cosas, usando alguno de los sistemas de expresión in vitro, in vivo, ex vivo, o plantas o de animales revelados arriba, u otros sistemas conocidos en el arte.

La hTRT, telomerasa y otras composiciones de la invención pueden ser purificadas usando un paso de inmunoafinidad, solo o en combinación con otros pasos de purificación. Normalmente, un anticuerpo anti-hTRT inmovilizado o inmovilizable, proporcionado por la presente invención, está en contacto con una muestra, como un lisato de células, que contiene la hTRT deseada o el complejo que contiene hTRT bajo condiciones en las cuales un anticuerpo anti-hTRT se fija al antígeno de hTRT. Después de la eliminación de los componentes no fijados de la muestra por métodos bien conocidos en el arte, la composición de hTRT puede eluirse, si se desea, del anticuerpo, en forma substancialmente pura. Los métodos de cromatografía de inmunoafinidad bien conocidos en el arte pueden utilizarse (vea, por ejemplo, Harlow y Lane, arriba; y Ausubel, arriba; Hermansan y otros, 1992, Immobilized Affinity Ligand Techniques (Academic Press, San Diego) ) . La inmunoprecipitación de complejos de hTRT de inmunoglobulina anti-hTRT puede realizarse usando Proteína A inmovilizada. Los expertos conocen muy bien las numerosas variaciones y los protocolos de purificación de inmunoafinidad alternativos adecuados para uso en conformidad con los métodos y reactivos de la invención.

Las proteínas de hTRT recombinante pueden, como una consecuencia de su alto nivel de expresión, purificarse usando métodos de purificación de proteína de rutina, como precipitación de sulfato de amonio, columnas de afinidad (por ejemplo, inmunoafinidad) , exclusión de tamaño, cromatografía de intercambio de aniones y cationes, electrofóresis de gel y similares (vea, generalmente, R. Scopes, Protein Purification (Purificación de Proteínas) , Springer-Verlag, N.Y. (1982) y Deutscher, Methods in Enzymology Vol. 182: Guide to Protein Purification (Métodos en Enzimología Vol. 182: Guía para la Purificación de Proteínas) , Academic Press, Inc. N.Y. (1990) ) en lugar, o además de métodos de inmunoafinidad. Los métodos de intercambio de cationes pueden ser particularmente útiles debido al pI básico de la proteína de hTRT. Por ejemplo, el fosfato inmovilizado puede usarse como un grupo funcional de intercambio de cationes (por ejemplo, P-11 Fosfocelulosa, catálogo Whatman #4071 o Fosfato de Celulosa, catálogo Sigma #C 3145) . El fosfato inmovilizado tiene dos características ventajosas de la purificación de hTRT - es una resina de intercambio de cationes y muestra parecido físico a la columna vertebral de fosfato del ácido nucleico. Esto puede permitir la cromatografía de afinidad ya que la hTRT fija la hTR y DNA telomérico. Otros métodos de cromatografía de afinidad de ácido nucleico no específico o específico también son útiles para la purificación (por ejemplo, Alberts y otros, 1971, Methods Enzymol. 21:198; RNAt-Jovin y otros, 1975, Eur. J. Biochem. 54:411; catálogo de Pharmacia #27-5575-02) . El aprovechamiento adicional de esta función de fijación de la hTRT podría incluir el uso de cromatografía de afinidad de ácido nucleico específico (por ejemplo, iniciador de telomerasa o hTR) para purificación (Chodosh y otros, 1986, Mol. Cell. Biol. 6:4723; Wu y otros, 1987, Science 238:1247; Kadonaga, 1991, Methods Enzymol. 208:10) ; el Tinte Azul Cibricon inmovilizado, el cual muestra parecido físico a los nucleótidos, es otra resina útil para la purificación de hTRT (catálogo de Pharmacia #17-0948-01 o catálogo de Sigma #C 1285) , debido a la fijación de hTRT de los nucleótidos (por ejemplo, como substratos para síntesis de DNA) .

Las proteínas de hTRT pueden ser aisladas directamente de un sistema de expresión in vitro o in vivo en el cual otros componentes de telomerasa no son coexpresados. Se reconocerá que la proteína de hTRT aislada también puede obtenerse fácilmente de la telomerasa humana o complejos de hTRT purificados, por ejemplo, rompiendo el RNP de telomerasa (por ejemplo, por la exposición a un desnaturalizante leve u otro y separando los componentes de RNP (por ejemplo, por medios de rutina como cromatografía o cromatografía de inmunoafinidad) .

La purificación de la telomerasa puede ser supervisada usando un ensayo de actividad de telomerasa (por ejemplo, el ensayo de TRAP, ensayo convencional, o ensayo de fijación de iniciador) , midiendo el enriquecimiento de hTRT (por ejemplo, por ELISA) , midiendo el enriquecimiento de hTR, u otros métodos conocidos en el arte.

La telomerasa humana, las proteínas de hTRT y los complejos de hTRT purificados permitidos por la presente invención pueden ser altamente purificados (es decir, por lo menos alrededor del 90% de homogeneidad, más a menudo por lo menos alrededor de 95% de homogeneidad) . La homogeneidad puede determinarse por medios estándar como electrofóresis de gel de SDS-poliacrilamida y otros medios conocidos en el arte (vea, por ejemplo, Ausubel y otros, arriba) . Se entenderá que, aunque algunas veces se deseen telomerasa humana, proteína de hTRT, o complejos de hTRT altamente purificados, la telomerasa humana, la proteína de hTRT, o los complejos de hTRT substancialmente purificados (por ejemplo, al menos alrededor de 75% de homogeneidad) o purificados de manera parcial (por ejemplo, al menos alrededor de 20% de homogeneidad) son útiles en muchas aplicaciones. Por ejemplo, la telomerasa parcialmente purificada es útil para seleccionar compuestos de prueba para la actividad de modulación de telomerasa y otros usos (vea, abajo y arriba; vea la Patente de los Estados Unidos Número 5, 645, 986) .

VII. TRATAMIENTO DE ENFERMEDAD RELACIONADA CON LA TELOMERASA

A) INTRODUCCIÓN

Los polinucleótidos, polipéptidos y anticuerpos de hTRT son útiles para el tratamiento de enfermedades humanas y condiciones de enfermedades. Los productos génicos de hTRT recombinante y sintética (proteína y mRNA) de la invención pueden usarse para crear o elevar la actividad de telomerasa en una célula, así como inhibir la actividad de telomerasa en células en las cuales no se desea. Por lo tanto, la inhibición, activación o de otra manera la alteración de una actividad de telomerasa (por ejemplo, actividad catalítica de telomerasa, fidelidad, procesabilidad, fijación de telómeros, etc.) en una célula pueden usarse para cambiar la capacidad de proliferación de la célula. Por ejemplo, la reducción de la actividad de telomerasa en una célula inmortal, como una célula de tumor maligno, puede volver mortal la célula. A la inversa, el aumento de la actividad de telomerasa en una célula mortal (por ejemplo, la mayoría de células somáticas humanas) puede aumentar la capacidad de proliferación de la célula. Por ejemplo, la expresión de la proteína de hTRT en fibroblastos dérmicos, aumentando con ello la longitud de telómeros, dará como resultado mayor capacidad de proliferación de los fibroblastos; dicha expresión puede retrasar o invertir el retraso dependiente de la edad del cierre de la herida (vea, por ejemplo, West, 1994, Arch. Derm. 130:87) .

La presente memoria de patente describe reactivos y métodos útiles para probar enfermedades y condiciones caracterizadas por la presencia, ausencia, o cantidad de actividad de telomerasa humana en una célula y que son susceptibles al tratamiento que usa las composiciones y métodos revelados en el presente. Estas enfermedades incluyen, como se describe abajo de una manera más completa, cánceres, otras enfermedades de proliferación celular (particularmente enfermedades de envejecimiento) , trastornos inmunológicos, infertilidad (fertilidad) y otras.

B) TRATAMIENTO DE CÁNCER

Existen varias composiciones para reducir la actividad de telomerasa en células de tumor y para tratar cáncer. Las composiciones incluyen oligonucleótidos antisentido, péptidos, vectores de terapia génica codificando oligonucleótidos antisentido o proteínas que alteran la actividad y anticuerpos anti-hTRT. Las células de cáncer (por ejemplo, células de tumor maligno) que expresan actividad de telomerasa (células positivas de telomerasa) pueden mortalizarse disminuyendo o inhibiendo la actividad de telomerasa endógena. Además, debido a que los niveles de telomerasa se correlacionan con enfermedades características como potencial metastático (por ejemplo, Patente de los Estados Unidos Número 5, 639, 613; 5, 648, 215; 5, 489, 508; Pandita y otros, 1996, Proc. Am. Ass. Cancer Res. 37:559) , cualquier reducción en la actividad de telomerasa podría reducir la naturaleza agresiva de un cáncer a un estado de enfermedad más manejable (aumentando la eficacia de intervenciones tradicionales) .

Las composiciones y métodos pueden ser útiles para el tratamiento de cánceres de una amplia variedad de tipos, incluyendo tumores sólidos y leucemias. Los tipos de cáncer que pueden tratarse incluyen (pero no están limitados a) : adenocarcinoma del pecho, próstata y colon; todas las formas de carcinoma broncogénico del pulmón; mieloide; melanoma; hepatoma; neuroblastoma; papiloma; apudoma; coristoma; branquioma; síndrome carcinoide maligno; insuficiencia cardíaca carcinoide; carcinoma (por ejemplo, Walker, célula básica, Brown-Pearce, del conducto, tumor Ehrlich, in situ, Krebs 2, célula Merkel, mucinoso, pulmón de células no pequeñas, célula en grano de avena, papilar, escirroso, bronquiolar, broncogénico, célula escamosa y célula de transición) , trastornos histiocíticos; leucemia (por ejemplo, célula B, célula mixta, célula nula, célula T, crónica de célula T, asociada con HTLV-II, linfocítica aguda, linfocítica crónica, célula cebada y mieloide) ; histiocitosis maligna; síndrome de Hodgkin; pequeño inmunoproliferativo; linfoma no de Hodgkin; plasmacitoma; reticuloendoteliosis; melanoma; condroblastoma; condroma; condrosarcoma; fibroma; fibrosarcoma; tumores celulares gigantes; histiocitoma; lipoma; liposarcoma; mesotelioma; mixoma; mixosarcoma; osteoma; osteosarcoma; sarcoma de Ewing; sinovioma; adenofibroma; adenolinfoma; carcinosarcoma; cordoma; craneofaringioma; disgerminoma; hamartoma; mesenquimoma; mesonefroma; miosarcoma; ameloblastoma; cementoma; odontoma; teratoma; timoma; tumor trofoblástico; adenocarcinoma; adenoma; colangioma; colesteatoma; cilindroma; cistadenocarcinoma; cistadenoma; tumor celular granuloso; ginandroblastoma; hepatoma; hidradenoma; tumor celular de islote; tumor de célula de Leydig; papiloma; tumor de célula de Sertoli; leiomioma; leiomiosarcoma; mioblastoma; mioma; miosarcoma; rabdomioma; rabdomiosarcoma; ependimoma; ganglioneuroma; glioma: meduloblastoma; meningioma; neurilemoma; neuroblastoma; neuroepitelioma; neurofibroma; neuroma; paraganglioma; paraganglioma no cromafín; angioqueratoma; hiperplasia angiolinfoide con eosinofilia; angioma esclerosante; angiomatosis; glomangioma; hemangioendotelioma; hemangioma; hemangiopericitoma; hemangiosarcoma; linfangioma; linfangiomioma; linfangiosarcoma; pinealoma; carcinosarcoma; condrosarcoma; filodios de cistosarcoma; fibrosarcoma; hemangiosarcoma; leiomiosarcoma; leucosarcoma; liposarcoma; linfangiosarcoma; miosarcoma; mixosarcoma; carcinoma ovárico; rabdomiosarcoma; sarcoma (por ejemplo, experimental de Ewing, de Kaposi y célula cebada) ; neoplasmas (por ejemplo, hueso, pecho, sistema digestivo, colorectal, hígado, pancreático, pituitaria, testicular, orbital, cabeza y cuello, sistema central nervioso, acústico, pélvico, vía respiratoria y urogenital) ; neurofibromatosis y displasia cervical) . Se puede concebir unas composiciones y métodos útiles para el tratamiento de otras condiciones en las cuales las células se han vuelto inmortalizadas o hiperproliferativas, por ejemplo, por "desregulación" (por ejemplo, expresión anormalmente alta) de hTRT, enzima de telomerasa, o actividad de telomerasa.

Las composiciones y métodos para la prevención de cánceres, incluyen vacunas de hTRT, vectores de terapia génica que previenen la activación de la telomerasa y vectores de terapia génica que dan como resultado la muerte específica de células positivas de telomerasa. Los métodos de terapia de reemplazo de genes abajo descritos pueden usarse para "tratar" una predilección genética para cánceres.

C) TRATAMIENTO DE OTRAS CONDICIONES

Las composiciones y métodos pueden ser útiles para el tratamiento de enfermedades y condiciones de enfermedades (además de cánceres) caracterizadas por expresión deficiente o excesiva de telomerasa o productos génicos de hTRT. Los ejemplos incluyen: enfermedades de proliferación celular, enfermedades resultantes de la senectud de células (particularmente de enfermedades de envejecimiento) , trastornos inmunológicos, infertilidad, enfermedades de disfunción inmune y otros.

Ciertas enfermedades de envejecimiento son caracterizadas por los cambios asociados con la senectud de células debido a la longitud reducida de telómeros (en comparación con las células más jóvenes) , resultante de la ausencia (o niveles mucho más bajos) de la actividad de telomerasa en la célula. La longitud disminuida de telómeros y la capacidad reducida de replicación contribuyen a enfermedades como las descritas más adelante. La actividad de telomerasa y la longitud de telómeros pueden aumentarse, por ejemplo, aumentando los niveles de productos génicos de hTRT (proteína y mRNA) en la célula. Una lista parcial de condiciones asociadas con la senectud celular en la cual la expresión de hTRT puede ser terapéutica incluye síndrome de Alzheimer, síndrome de Parkinson, síndrome de Huntington y apoplejía; enfermedades relacionadas con la edad del integumento como atrofia dérmica, elastólisis y arrugamiento de la piel, hiperplasia de la glándula sebácea, lentigo senil, cabello canoso y pérdida del cabello, úlceras crónicas de la piel y deterioro de sanación de heridas relacionado con la edad; enfermedad degenerativa de las articulaciones; osteoporosis; deterioro del sistema inmune relacionado con la edad (por ejemplo, implicando células como linfocitos B y T, monocitos, neutrófilos, eosinófilas, basófilos, células NK y sus respectivos progenitores) ; enfermedades relacionadas con la edad del sistema vascular incluyendo ateroesclerosis, calcificación, trombosis y aneurismas; diabetes, atrofia muscular, enfermedades respiratorias, enfermedades del hígado y sistema GI, enfermedades metabólicas, enfermedades endocrinas (por ejemplo, trastornos de la glándula pituitaria y suprarrenal) , enfermedades de reproducción y degeneración macular relacionada con la edad. Estas enfermedades y condiciones pueden tratarse aumentando los niveles de productos génicos de hTRT en la célula para aumentar la longitud de telómeros, restaurando o impartiendo así mayor capacidad de replicación a la célula. Estos métodos pueden realizarse en células cultivadas ex vivo o células in vivo. Las células pueden ser primeramente tratadas para activar la telomerasa y alargar los telómeros y después tratadas para inactivar el gene de hTRT y la actividad de telomerasa. La actividad de telomerasa puede ser generada por un vector de la invención en un germen embriónico o célula impulsora antes o durante la diferenciación.

Los métodos y composiciones pueden ser útiles para tratar la infertilidad. Las células germinales humanas (por ejemplo, células de espermogonias, sus progenitores o descendientes) son capaces de proliferación indefinida y se caracterizan por alta actividad de telomerasa. Los niveles anormales o disminuidos de productos génicos de hTRT pueden dar como resultado, por ejemplo, la producción inadecuada o anormal de espermatozoides, ocasionando infertilidad o trastornos de reproducción. En consecuencia, la infertilidad "basada en telomerasa" puede tratarse usando los métodos y composiciones descritos en el presente para aumentar los niveles de telomerasa. Del mismo modo, debido a que la inhibición de la telomerasa puede afectar negativamente la espermatogénesis, oogénesis y viabilidad de esperma y óvulo, composiciones inhibidoras de telomerasa pueden tener efectos de contracepción cuando se usan para reducir los niveles de productos génicos de hTRT en las células germinales.

Los métodos y composiciones pueden ser útiles para disminuir el potencial de proliferación de las células positivas de telomerasa como los linfocitos activados y células impulsoras hematopoyéticas reduciendo la actividad de telomerasa. Por lo tanto, la inmunosupresión puede ser afectada. Los métodos y reactivos de la invención son útiles para aumentar la actividad de telomerasa y potencial de proliferación en las células, como células impulsoras, que expresan un nivel bajo de telomerasa o nada de telomerasa antes de la intervención terapéutica.

D) MODOS DE INTERVENCIÓN

Como es evidente de la discusión anterior, la modulación del nivel de telomerasa o la actividad de telomerasa de una célula puede tener un efecto profundo en el potencial de proliferación de la célula y por lo tanto tiene gran utilidad en el tratamiento de enfermedades. Como también es evidente, esta modulación puede ser una disminución en la actividad de telomerasa o un aumento en la actividad. Las moléculas de modulación de telomerasa proporcionadas por medio de la operación de la invención pueden actuar a través de una cantidad de mecanismos; algunas de estas moléculas se describen aquí y más adelante para ayudar al médico a seleccionar los agentes terapéuticos. Sin embargo, los solicitantes no pretenden estar limitados a un mecanismo de acción en particular para los nuevos compuestos terapéuticos, composiciones y métodos descritos en el presente.

La actividad de telomerasa puede disminuirse a través de uno de varios mecanismos o combinaciones de mecanismos. Un mecanismo es la reducción de la expresión de gene de hTRT para reducir la actividad de telomerasa. Esta reducción puede estar en el nivel de transcripción del gene de hTRT en mRNA, procesando (por ejemplo, empalmando) transporte nuclear o estabilidad de mRNA, traducción de mRNA para producir proteína de hTRT, o estabilidad y función de la proteína de hTRT. Otro mecanismo es la interferencia con una o más actividades de telomerasa (por ejemplo, la actividad catalítica de transcriptasa inversa, o la actividad de fijación de hTR) usando ácidos nucleicos inhibidores, polipéptidos, u otros agentes (por ejemplo, mimetismo, moléculas pequeñas, medicamentos y pro-medicamentos) que pueden identificarse usando los métodos, o son proporcionadas por composiciones, reveladas en el presente. Otros mecanismos incluyen el secuestro de hTR y/o proteínas asociadas con la telomerasa y la interferencia con la unión de RNP de telomerasa de sus subunidades componentes. En un mecanismo relacionado, una secuencia de promotor de hTRT se vincula de manera manejable a un gene que codifica una toxina y se introduce a una célula; si o cuando los activadores de transcripción de hTRT son expresados o activados en la célula; la toxina se expresará, dando como resultado la destrucción de células específicas.

Un método relacionado para reducir la capacidad de proliferación de una célula implica la introducción de una variante de hTRT con baja fidelidad (es decir, una con porcentaje de error alto, por ejemplo, mayor que 1%) de tal manera que las repeticiones teloméricas aberrantes son sintetizadas. Estas repeticiones aberrantes afectan la fijación de proteínas y ocasionan reagrupaciones y aberraciones cromosómicas y conducen a la muerte de las células.

Del mismo modo, la actividad de telomerasa puede aumentarse a través de uno de varios mecanismos, o una combinación de mecanismos. Estos mecanismos incluyen el aumento de la cantidad de hTRT en una célula. Generalmente esto se realiza introduciendo un polinucleótido que codifica un polipéptido de hTRT a la célula (por ejemplo, un polipéptido producido de manera recombinante que comprende una secuencia de DNA de hTRT vinculada de manera manejable a un promotor, o un mRNA estable de hTRT) . Alternativamente, un polipéptido catalíticamente activo de hTRT puede introducirse a una célula o tejido, por ejemplo, por microinyección u otros medios conocidos en el arte. En otros mecanismos, puede aumentarse la expresión del gene de hTRT endógena o la estabilidad de los productos génicos de hTRT en la célula. La actividad de telomerasa en una célula también puede ser aumentada interfiriendo en la interacción de los inhibidores de telomerasa endógena y el RNP de telomerasa, o represores de transcripción de hTRT endógena y el gene de hTRT; aumentando la expresión o actividad de los activadores de transcripción de hTRT; y otros medios aparentes para los expertos en la revisión de esta revelación.

E) AGENTES DE INTERVENCIÓN

1) PROTEÍNAS Y PÉPTIDOS DE TRT

La invención permite polipéptidos de modulación de telomerasa (es decir, proteínas, polipéptidos y péptidos) que aumentan o reducen la actividad de la telomerasa los cuales pueden introducirse a una célula de objetivo directamente (por ejemplo, por inyección, fusión mediada por liposomas, aplicación de un hidrogel a la superficie del tumor [por ejemplo, melanoma], fusión o unión a la proteína VP22 estructural del virus del herpes y otros medios descritos en el presente y conocidos en el arte) . Las proteínas y péptidos de modulación de telomerasa pueden expresarse en una célula introduciendo un ácido nucleico (por ejemplo, vector de expresión de DNA o mRNA) codificando la proteína o péptido deseado en la célula. La expresión puede ser constitutiva o capaz de ser inducida dependiendo del vector y la elección del promotor (vea más adelante la discusión) . Las preparaciones de ARN mensajero codificando la hTRT son especialmente útiles cuando sólo se desea la expresión temporal (por ejemplo, activación temporal de la telomerasa) . Los métodos para la introducción y expresión de ácidos nucleicos en una célula son bien conocidos en el arte (también, vea en otra parte en esta especificación, por ejemplo, capítulos sobre oligonucleótidos, métodos de terapia génica) .

Polipéptidos de modulación de la telomerasa que aumentan la actividad de telomerasa en una célula incluyen los polipéptidos que son polipéptidos catalíticamente activos de hTRT capaces de dirigir la síntesis (en conjunto con un molde de ARN como hTR) de DNA telomérico humano. Esta actividad puede medirse, como se discute arriba, por ejemplo, usando un ensayo de actividad de telomerasa como un ensayo de TRAP. En una realización, el polipéptido es una proteína de hTRT de tamaño natural, teniendo una secuencia de, o substancialmente idéntica a, la secuenciade 1132 residuos de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2. En otra realización, el polipéptido es una variante de la proteína de hTRT de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2, como un polipéptido de fusión, polipéptido derivado, polipéptido truncado, polipéptido substituido de manera conservadora, polipéptido modificado en actividad, o similares. Una proteína de fusión o derivada puede incluir una mitad de objetivo que aumenta la habilidad del polipéptido para cruzar una membrana celular u ocasiona que el polipéptido sea entregado a un tipo especificado de célula (por ejemplo, células de hígado o células de tumor) preferentemente o compartimento celular (por ejemplo, compartimento nuclear) preferentemente. Los ejemplos de mitades incluyen colas de lípidos, secuencias de aminoácidos como péptido de antenapedia o una señal de localización nuclear (NLS; por ejemplo, nucleoplasma de Xenopus, Robbins y otros, 1991, Cell 64:615) . La proteína de hTRT que ocurre naturalmente (por ejemplo, teniendo una secuencia de, o substancialmente idéntica a, NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) actúa en el núcleo de la célula. De esta manera, es probable que una o mássubsecuencias de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2, como residuos 193-196 (PRRR) y residuos 235-240 (PKRRRR) actúen como una señal de localización nuclear. Es probable que las regiones pequeñas se basen en la observación de que muchos NLSs comprenden un patrón de 4 residuos compuesto de aminoácidos básicos (K o R) , o compuesto de tres aminoácidos básicos (K o R) y H o P; un patrón comenzando con P y seguida dentro de 3 residuos por un segmento básico conteniendo 3 residuos K o R de 4 residuos (vea, por ejemplo, Nakai y otros, 1992, Genomics 14:897) . Se espera que la supresión de una o ambas secuencias y/o secuencias de localización adicionales interfiera en el transporte de la hTRT al núcleo y/o aumente la producción de hTRT y sea útil para evitar el acceso de la telomerasa a sus substratos nucleares y disminuir el potencial de proliferación. Además, un polipéptido de hTRT de variante que carece de NLS puede unirse a un RNP que no será capaz de mantener la longitud de telómeros, debido a que la enzima resultante no puede entrar al núcleo.

Los polipéptidos de hTRT caracteristicos de la invención normalmente estarán asociados en la célula de objetivo con un ARN de telomerasa, como hTR, en especial cuando se usan para aumentar la actividad de la telomerasa en una célula. Un polipéptido de hTRT introducido puede asociarse con una hTR endógena para formar un RNP catalíticamente activo (por ejemplo, un RNP comprendiendo la hTR y un polipéptido de tamaño natural teniendo una secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2) . El RNP así formado también puede asociarse con otras proteínas, por ejemplo proteínas asociadas con la telomerasa. Alternativamente el RNP de telomerasa (conteniendo proteína de hTRT, hTR y opcionalmente otros componentes) puede ser introducido como un complejo a la célula de objetivo.

Un vector de expresión de hTRT se introduce a una célula (o progenie de una célula) a la cual un vector de expresión de ARN de telomerasa (por ejemplo, hTR) se introduce de manera simultánea o subsecuente, o se ha introducido previamente. La proteína de hTRT y el ARN de telomerasa son coexpresados en la célula y se unen para formar un RNP de telomerasa. Un ARN de telomerasa preferido es la hTR. Un vector de expresión útil para la expresión de hTR en una célula se describe arriba (vea Patente de los Estados Unidos Número 5, 583, 016) . Alternativamente, el polipéptido de hTRT y ARN de hTR (o equivalente) se asocian in vitro para formar un complejo, el cual después se introduce a las células de objetivo, por ejemplo, por transferencia mediada por liposomas.

Unos polipéptidos de hTRT pueden ser útiles para reducir la actividad de la telomerasa en una célula. Como arriba, estos polipéptidos "inhibidores" pueden introducirse directamente, o por expresión de ácidos nucleicos recombinantes en la célula. Se reconocerá que los péptidos miméticos o polipéptidos que comprenden aminoácidos no estándar (es decir, distintos a los 20 aminoácidos codificados por el código genético o sus derivados normales) normalmente se introducirán de manera directa.

La inhibición de la actividad de telomerasa puede resultar del secuestro de un componente requerido para alargamiento preciso de telómeros. Los ejemplos de dichos componentes son hTRT y hTR. Por lo tanto, la administración de un polipéptido que fija hTR, pero que no tiene actividad catalítica de telomerasa, puede reducir la actividad de telomerasa endógena en la célula. En una realización relacionada, el polipéptido de hTRT puede fijar un componente celular distinto a la hTR, como una o más proteínas asociadas con la telomerasa, interfiriendo con ello en la actividad de telomerasa en la célula.

Por lo tanto, unos polipéptidos de hTRT interfieren (por ejemplo, por competencia) en la interacción de proteína de hTRT expresada de manera endógena y otro componente celular requerido para la función de la telomerasa, como hTR, DNA telomérico, proteínas asociadas con telomerasa, proteínas asociadas con telómeros, telómeros, proteínas de control del ciclo celular, enzimas de reparación de DNA, proteínas cromosómicas histónicas y no histónicas, u otros.

En la selección de moléculas (por ejemplo, polipéptidos) que afectan la interacción de la proteína de hTRT expresada de manera endógena y otros componentes celulares, uno puede preferir moléculas que incluyan uno o más de los motivos conservados de la proteína de hTRT, como se describe en el presente. La conservación evolutiva de estas regiones indica la función importante en el correcto funcionamiento de la telomerasa humana contribuida por estos motivos y por lo tanto los motivos generalmente son sitios útiles para cambiar la función de las proteínas de hTRT para crear proteínas de hTRT de variante. De esta manera, los polipéptidos de hTRT de variante que tienen mutaciones en motivos conservados serán particularmente útiles para algunas aplicaciones.

La expresión del gene de hTRT endógena es reprimida por la introducción a la célula de una gran cantidad de polipéptido de hTRT (por ejemplo, normalmente por lo menos alrededor de 2 pliegues más que el nivel endógeno, más a menudo por lo menos alrededor de 10 a 100 pliegues) el cual actúa a través de un ciclo de retroalimentación para inhibir la transcripción del gene de hTRT, el procesamiento del mRNA de hTRT, la traducción del mRNA de hTRT, o unión o transporte de la RNP de telomerasa.

2) OLIGONUCLEÓTIDOS

a) CONSTRUCCIONES ANTISENTIDO

Los reactivos de oligonucleótidos o polinucleótidos antisentido pueden usarse para reducir la expresión de productos génicos de hTRT in vitro o in vivo. La administración de los reactivos antisentido a una célula de objetivo da como resultado actividad de telomerasa reducida y es particularmente útil para el tratamiento de enfermedades caracterizadas por la alta actividad de la telomerasa (por ejemplo, cánceres) . Sin pretender estar limitados a un mecanismo en particular, se cree que los oligonucleótidos antisentido se fijan al mRNA de hTRT con sentido e interfieren en la traducción del mismo. Alternativamente, la molécula antisentido puede volver el mRNA de hTRT susceptible a la digestión de la nucleasa, interferir en la transcripción, interferir en el procesamiento, localización o de otra manera en los precursores de ARN ("pre-mRNA") , reprimir la transcripción de mRNA del gene de hTRT, o actuar a través de algún otro mecanismo. Sin embargo, este mecanismo particular por el cual la molécula antisentido reduce la expresión de hTRT no es crítico.

Los polinucleótidos antisentido comprenden una secuencia antisentido de por lo menos 7 a 10 normalmente a 20 o más nucleótidos que se hibridan específicamente a una secuencia de mRNA codificando hTRT o mRNA transcrito del gene de hTRT. Muy a menudo, el polinucleótido antisentido tiene alrededor de 10 a 50 nucleótidos de longitud o alrededor de 14 a 35 nucleótidos de longitud. Los polinucleótidos antisentido pueden ser polinucleótidos de menos de alrededor de 100 nucleótidos o menos de alrededor de 200 nucleótidos. En general, el polinucleótido antisentido debe ser suficientemente largo para formar un duplexo estable pero suficientemente corto, dependiendo del modo de suministro, para administrar in vivo, si se desea. La longitud mínima de un polinucleótido requerido para hibridación específica a una secuencia de objetivo depende de varios factores, como contenido de G/C, posición de bases mal apareadas (si hay) , grado de unicidad de la secuencia en comparación con la población de polinucleótidos de objetivo y naturaleza química del polinucleótido (por ejemplo, columna vertebral de metilfosfonato, ácido nucleico de péptido, fosforotioato) , entre otros factores.

En general, para asegurar la hibridación específica, la secuencia antisentido es substancialmente complementaria a la secuencia de mRNA de hTRT de objetivo. La secuencia antisentido puede ser exactamente complementaria a la secuencia de objetivo. Los polinucleótidos antisentido también pueden incluir, sin embargo, substituciones, adiciones, supresiones, transposiciones, o modificaciones de nucleótidos, u otras secuencias de ácido nucleico o mitades no de ácido nucleico siempre y cuando la fijación específica a la secuencia de objetivo pertinente que corresponde a ARN de hTRT o su gene sea retenida como una propiedad funcional del polinucleótido.

La secuencia antisentido puede ser complementaria a secuencias relativamente accesibles de mRNA de hTRT (por ejemplo, relativamente sin ninguna estructura secundaria) . Esto puede determinarse analizando las estructuras secundarias de ARN previstas, por ejemplo, el programa MFOLD (Genetics Computer Group, Madison, WI) y probando in vitro o in vivo como se conoce en el arte. Los ejemplos de oligonucleótidos que pueden probarse en células para supresión antisentido de la función de hTRT son aquellos capaces de hibridarse a (es decir, substancialmente complementario a) las siguientes posiciones de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA:

1: 40-60; 260-280; 500-520; 770-790; 885-905; 1000-1020; 1300-1320; 1520-1540; 2110-2130; 2295-2315; 24502470; 2670-2690; 3080-3110; 3140-3160; y 3690-3710. Otro método útil para identificar composiciones antisentido eficaces usa arreglos de combinación de oligonucleótidos (vea, por ejemplo, Milner y otros, 1997, Nature Biotechnology 15:537) .

Los polinucleótidos antisentidos pueden tener secuencias además de la secuencia antisentido (es decir, además de la secuencia antisentido de hTRT) . En este caso, la secuencia antisentido está contenida dentro de un polinucleótido de secuencia más larga. La secuencia del polinucleótido puede constar esencialmente de, o es, la secuencia antisentido.

Los ácidos nucleicos antisentido (DNA, RNA, análogos modificados y similares) pueden hacerse usando algún método adecuado para producir un ácido nucleico, como la síntesis química y los métodos recombinantes revelados en el presente. Por ejemplo, las moléculas de ARN antisentido pueden prepararse por síntesis química de nuevo o por clonación. Por ejemplo, un ARN antisentido que se hibrida a mRNA de hTRT puede hacerse insertando (ligando) una secuencia de DNA de hTRT (por ejemplo, NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1, o fragmento de la misma) en orientación inversa vinculada de manera manejable a un promotor en un vector (por ejemplo, plásmido) . Siempre y cuando el promotor y, de preferencia las señales de terminación y poliadenilación, estén colocados correctamente, el filamento de la secuencia insertada que corresponde al filamento de no codificación será transcrito y actuará como un oligonucleótido antisentido.

Los oligonucleótidos antisentido pueden usarse para inhibir la actividad de telomerasa en extractos libres de células, células y animales, incluyendo mamíferos y humanos. Por ejemplo, los oligonucleótidos antisentido de fosforotioato:

A) 5'-GGCATCGCGGGGGTGGCCGGG B) 5'-CAGCGGGGAGCGCGCGGCATC C) 5'-CAGCACCTCGCGGTAGTGGCT D) 5'-GGACACCTGGCGGAAGGAGGG

pueden usarse para inhibir la actividad de telomerasa. En una concentración de 10 micromolares, cada oligonucleótido, mezclas de oligonucleótidos A y B; A, B, C y D; y A, C y D inhibieron la actividad de telomerasa en 293 células cuando se trataron una vez al día durante siete días. La inhibición también se observó cuando se usó una molécula antisentido de hTR (5'-GCTCTAGAATGAAGGGTG-3') en combinación con oligonucleótidos A, B y C; A, B y D; A y C. Los oligonucleótidos de control útiles en estos experimentos incluyen:

S1) 5'-GCGACGACTGACATTGGCCGG S2) 5'-GGCTCGAAGTAGCACCGGTGC S3) 5'-GTGGGAACAGGCCGATGTCCC

Pata determinar el oligonucleótido antisentido óptimo para una aplicación de interés en particular, uno puede realizar una exploración usando series de oligonucleótidos antisentido. Una serie ilustrativa es la serie de oligonucleótidos de 30 meros que se extienden sobre el mRNA de hTRT y son compensados uno del siguientes por quince nucleótidos (es decir, ON1 corresponde a las posiciones 1-30 y es TCCCACGTGCGCAGCAGGACGCAGCGCTGC, ON2 corresponde a las posiciones 16-45 y es GCCGGGGCCAGGGCTTCCCACGTGCGCAGC y ON3 corresponde a las posiciones 31-60 y es GGCATCGCGGGGGTGGCCGGGGCCAGGGCT y así sucesivamente hasta el Final del mRNA) . Cada miembro de esta serie puede probarse para actividad inhibidora como se revela en el presente. Esos oligonucleótidos que muestran actividad inhibidora bajo las condiciones de interés entonces identifican una región de interés y otros oligonucleótidos que corresponden a la región de interés (es decir, 8 meros, 10 meros, 15 meros y sucesivamente) pueden probarse para identificar el oligonucleótido con la actividad preferida para la aplicación.

Para métodos generales referentes a polinucleótidos antisentido, vea Antisense ARN and DNA (1988) , D.A. Melton, Ed., Cold Spring Harbor Laborator y , Cold Spring Harbor, NY) . Vea también Dagle y otros, 1991, Nucleic Acids Research, 19:1805. Para una revisión de terapia antisentido, vea, por ejemplo, Uhlmann y otros, Chem. Reviews, 90:543-584 (1990) .

b) OLIGONUCLEÓTIDOS Y POLINUCLEÓTIDOS TRIPLEX

La presente invención proporciona oligonucleótidos y polinucleótidos (por ejemplo, DNA, RNA, PNA y similares) que se fijan a ácidos nucleicos de hTRT de doble filamento o dobles (por ejemplo, en una región plegada del ARN de hTRT o en el gene de hTRT) , formando un ácido nucleico conteniendo hélice triple, o "triplex". La formación de hélice triple da como resultado la inhibición de la expresión de hTRT, por ejemplo, evitando la transcripción del gene de hTRT, reduciendo o eliminando así la actividad de telomerasa en una célula. Sin pretender estar limitado por un mecanismo en particular, se cree que el apareamiento de hélice triple compromete la habilidad de la hélice doble de abrirse suficientemente para la fijación de polimerasas, factores de transcripción, o moléculas de regulación que ocurrirán.

Los oligonucleótidos y polinucleótidos triplex de la invención se construyen usando las reglas del apareamiento de base de la formación de hélice triple (vea, por ejemplo, Cheng y otros, 1988, J. Biol. Chem. 263:15110; Ferrin y Camerini-Otero, 1991, Science 354:1494; Ramdas y otros, 1989, J. Biol. Chem. 264:17395; Strobel y otros, 1991, Science 254:1639; y Rigas y otros, 1986, Proc. Natl. Acad. Sci. U.S.A. 83:9591; cada uno de los cuales se incorpora en el presente por referencia) y la secuencia de mRNA de hTRT y/o gene. Normalmente, los oligonucleótidos que forman triplexos comprenden una secuencia específica o de alrededor de 10 a por lo menos 25 nucleótidos o más larga "complementaria" a una secuencia específica en el mRNA de hTRT o gene (es decir, suficientemente grande para formar una hélice triple estable, pero suficientemente pequeña, dependiendo del modo de suministro, para administrar in vivo, si se desea) . En este contexto, "complementaria" significa capaz de formar una hélice triple estable. Los oligonucleótidos pueden diseñarse para fijarse específicamente a las regiones de regulación del gene de hTRT (por ejemplo, la secuencia flanqueante de 5'-de hTRT, promotores e intensificadores) o al sitio de iniciación de transcripción (por ejemplo, entre -10 y +10 del sitio de iniciación de transcripción) . Para una revisión de los recientes avances terapéuticos usando DNA triplex, vea Gee y otros, en Huber y Carr, 1994, Molecular and Immunologic Approaches, Futura Publishing Co., Mt Kisco NY y Rininsland y otros, 1997, Proc. Natl. Acad. Sci. USA 94:5854, los cuales ambos se incorporan en el presente por referencia.

c) RIBOSOMAS

Los ribosomas pueden ser utilizados para la inhibición de la actividad de telomerasa. Los ribosomas se fijan y específicamente se disocian e inactivan el mRNA de hTRT. Los ribosomas útiles pueden comprender secuencias terminales 5'- y 3'- complementarias al mRNA de hTRT y pueden diseñarse por un experto en la base de la secuencia de mRNA de hTRT revelada en el presente (vea publicación PCT WO 93/23572, arriba) . Los ribosomas incluyen aquellos que tienen características de ribosomas de intrones grupo I (Cech, 1995, Biotechnology 13:323) y otros de ribosomas con cabeza de martillo (Edgington, 1992, Biotechnology 10:256) .

Los ribosomas incluyen aquellos que tienen sitios de disociación como GUA, GUU y GUC. Otros sitios óptimos de disociación para la inhibición mediada por ribosomas de la actividad de telomerasa incluyen aquellos descritos en las publicaciones PCT WO 94/02595 y WO 93/23569, ambas incorporadas en el presente por referencia. Los oligonucleótidos de ARN entre 15 y 20 ribonucleótidos de largo que corresponden a la región del gene de hTRT de objetivo conteniendo el sitio de disociación pueden ser evaluados por características estructurales secundarias que pueden volver el oligonucleótido más conveniente. La adaptabilidad de los sitios de disociación también pueden evaluarse probando la accesibilidad a la hibridación con oligonucleótidos complementarios usando ensayos de protección de ribonucleasa, o probando la actividad de ribosomas in vitro en conformidad con los procedimientos estándar conocidos en el arte.

Como lo describe Hu y otros, publicación PCT WO 94/03596, incorporado en el presente por referencia, las funciones antisentido y de ribosomas pueden combinarse en un solo oligonucleótido. Además, los ribosomas pueden comprender uno o más nucleótidos modificados o ligamientos modificados entre nucleótidos, como se describe arriba en conjunto con la descripción de oligonucleótidos antisentido ilustrativos.

Los ribosomas pueden ser generados in vitro y introducidos a una célula o paciente. Los métodos de terapia génica pueden ser utilizados para la expresión de ribosomas en una célula de objetivo ex vivo o in vivo.

d) ADMINISTRACIÓN DE OLIGONUCLEÓTIDOS

Normalmente, los métodos terapéuticos implican la administración de un oligonucleótido que funciona para inhibir o estimular la actividad de la telomerasa bajo condiciones fisiológicas in vivo y es relativamente estable bajo aquellas condiciones por un período de tiempo suficiente para un efecto terapéutico. Como se indica arriba, los ácidos nucleicos modificados pueden ser útiles en proporcionar dicha estabilidad, así como en dirigir el suministro del oligonucleótido al tejido, órgano, o célula deseado.

Los oligonucleótidos y polinucleótidos pueden suministrarse de manera directa como un medicamento en una fórmula farmacéutica adecuada, o de manera indirecta por medios para introducir un ácido nucleico a una célula, incluyendo liposomas, inmunoliposomas, balística, absorción directa en las células y similares como se describe en el presente. Para el tratamiento de enfermedades, los oligonucleótidos de la invención serán administrados a un paciente en una cantidad terapéuticamente eficaz. Una cantidad terapéuticamente eficaz es una cantidad suficiente para mejorar los síntomas de la enfermedad o modular la actividad de telomerasa en la célula de objetivo, por ejemplo, ya que puede medirse usando un ensayo de TRAP u otro ensayo adecuado de la función biológica de la telomerasa. Los métodos útiles para el suministro de oligonucleótidos para fines terapéuticos se describen en la Patente de los Estados Unidos 5, 272, 065, incorporada en el presente por referencia. Abajo se proporcionan otros detalles de administración de compuestos farmacéuticamente activos. Los oligonucleótidos y polinucleótidos pueden suministrarse usando terapia génica y plásmidos de expresión de DNA recombinante de la invención.

3) TERAPIA GÉNICA

La terapia génica se refiere a la introducción de un polinucleótido exógeno el cual produce un efecto de fenotipo médicamente útil en la (s) célula (s) mamífera (s) (normalmente) a la (s) cual (es) es transferido. Los métodos y composiciones de terapia génica pueden ser utilizados para el tratamiento de las condiciones asociadas con la telomerasa. La terapia génica puede implicar la introducción a una célula de un vector que expresa un producto génico de hTRT (como una proteína de hTRT substancialmente similar al polipéptido de hTRT teniendo una secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2, por ejemplo, para aumentar la actividad de telomerasa, o un polipéptido de hTRT inhibidor para reducir la actividad) , expresa un ácido nucleico teniendo un gene de hTRT o secuencia de mRNA (como un ARN antisentido, por ejemplo, para reducir la actividad de telomerasa) , expresa un polipéptido o polinucleótido que afecta de otra manera la expresión de productos génicos de hTRT (por ejemplo, un ribosoma dirigido a mRNA de hTRT para reducir la actividad de telomerasa) , o reemplaza o rompe una secuencia de hTRT endógena (por ejemplo, reemplazo de genes y "eliminación de genes", respectivamente) . Muchas otros enfoques serán evidentes para los expertos en la revisión de las enseñanzas de la presente memoria. También se puede introducir un vector codificando hTR. Alternativamente, también se introducen vectores codificando proteínas asociadas con la telomerasa con o sin un vector de hTR.

Los vectores útiles en la terapia génica de hTRT pueden ser virales o no virales e incluyen aquellos descritos arriba en relación con los sistemas de expresión de hTRT de la invención. Los expertos en el arte entenderán que los vectores de terapia génica pueden comprender promotores y otras secuencias de regulación o procesamiento, como se describen en esta revelación. Generalmente el vector comprenderá un promotor y, de manera opcional, un intensificador (separado de cualquiera contenido dentro de las secuencias de promotores) que sirven para impulsar la transcripción de un oligonucleótido, así como otros elementos de regulación que proporcionan mantenimiento episómico o integración cromosómica y transcripción de alto nivel, si se desea. Un plásmido útil para la terapia génica puede comprender otros elementos funcionales, como marcadores seleccionables, regiones de identificación y otras secuencias. Las secuencias adicionales pueden tener papeles en dar estabilidad tanto fuera, como dentro de una célula, dirigiendo el suministro de secuencias de nucleótidos de hTRT (con sentido o antisentido) a un órgano, tejido, o célula, o población de células especificado, mediando la entrada a una célula, mediando la entrada al núcleo de una célula y/o mediando la integración dentro del DNA nuclear. Por ejemplo, pueden usarse estructuras de DNA similares a los aptameros, u otros sitios de mitades de fijación de proteínas para mediar la fijación de un vector a receptores de la superficie celular o a proteínas de suero que se fijan a un receptor aumentando con ello la eficiencia de la transferencia de DNA a la célula. Otros sitios y estructuras de DNA pueden fijarse directa o indirectamente a receptores en la membrana nuclear o a otras proteínas que entran al núcleo, facilitando con ello la absorción nuclear de un vector. Otras secuencias de DNA pueden afectar directa o indirectamente la eficiencia de la integración.

Los vectores de terapia génica adecuados pueden o no tener un origen de replicación. Por ejemplo, es útil incluir un origen de replicación en un vector para la propagación del vector antes de la administración a un paciente. Sin embargo, el origen de replicación a menudo puede eliminarse antes de la administración si el vector está diseñado para integrarse a DNA cromosómico huésped o fijarse a mRNA o DNA huésped. en algunas situaciones (por ejemplo, células de tumor) , puede no ser necesario que el DNA exógeno se integre de manera estable a la célula transducida, debido a que la expresión temporal puede ser suficiente para destruir las células del tumor.

Se prevé unos métodos y reactivos para la terapia de reemplazo de genes (es decir, el reemplazo por recombinación homóloga de un gene de hTRT endógena con un gene recombinante) . Pueden usarse vectores específicamente diseñados para la integración por recombinación homóloga. Los factores importantes para optimizar la recombinación homóloga incluyen el grado de identidad de secuencia y la extensión de la homología a secuencias cromosómicas. También es importante la secuencia específica que media la recombinación homóloga, ya que la integración ocurre mucho más fácilmente en DNA activo de manera transcripcional. Los métodos y materiales para hacer construcciones homólogas de objetivo son descritos, por ejemplo, por Mansour y otros, 1988, Nature 336:348; Bradley y otros, 1992, Bio/Technology 10:534. Vea también Patentes de los Estados Unidos Números 5, 627, 059; 5, 487, 992; 5, 631, 153 y 5, 464, 764. La terapia de reemplazo de genes puede implicar la alteración y el reemplazo de todas o una parte de las secuencias de regulación que controlan la expresión del gene de hTRT el cual debe ser regulado. Por ejemplo, las secuencias de promotores de hTRT (por ejemplo, como las que se encuentran en NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 6) pueden romperse (para disminuir la expresión de hTRT o suprimir un sitio de control de transcripción) o un promotor exógeno (por ejemplo, para aumentar la expresión de hTRT) puede substituirse.

Los métodos y reactivos para "eliminación de genes" de hTRT implican la supresión o el rompimiento por recombinación homóloga de un gene de hTRT endógena usando un vector producido de manera recombinante. En la eliminación de genes, las secuencias de objetivo pueden ser secuencias de regulación (por ejemplo, el promotor de hTRT) , o secuencias de codificación de ARN o proteínas. El uso de recombinación homóloga para alterar la expresión de genes endógenos se describe detalladamente en la Patente de los Estados Unidos Número 5, 272, 071 (y las Patentes de los Estados Unidos citadas arriba) , WO 91/09955, WO 93/09222, WO 96/29411, WO 95/31560 y WO 91/12650. Vea también Moynahan y otros, 1996, Hum. Mol. Genet. 5:875.

Los métodos para destruir específicamente células positivas de telomerasa, o evitar la transformación de las células negativas de telomerasa a un estado positivo de telomerasa, implican la utilización del promotor del gene de hTRT para regular la expresión de una proteína tóxica para la célula. Como se muestra en el Ejemplo 14, una secuencia de promotor de hTRT puede estar vinculada de manera manejable a un gene reportero de tal forma que la activación del promotor da como resultado la expresión de la proteína codificada por el gene reportero. Si, en lugar de una proteína reportera, la proteína codificada es tóxica para la célula, la activación del promotor conduce a la morbidad o muerte de la célula. Un vector comprendiendo un promotor de hTRT vinculado de manera manejable a un gene que codifica una proteína tóxica puede ser introducido a células, como células humanas, por ejemplo, células en un paciente humano, dando como resultado la muerte de las células en las cuales se expresan los factores de activación de promotor de hTRT, como células de cáncer. En un enfoque relacionado, la proteína codificada no es tóxica para una célula, pero codifica una actividad que vuelve la célula sensible a un medicamento de otra manera no tóxico. Por ejemplo, los tumores pueden tratarse introduciendo una construcción de fusión de gene de cinasa de timidina (TK) de promotor de hTRT y Herpes a células del tumor y administrando ganciclovir o el equivalente (vea, por ejemplo, Moolton y Wells, 1990, J. Natl. Canc. Inst. 82:297) . El arte sabe de muchas otras proteínas tóxicas o potencialmente tóxicas y sistemas adecuados (usando secuencias de promotor distintas a hTRT) que pueden modificarse y aplicarse por un experto en el arte en la revisión de esta revelación.

Pueden introducirse vectores de terapia génica en células o tejidos in vivo, in vitro o ex vivo. Para terapia ex vivo, pueden introducirse vectores a células, por ejemplo, células impulsoras, tomadas del paciente y clonalmente propagadas para transplante derivado por sí mismo de nuevo al mismo paciente (vea, por ejemplo, Patentes de los Estados Unidos Números 5, 399, 493 y 5, 437, 994, cuyas revelaciones se incorporan en el presente por referencia) . Las células que pueden ser dirigidas para terapia génica de hTRT tenían como objetivo aumentar la actividad de telomerasa de una célula de objetivo incluyen, pero no están limitadas a, células impulsoras embriónicas o germinales, particularmente células de primate o humano, como se indica arriba, células impulsoras hematopoyéticas (SIDA y posquimioterapia) , células endoteliales vasculares (padecimiento cardiovascular y cerebrovascular) , fibroblastos y queratinocitos basales en la piel (sanación de herida y quemaduras) , condrocitos (artritis) , astrocitos y células microgliales en el cerebro (Síndrome de Alzheimer) , osteoblastos (osteoporosis) , células retinales (enfermedades de los ojos) y células del islote pancreático (diabetes Tipo I) y algunas de las células incluidas en el Cuadro 3, abajo, así como otros tipos de células conocidos que se dividen.

Un promotor capaz de ser inducido vinculado de manera manejable a una TRT, como hTRT, secuencia (o variante) de codificación puede ser utilizado para modular la capacidad de proliferación de las células in vivo o in vitro. Por ejemplo, a un paciente se introducen células pancreáticas que producen insulina transfectadas con un vector de expresión de hTRT bajo el control de un promotor capaz de ser inducido. La capacidad de proliferación de las células puede controlarse entonces mediante la administración al paciente del agente de activación del promotor (por ejemplo, tetraciclina) para posibilitar que las células se multipliquen más que de lo contrario hubiera sido posible. La proliferación de células puede entonces terminarse, continuarse, o reiniciarse según lo desee el médico tratante.

4) VACUNAS Y ANTICUERPOS

Los péptidos o polipéptidos inmunogénicos teniendo una secuencia de hTRT pueden usarse para producir una respuesta inmune anti-hTRT en un paciente (es decir, actuar como una vacuna) . Los péptidos y polipéptidos de hTRT inmunogénicos ejemplares se describen abajo en los Ejemplos 6 y 8. También puede producirse una respuesta inmune mediante el suministro de vectores de plásmido codificando el polipéptido de interés (es decir, la administración de "DNA descubierto") . Los ácidos nucleicos de interés pueden suministrarse por inyección, liposomas, u otros medios de administración. Pueden ser seleccionados los modos de inmunización que producen en el individuo una respuesta de linfocito citotóxico restringido MHC Clase I contra la telomerasa que expresa células. Una vez inmunizado, el individuo o animal producirán una respuesta inmune aumentada contra las células que expresan altos niveles de telomerasa (por ejemplo, células malignas) .

Los anticuerpos anti-hTRT, por ejemplo, anticuerpos murinos, humanos, o monoclonales humanizados también pueden administrarse a un paciente (por ejemplo, inmunización pasiva) para efectuar una respuesta inmune contra las células que expresan telomerasa.

F) COMPOSICIONES FARMACÉUTICAS

En aspectos relacionados, la invención proporciona composiciones farmacéuticas que comprenden oligonucleótidos y polinucleótidos, polipéptidos de hTRT y anticuerpos, agonistas, antagonistas, o inhibidores, solos o en combinación con por lo menos otro agente, como un compuesto estabilizador, diluyente, portador, u otro ingrediente activo o agente.

Los agentes terapéuticos de la invención pueden administrarse en algún portador farmacéutico estéril, biocompatible, incluyendo, pero no limitado a, solución salina, solución salina tamponada, dextrosa y agua. Alguna de estas moléculas puede administrarse a un paciente sola, o en combinación con otros agentes, medicamentos u hormonas, en composiciones farmacéuticas donde se mezcla con excipiente (s) adecuado (s) , adyuvantes y/o portadores farmacéuticamente aceptables. En una realización de la presente invención, el portador farmacéuticamente aceptable es farmacéuticamente inerte.

La administración de composiciones farmacéuticas se realiza de manera oral o parenteral. Los métodos de suministro parenteral incluyen administración local, intrarterial (por ejemplo, directamente al tumor) , intramuscular, subcutánea, intramedular, intratecal, intraventricular, intravenosa, intraperitoneal, o intranasal. Además de los ingredientes activos, estas composiciones farmacéuticas pueden contener portadores adecuados farmacéuticamente aceptables que comprenden excipientes y otros compuestos que facilitan el procesamiento de los compuestos activos en preparaciones que pueden usarse para fines farmacéuticos. Pueden encontrarse más detalles sobre técnicas para composición y administración en la edición más reciente de "Remington's Pharmaceutical Sciences" (Maack Publishing Co., Easton, PA) .

Las composiciones farmacéuticas para administración oral pueden prepararse usando portadores farmacéuticamente aceptables bien conocidos en el arte en dosis adecuadas para administración oral. Los portadores permiten que las composiciones farmacéuticas se preparen como tabletas, píldoras, grageas, cápsulas, líquidos, geles, jarabes, lechadas, suspensiones, etc., adecuados para ingestión por el paciente. Vea la publicación PCT WO 93/23572.

Las preparaciones farmacéuticas para uso oral pueden obtenerse a través de la combinación de compuestos activos con excipiente sólido, opcionalmente triturando una mezcla resultante y procesando la mezcla de gránulos, después de agregar compuestos adicionales adecuados, si se desea, para obtener tabletas o núcleos de gragea. Los excipientes adecuados son rellenos de carbohidratos o proteínas e incluyen, pero no están limitados a azúcares, incluyendo lactosa, sacarosa, manitol, o sorbitol; almidón de maíz, trigo, arroz, papa, u otras plantas; celulosa como celulosa de metilo, celulosa de hidroxipropilmetilo, o carboximetilcelulosa de sodio; y gomas incluyendo arábiga y tragacanto; así como proteínas como gelatina y colágeno. Si se desea, pueden agregarse agentes desintegrantes o solubilizantes, como la polivinilpirrolidona degradada, agar, ácido algínico, o una sal del mismo, como alginato de sodio.

Los núcleos de gragea están provistos con recubrimientos adecuados como soluciones de azúcar concentradas, las cuales también pueden contener goma arábiga, talco, polivinilpirrolidona, gel de carbopol, polietilenglicol y/o dióxido de titanio, soluciones de laca y solventes orgánicos adecuados o mezclas de solventes. Pueden agregarse colorantes o pigmentos a las tabletas o recubrimientos de grageas para identificación del producto o para caracterizar la cantidad del compuesto activo (es decir, la dosis) .

Las preparaciones farmacéuticas las cuales pueden usarse oralmente incluyen cápsulas de ajuste suave hechas de gelatina, así como cápsulas suaves, selladas hechas de gelatina y un recubrimiento como glicerol o sorbitol. Las cápsulas de ajuste suave pueden contener ingredientes activos mezclados con una substancia de relleno o aglutinantes como lactosa o almidones, lubricantes como talco o estearato de magnesio y, opcionalmente, estabilizadores. En las cápsulas suaves, los compuestos activos pueden disolverse o suspenderse en líquidos adecuados, como aceites grasos, parafina líquida, o polietilenglicol líquido con o sin estabilizadores.

Las fórmulas farmacéuticas para administración parenteral incluyen soluciones acuosas de compuestos activos. Para inyección, las composiciones farmacéuticas de la invención pueden prepararse en soluciones acuosas, de preferencia en tampones fisiológicamente compatibles como solución de Hank, solución de Ringer, o solución salina tamponada de manera fisiológica. Las suspensiones acuosas para inyección pueden contener substancias que aumentan la viscosidad de la suspensión, como carboximetilcelulosa de sodio, sorbitol, o dextrano. Además, las suspensiones de los compuestos activos pueden prepararse como suspensiones aceitosas adecuadas para inyección. Los solventes o vehículos lipofílicos adecuados incluyen aceites grasos como aceite de ajonjolí, o ésteres sintéticos de ácido graso, como oleato de etilo o triglicéridos, o liposomas. Opcionalmente, la suspensión puede también contener estabilizadores o agentes adecuados los cuales aumentan la solubilidad de los compuestos para permitir la preparación de soluciones muy concentradas.

Para administración local o nasal, en la composición se usan penetrantes adecuados para la barrera particular que será impregnada. Estos penetrantes generalmente son conocidos en el arte.

Las composiciones farmacéuticas de la presente invención pueden fabricarse de una manera similar a las que se conocen en el arte (por ejemplo, por medio de procesos convencionales de mezcla, disolución, granulación, elaboración de grageas, pulverización, emulsionamiento, encapsulado, oclusión o liofilización) .

La composición farmacéutica puede proporcionarse como una sal y puede formarse con muchos ácidos, incluyendo, pero no limitados a, ácido clorhídrico, ácido sulfúrico, ácido acético, ácido láctico, ácido tartárico, ácido málico, ácido succínico, etc. Las sales tienden a ser más solubles en solventes acuosos u otros solventes protónicos que son las formas de base libres correspondientes. En otros casos, la preparación preferida puede ser un polvo liofilizado en 1 mM- 50 mM de histidina, 0.1%-2% de sacarosa, 2%-7% de manitol en una gama de pH de 4.5 a 5.5, que se combina con tampón antes de usarse.

Después de que se han preparado las composiciones farmacéuticas que comprenden un compuesto de la invención formulado en un portador aceptable, pueden ponerse en un recipiente adecuado y etiquetarse para el tratamiento de una condición indicada. Para administración de proteínas de telomerasa humana y ácidos nucleicos, la etiqueta incluirá la cantidad, la frecuencia y el método de administración.

Las composiciones farmacéuticas adecuadas para uso en la presente invención incluyen composiciones en donde los ingredientes activos están contenidos en una cantidad eficaz para lograr el propósito deseado. "Cantidad terapéuticamente eficaz" o "cantidad farmacológicamente eficaz" son frases muy reconocidas y se refieren a la cantidad de un agente eficaz para producir el resultado farmacológico propuesto. De esta manera, una cantidad terapéuticamente eficaz es una cantidad suficiente para mejorar los síntomas de la enfermedad que se está tratando. Un ensayo útil en la investigación de una cantidad eficaz para una aplicación determinada (por ejemplo, cantidad terapéuticamente eficaz) es la medición del efecto en la actividad de telomerasa en una célula de objetivo. La cantidad realmente administrada dependerá del individuo a quien se aplicará el tratamiento y de preferencia será una cantidad optimizada de tal manera que el efecto deseado se logre sin efectos secundarios considerables. La determinación de una dosis terapéuticamente eficaz es bien conocida dentro de la capacidad de los expertos en el arte.

Para un compuesto, la dosis terapéuticamente eficaz puede calcularse inicialmente en ensayos de cultivos de células o en algún modelo animal adecuado. El modelo animal también se usa para lograr una gama de concentración y vía de administración convenientes. Tal información puede usarse entonces para determinar las dosis y vías de administración útiles en humanos.

Una cantidad terapéuticamente eficaz se refiere a la cantidad de proteína, polipéptido, péptido, anticuerpo, oligonucleótido o polinucleótido, agonista o antagonistas que mejora los síntomas o condición. La eficacia terapéutica y toxicidad de estos compuestos pueden determinarse mediante procedimientos farmacéuticos estándar en cultivos de células o animales experimentales (por ejemplo, ED50, la dosis terapéuticamente eficaz en el 50% de la población; y LD50, la dosis letal para el 50% de la población) . La relación de dosis entre efectos terapéuticos y tóxicos es el índice terapéutico y puede expresarse como la relación, ED50/LD50. Se prefieren las composiciones farmacéuticas que presentan grandes índices terapéuticos. Los datos obtenidos de los ensayos de cultivos de células y estudios de animales se usan en la formulación de una gama de dosis para uso humano. La dosis de estos compuestos está de preferencia dentro de una gama de concentraciones circulantes que incluyen la ED50 con poca toxicidad o ausencia de la misma. La dosis varía dentro de su gama dependiendo de la forma de dosis empleada, sensibilidad del paciente y la vía de administración.

La dosis exacta es elegida por el médico individual en vista del paciente que se tratará. La dosis y administración son ajustadas para proporcionar suficientes niveles de la mitad activa o para mantener el efecto deseado. Los factores adicionales que pueden tomarse en cuenta incluyen la severidad del estado de la enfermedad (por ejemplo, tamaño y lugar del tumor; edad, peso y género del paciente; dieta, tiempo y frecuencia de administración, combinación o combinaciones de medicamentos, sensibilidades de reacción y tolerancia/respuesta a la terapia) . Las composiciones farmacéuticas de acción prolongada podrían administrarse cada 3 a 4 días, cada semana, o una vez cada dos semanas dependiendo de la vida media y velocidad de eliminación de la fórmula en particular. La orientación en cuanto a las dosis y métodos de suministro en particular se proporciona en la literatura (vea Patentes de los Estados Unidos Números 4, 657, 760; 5, 206, 344; y 5, 225, 212 incorporada en el presente por referencia) . Los expertos en el arte normalmente emplearán fórmulas diferentes para nucleótidos que para proteínas o sus inhibidores. Del mismo modo, el suministro de polinucleótidos o polipéptidos puede ser específico a células, condiciones, lugares y similares en particular.

VIII. AUMENTANDO LA CAPACIDAD DE PROLIFERACIÓN Y PRODUCCIÓN DE CÉLULAS INMORTALIZADAS, LÍNEAS DE CÉLULAS Y ANIMALES

Como se discute arriba, las células de la mayoría de los vertebrados envejecen después de un número finito de divisiones en el cultivo (por ejemplo, de 50 a 100 divisiones) . Sin embargo, ciertas células de variantes son capaces de dividirse indefinidamente en el cultivo (por ejemplo, células HeLa, 293 células) y, por esta razón, son útiles para la investigación y aplicaciones industriales. Generalmente estas líneas de células inmortales se derivan de tumores que surgen espontáneamente, o por transformación por la exposición a la radiación de un virus o químico que induce un tumor. Desafortunadamente, está disponible una selección limitada de líneas de células, especialmente líneas de células humanas representando función celular diferenciada. Además, las líneas de células inmortales actualmente disponibles se caracterizan por anormalidades cromosómicas (por ejemplo, aneuploidía, reagrupaciones de genes, o mutaciones) . Además, muchas líneas de células establecidas por largo tiempo son relativamente no diferenciadas (por ejemplo, no hacen productos muy especializados de la clase que únicamente caracteriza tejidos u órganos particulares) . Por lo tanto, existe la necesidad de nuevos métodos para generar células inmortales, especialmente células humanas. Las células inmortalizadas se usan en la producción de proteínas naturales y proteínas recombinantes (por ejemplo, polipéptidos terapéuticos como eritroproteína, hormona de crecimiento humana, insulina y similares) , o anticuerpos, para las cuales se prefiere una línea de células genéticamente normal. Para la producción de algunas proteínas recombinantes, también pueden preferirse tipos de células especializados (por ejemplo, células pancreáticas para la producción de insulina humana) . Otro uso para células inmortalizadas o hasta células mortales con capacidad de proliferación aumentada (relativa a las células no modificadas) es para la introducción a un paciente para terapia génica, o para el reemplazo de células o tejido enfermos o dañados. Por ejemplo, las células inmunes derivadas por sí mismas que contienen o expresan, por ejemplo, un gene o polipéptido de hTRT recombinante de la invención puede usarse para el reemplazo de células en una paciente después de la agresiva terapia de cáncer, por ejemplo, irradiación de todo el cuerpo. Otro uso de las células inmortalizadas es para la producción ex vivo de tejidos u órganos "artificiales" (por ejemplo, piel) para uso terapéutico. Otro uso de dichas células es para la selección o validación de medicamentos, como medicamentos inhibidores de la telomerasa, o para uso en la producción de vacunas o reactivos biológicos. Los usos adicionales de las células de la invención serán aparentes para los expertos.

Las células y líneas de células inmortalizadas, así como aquellas de capacidad de replicación simplemente aumentada, de la invención se hacen aumentando la actividad de la telomerasa en la célula. Puede usarse cualquier método revelado en el presente para aumentar la actividad de la telomerasa. De esta manera, en una realización, las células son inmortalizadas aumentando la cantidad de un polipéptido de hTRT en la célula. En una realización, los niveles de hTRT son aumentados introduciendo un vector de expresión de hTRT a la célula (con transfección estable algunas veces preferida) . Como se discutió arriba, la secuencia de codificación de hTRT generalmente está vinculada de manera manejable a un promotor, el cual puede ser capaz de ser inducido o ser constitutivamente activo en la célula.

En una realización, se introduce a la célula un polinucleótido que comprende una secuencia codificando unpolipéptido de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 2, la cual está vinculada de manera manejable a un promotor (por ejemplo, un promotor constitutivamente expresado, por ejemplo, una secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 6) . En una realización, el polinucleótido comprende una secuencia de NÚMERO DE IDENTIFICACIÓN DE SECUENCIA: 1. De preferencia, el polinucleótido incluye señales de poliadenilación y terminación. En otras realizaciones, se incluyen elementos adicionales como intensificadores y otros discutidos arriba. En una realización alternativa, el polinucleótido no incluye una secuencia de promotor, la secuencia siendo proporcionada por el genomio endógeno de la célula de objetivo después de la integración (por ejemplo, recombinación, por ejemplo, recombinación homóloga) del polinucleótido introducido. El polinucleótido puede introducirse a la célula de objetivo por cualquier método, incluyendo algún método revelado en el presente, como lipofección, electroporación, virosomas, liposomas, inmunoliposomas, conjugados de policatión:ácido nucleico, DNA descubierto) .

Usando los métodos de la invención, puede lograrse que una célula de vertebrado tenga una capacidad de proliferación aumentada o hasta sea inmortalizada y mantenida indefinidamente en el cultivo. En una realización, las células son mamíferas, con células humanas preferidas para muchas aplicaciones. Los ejemplos de células humanas que pueden inmortalizarse incluyen aquellas incluidas en el Cuadro 3.

Se reconocerá que los ensayos de "diagnóstico" de la invención descritos abajo pueden usarse para identificar y caracterizar las células inmortalizadas de la invención.

TABLA 3

CÉLULAS HUMANAS EN LAS CUALES LA EXPRESIÓN DE hTRT PUEDE AUMENTARSE

Células Epiteliales Queratinizantes queratinocito de epidermis (célula epidérmica de diferenciación) célula basal de epidermis (célula impulsora) queratinocito de uñas de manos y pies célula basal de la matriz de la uña (célula impulsora) células de caña pilosa medulares, corticales, cuticulares; células envolventes de raíz de cabello, cuticulares, de capa de Huxley, externas de capa de Henle; célula de la matriz del cabello (célula impulsora)

Células de Epitelios de Barrera Estratificados Húmedos célula epitelial superficial del epitelio escamoso estratificado de la lengua, cavidad oral, esófago, canal anal, uretra distal, vagina célula basal de estos epitelios (célula impulsora) célula del epitelio externo de la córnea célula del epitelio urinario (revistiendo la vesícula y conductos urinarios)

Células Epiteliales Especializadas para Secreción Exocrina células de glándula salival célula mucosa (secreción rica en polisacárido) célula serosa (secreción rica en enzimas de glicoproteína) célula de la glándula de von Ebner en la lengua (secreción que fluye sobre las papilas gustativas) célula de la glándula mamaria, secretando leche célula de la glándula lagrimal, secretando lágrimas célula de la glándula ceruminosa del oído, secretando cerumen célula de la glándula sudorípara ecrina, secretando glicoproteínas (célula obscura) célula de la glándula sudorípara ecrina, secretando moléculas pequeñas (célula clara) célula de la glándula sudorípara apocrina (secreción odorífera, sensible a la hormona sexual) célula de la glándula de Moll en el párpado (glándula sudorípara especializada) célula de la glándula sebácea, secretando sebo rico en lípidos célula de la glándula de Bowman en la nariz (secreción que fluye sobre el epitelio olfativo) célula de la glándula de Brunner en el duodeno, secretando solución alcalina de moco y enzimas célula de la vesícula seminal, secretando componentes del fluido seminal, incluyendo fructosa (como combustible para nadar el esperma) célula de la glándula prostática, secretando otros componentes del fluido seminal célula de la glándula bulbouretral, secretando moco célula de la glándula de Bartholin, secretando lubricante vaginal célula de la glándula de Littré, secretando moco célula del endometrio del útero, secretando principalmente carbohidratos célula caliciforme aislada del sistema respiratorio y digestivo, secretando moco célula mucosa del revestimiento del estómago célula cimógena de la glándula gástrica, secretando pepsinógeno célula oxíntica de la glándula gástrica, secretando HCl célula acinosa del páncreas, secretando enzimas digestivas y bicarbonato célula de Paneth del intestino delgado, secretando lisozima neumocito tipo II del pulmón, secretando tensioactivo célula Clara del pulmón Células especializadas para Secreción de Hormonas células de pituitaria anterior, secretando hormona de crecimiento, hormona folicular, hormona luteinizante, prolactina, hormona adrenocorticotrópica y hormona tiroidea célula de pituitaria intermedia, secretando hormona melanocitostimulante células de pituitaria posterior, secretando oxitocina, vasopresina células de intestino, secretando serotonina, endorfina, somatostatina, gastrina, secretina, colecistocinina, insulina y glucagón células de la glándula tiroides, secretando hormona tiroidea, calcitonina células de la glándula paratiroides, secretando hormona paratiroidea, célula oxífila células de la glándula suprarrenal, secretando epinefrina, norepinefrina y hormonas esteroides; mineralocorticoides glucocorticoides células de gónadas, secretando testosterona (célula de Leydig de teste) estrógeno (células tecales internas del folículo ovárico) progesterona (célula del cuerpo lúteo del folículo ovárico quebrado) células del aparato yuxtaglomerular del riñón célula yuxtaglomerular (secretando renina) célula mácula densa célula peripolar célula de mesangio Células Absorbentes Epiteliales en Intestino, Glándulas Exocrinas y Sistema Urogenital célula de margen de cepillo del intestino (con microvellosidades) célula de conducto estriado de glándulas exocrinas célula epitelial de la vesícula biliar célula de margen de cepillo del túbulo proximal del riñón célula del túbulo distal del riñón células no ciliadas de ductulus efferens célula principal de epidídimo célula basal epidídimo Células Especializadas para Metabolismo y Almacenamiento hepatocito (célula del hígado) células grasas grasa blanca grasa café lipocito del hígado Células Epiteliales que Sirven Principalmente como una Función de Barrera, Revistiendo el Pulmón, Intestino, Glándulas Exocrinas y Sistema Urogenital neumocito tipo I (revistiendo el espacio aéreo del pulmón) célula del conducto pancreático (célula centroacinosa) célula del conducto no estriado de la glándula sudorípara, glándula salival, glándula mamaria célula parietal del glomérulo del riñón podocito del glomérulo del riñón célula de segmento delgado del asa de Henle (en el riñón) célula del conducto de recolección (en el riñón) célula del conducto de la vesícula seminal, glándula prostática Células Epiteliales Revistiendo las Cavidades Corporales Internas Cerradas células endoteliales vasculares de vasos sanguíneos y vasos linfáticos fenestradas continuas esplénicas célula sinovial (revistiendo las cavidades de las articulaciones, secretando principalmente ácido hialurónico) célula serosal (revistiendo cavidades peritoneales, pleurales y pericárdicas) célula escamosa revistiendo el espacio perilinfático del oído células revistiendo el espacio endolinfático del oído célula escamosa células columnares del saco endolinfático con microvellosidades sin microvellosidades célula "obscura" célula de la membrana vestibular (pareciendo célula del plexo coroideo) célula basal stria vascularis célula marginal stria vascularis célula de Claudius célula de Boettcher célula del plexo coroideo (secretando fluido cerebroespinal) célula escamosa de pia-aracnoidea células del epitelio ciliar del ojo pigmentadas no pigmentadas célula "endotelial" de la córnea Células Ciliadas con Función Impulsora del sistema respiratorio del oviducto y del endometrio del útero (en hembra) de rete testis y ductulus efferens (en macho) del sistema central nervioso (célula de epéndimo revistiendo las cavidades del cerebro)

Células Especializadas para la Secreción de Matriz Extracelular epiteliales: ameloblasto (secretando esmalte de diente) célula planum semilunatum del aparato vestibular del oído (secretando proteoglucano) célula interdental del órgano de Corti (secretando "membrana" tectorial cubriendo las células del cabello del órgano de Corti no epiteliales (tejido conectivo) fibroblastos (varios de tejido conectivo suelto, de la córnea, del tendón, del tejido reticular de la médula ósea, etc.) pericito de vaso capilar de la sangre célula nucleus pulposus de disco intervertebral cementoblasto/cementocito (secretando cemento óseo de raíz de diente) odontoblasto/odontocito (secretando dentina de diente) condrocitos de cartílago hialino, de fibrocartílago, de cartílago elástico osteoblasto/osteocito célula osteoprogenitora (célula impulsora de osteoblastos) hialocito de cuerpo vítreo de ojo célula estrellada del espacio perilinfático de oído Células Contráctiles células del músculo esquelético rojas (lentas) blancas (rápidas) intermedias fusiformes musculares - bolsa nuclear fusiformes musculares - cadena nuclear célula satélite - (célula impulsora) células del músculo del corazón ordinarias nodales fibra de Purkinje células del músculo liso células mioepiteliales de iris de glándulas exocrinas Células del Sistema Sanguíneo e Inmune glóbulo rojo de la sangre megacariocito macrófagos monocito macrófago del tejido conectivo (varios)

célula de Langerhans (en epidermis)

osteoclasto (in hueso)

célula dendrítica (en tejidos linfoides)

célula microglial (en el sistema central nervioso)

neutrófilo eosinófilo basófilo célula cebada linfocito T

célula ayudante T

célula supresora T

célula destruidora T

linfocito B

IgM

IgG

IgA

IgE célula destruidora células impulsoras para el sistema sanguíneo e inmune (varias)

Transductores Sensorios fotoreceptores bastoncillo conos sensibles al azul sensibles al verde sensibles al rojo oído célula pilosa interior del órgano de Corti célula pilosa exterior del órgano de Corti aceleración y gravedad célula pilosa tipo I del aparato vestibular de oído célula pilosa tipo II del aparato vestibular de oído gusto célula de papila gustativa tipo II olfato neurona olfativa célula basal de epitelio olfativo (célula impulsora para neuronas olfativas) pH sanguíneo célula corporal carótida tipo I tipo II tacto célula Merkel de epidermis neuronas sensorias primarias especializadas para el tacto temperatura neuronas sensorias primarias especializadas para la temperatura sensible al frío sensible al calor dolor neuronas sensorias primarias especializadas para el dolor configuraciones y fuerzas en el sistema locomotor neuronas sensorias primarias propioceptivas Neuronas Autónomas colinérgicas adrenérgicas peptidérgicas Células de Soporte de los Órganos Sensorios y de Neuronas Periféricas Células de soporte del órgano de Corti célula pilar interior célula pilar exterior célula falangiana interior célula falangiana exterior célula de margen célula de Hensen célula de soporte del aparato vestibular célula de soporte de papila gustativa (célula de papila gustativa tipo I) célula de soporte de epitelio olfativo célula de Schwann célula satélite (encapsulando células nerviosas periféricas) célula entérica glial Neuronas y Células Gliales del Sistema Central Nervioso neuronas células glial astrocito oligodendrocito Células de Cristalino células epiteliales anteriores del cristalino fibra del cristalino (célula conteniendo cristalino)

Células del Pigmento melanocito, célula epitelial retinal pigmentada Células Germinales oogonio/oocito espermatocito espermogonia (célula impulsora para espermatocito)

Células Nodrizas célula de folículo ovárico célula de Sertoli (en teste) célula epitelial de timo Células Impulsoras célula impulsora embriónica célula germinal embriónica célula impulsora adulta célula impulsora fetal IX. ENSAYOS DE DIAGNÓSTICO

A) INTRODUCCIÓN

1) ENSAYOS TRT

La presente invención ofrece una amplia variedad de ensayos para la TRT, de preferencia la hTRT, y la telomerasa. Estos ensayos proporcionan, entre otras cosas, la base para los ensayos sensibles, no costosos, convenientes y ampliamente aplicables, para la diagnosis y prognosis de cierto número de enfermedades del ser humano, de las cuales el cáncer es un ejemplo ilustrativo. Como se indicó anteriormente, los productos del gene de hTRT (proteína y mRNA) por lo general se encuentran en un número elevado en las células humanas inmortales en relación con la mayoría de las células mortales normales (es decir, las células de telomerasa negativa y la mayoría de las células somáticas de adultos normales de telomerasa positiva) . Por lo tanto, en un aspecto, la invención proporciona ensayos útiles para detectar o medir la presencia, ausencia o cantidad de un producto del gene de la hTRT en una muestra de, o que contenga, células humanas u otras células mamíferas o eucarióticas para caracterizar las células como inmortales (como por ejemplo una célula de tumor maligno) o mortal (como por ejemplo la mayoría de las células somáticas normales en los adultos) o como telomerasa positiva o negativa.

Cualquier condición caracterizada por la presencia o ausencia de un producto del gene de la hTRT (es decir, proteína o mRNA) puede diagnosticarse utilizando los métodos y los materiales descritos en la presente. Estos incluyen, tal como se describe de manera más completa posteriormente, cáncer, otras enfermedades de proliferación celular acelerada, trastornos inmunológicos, fertilidad, infertilidad, y otras. Además, debido a que el grado al cual se eleva la actividad de la telomerasa en las células del cáncer está correlacionado con las características del tumor, como el potencial metastático, puede utilizarse el monitoreo de los niveles de hTRT, mRNA o proteína para calcular y predecir la progresión probable a futuro de un tumor.

En un aspecto, los métodos de diagnóstico y prognóstico de la invención vinculan la determinación de si un producto del gene de la TRT humana está presente en una muestra biológica (por ejemplo, de un paciente) . En un segundo aspecto, la abundancia del producto del gene de la hTRT en una muestra biológica (por ejemplo, de un paciente) se determina y se compara con la abundancia en una muestra de control (por ejemplo, células o tejidos normales) . En un tercer aspecto, se determina la localización celular o intracelular de un producto del gene de la hTRT en una muestra de célula o tejido. En un cuarto aspecto, las células huésped (por ejemplo, del paciente) se someten a un ensayo para identificar los ácidos nucléicos con secuencias características de una propensidad hereditaria para la expresión del gene de la hTRT anormal (cantidad, regulación o producto anormal) , como el que se utiliza para la clasificación genética o la asesoría genética. Ensayos pueden ser utilizados para detectar la presencia de anticuerpos anti-hTRT (por ejemplo, en el suero del paciente) . Los métodos descritos posteriormente con algunos detalles son indicativos de los ensayos exitosos que pueden llevarse a cabo utilizando las secuencias y las relaciones presentadas en esta invención. Sin embargo, muchas otras variaciones u otras aplicaciones de estos ensayos serán aparentes para aquellas personas con capacidad ordinaria en la técnica en vista de esta presentación.

Se reconocerá que, a pesar de que los ensayos presentados a continuación están en términos de métodos de diagnóstico y prognóstico, estos pueden utilizarse cuando tenga que detectarse, cuantificarse o caracterizarse un gene de hTRT, un producto del gene o una variante. Por lo tanto, por ejemplo, los métodos de "diagnóstico" descritos a continuación son útiles para los ensayos de la hTRT o la telomerasa durante la producción y purificación de la hTRT o telomerasa humana, para la caracterización de las líneas celulares derivadas de las células humanas (por ejemplo, para identificar líneas inmortales) , para la caracterización de células, animales no humanos, plantas, hongos, bacterias u otros organismos que incluyan un gene de TRT humana o un producto del gene (o fragmentos del mismo) .

Tal como se utiliza en la presente, el término "diagnóstico" tiene su significado usual de identificar la presencia o naturaleza de una enfermedad (por ejemplo, cáncer) , una condición (por ejemplo, infértil, activada) . o estado (por ejemplo, fértil) , y el término "prognóstico" tiene su significado usual de predecir el desarrollo probable y/o resultado de una enfermedad o condición. A pesar de que estos dos términos se utilizan de formas de alguna manera diferentes en el ambiente clínico, se entenderá que cualquiera de los ensayos o formatos de ensayos presentados posteriormente en referencia al "diagnosis" son igualmente adecuados para la determinación de la prognosis porque se ha establecido adecuadamente que los niveles más altos de actividad de la telomerasa están asociados con prognosis más débiles para los pacientes de cáncer, y porque la presente invención proporciona métodos de detección específicos para la hTRT, que se expresa a niveles que se correlacionan estrechamente con la actividad de la telomerasa en una célula.

2) DIAGNOSIS Y PROGNOSIS DEL CÁNCER

La determinación del nivel de un gene de la hTRT, mRNA o proteína arriba del rango normal o estándar indica la presencia de células de telomerasa positiva, o inmortales, de las cuales ciertas células tumorosas son ejemplos. Debido a que ciertas células embriónicas y fetales, así como ciertas células impulsoras adultas, expresan la telomerasa, la presente invención también proporciona métodos para determinar otras condiciones, como por ejemplo el embarazo, por medio de la detección o aislamiento de las células fetales de telomerasa positiva de la sangre materna. Estos valores pueden utilizarse para llevar a cabo, o ayudar a llevar a cabo un diagnóstico, aún cuando las células no hayan sido clasificadas como cancerosas o detectadas o clasificadas de cualquier otra forma utilizando los métodos tradicionales. Por lo tanto, los métodos de la presente invención permiten la detección o verificación de condiciones cancerosas o de otro tipo, asociadas con la telomerasa con una mayor confianza, y por lo menos en algunos casos en etapas iniciales. Los ensayos para la invención permiten la discriminación entre diferentes clases y grados de tumores humanos u otras enfermedades de proliferación celular proporcionando ensayos cuantitativos para el gene de la hTRT y los productos del gene, y de esta manera facilitan la selección de regímenes de tratamiento adecuados y diagnósticos precisos. Además, debido a que los niveles de actividad de la telomerasa pueden utilizarse para distinguir entre los tumores malignos y benignos (por ejemplo, Patente de los Estados Unidos Nº 5, 489, 508; Himaya y colaboradores, 1997, Procedimiento de la Asociación Norteamericana de Investigación del Cáncer 38:637) , para predecir la inmanencia de invasión (por ejemplo, Patente de los Estados Unidos Nº 5, 639, 613; Yashima y colaboradores, 1997, Procedimiento de la Asociación Norteamericana de Investigación del Cáncer 38:326) , y para correlacionar con el potencial metastático (por ejemplo, Patente de los Estados Unidos Nº 5, 648, 215; Pandita y colaboradores, 1996, Procedimiento de la Asociación Norteamericana de Investigación del Cáncer 37:559) , estos ensayos serán útiles para la profiláxis, detección y tratamiento de una amplia variedad de cánceres humanos.

Para la prognosis de los cánceres (u otras enfermedades o condiciones caracterizadas por una telomerasa elevada) , se determina un valor de prognóstico del producto del gene de la hTRT (mRNA o proteína) o la actividad para un tipo de tumor en particular, clase o grado, tal como se describe a continuación. Los niveles de la hTRT, proteína o mRNA

o la actividad de la telomerasa en un paciente también pueden ser determinados (por ejemplo, utilizando los ensayos presentados en la invención) y comparados con el nivel del prognóstico.

Dependiendo del ensayo utilizado, en algunos casos la abundancia de un producto del gene de la hTRT en una muestra, será considerada como elevada cuando sea detectable por el ensayo. Debido a la baja abundancia de hTRT, mRNA y proteína incluso en las células de telomerasa positiva, y a la rareza o no existencia de estos productos del gene en células normales o de telomerasa negativa, se requieren ensayos sensibles para detectar el producto del gene de la hTRT si está presente de hecho en las células normales. Si se seleccionan ensayos menos sensibles, los productos del gene de la hTRT no podrán detectarse en tejido sano, pero serán detectables en el cáncer de telomerasa positiva u otras células de telomerasa positiva. Por lo general, la cantidad de producto del gene de la hTRT en una muestra elevada es de por lo menos aproximadamente cinco, con frecuencia por lo menos aproximadamente diez, con mayor frecuencia de por lo menos aproximadamente 50, y con mucha frecuencia por lo menos aproximadamente de 100 a 1000 veces más que los niveles en las células de control de telomerasa negativa

o células de tejido sanos en un adulto, donde el porcentaje de células normales de telomerasa positiva es muy bajo.

Los métodos de diagnóstico y prognóstico de la presente invención pueden emplearse con cualquier tipo de célula o tejido de cualquier origen, y pueden utilizarse para detectar una célula inmortal o neoplástica, o un tejido tumoroso, o cáncer, de cualquier origen. Los tipos de cáncer que pueden detectarse incluyen, pero no se limitan a, todos aquellos enlistados anteriormente en la discusión sobre aplicaciones terapéuticas de la hTRT.

Los ensayos de la invención también son útiles para monitorear la eficacia de la intervención terapéutica en pacientes que son tratados con regímenes anticancerosos. Los regímenes anticancerosos que pueden monitorearse incluyen todos los tratamientos aprobados actualmente (incluyendo la quimioterapia, terapia de radiación y cirugía) y también incluyen tratamientos que serán aprobados en el futuro, como las terapias de inhibición o activación de la telomerasa tal como se describe en la presente. (Consultar por ejemplo, Publicación PCT Nº 96/01835 y 96/40868 y la Patente de los Estados Unidos Nº 5, 583, 016; todas las cuales se incorporan por referencia en su totalidad) .

En otro aspecto, los ensayos descritos posteriormente son útiles para detectar ciertas variaciones en la secuencia del gene de la hTRT (mutaciones y alelos de la hTRT hereditarios) que indican una predilección para el cáncer u otras condiciones asociadas con la regulación anormal de la actividad de la telomerasa (infertilidad, envejecimiento prematuro) .

3) DIAGNÓSTICO DE CONDICIONES DIFERENTES AL CÁNCER

Además del diagnóstico de cánceres, los ensayos de la presente invención tienen varias otras aplicaciones. La presente invención proporciona reactivos y métodos de diagnosis de condiciones o enfermedades caracterizadas por una expresión insuficiente o excesiva de telomerasa o productos del gene de la hTRT en las células. En los adultos, un nivel bajo de actividad de la telomerasa se encuentra normalmente en un complemento limitado de células somáticas humanas normales, por ejemplo, células impulsoras, linfocitos activados y células germinales y está ausente de otras células somáticas. De esta manera, la detección de hTRT o actividad de la telomerasa en las células en donde está normalmente ausente o inactiva, o la detección a niveles anormales (es decir, más arriba o más abajo que lo normal) en las células en las que la hTRT está normalmente presente a un nivel bajo (como por ejemplo, las células impulsadoras, linfocitos activados y células germinales) , pueden diagnosticarse en una enfermedad o condición relacionada con la telomerasa, o utilizarse para identificar o aislar un tipo específico de célula (es decir, para aislar las células impulsadoras) . Los ejemplos de estas enfermedades y condiciones incluyen: enfermedades de proliferación celular, trastornos inmunológicos, infertilidad, enfermedades de función celular inmune, embarazo, anormalidades fetales, envejecimiento prematuro y otros. Además, los ensayos de la invención son útiles para monitorear la efectividad de la intervención terapéutica (incluyendo, pero sin limitarse a, los medicamentos que modulan la actividad de la telomerasa) en un paciente o en un ensayos basado en células o animales.

En un aspecto, la invención proporciona ensayos útiles para el diagnóstico de la infertilidad. Las células germinales humanas (por ejemplo, células de espermatogonios, sus progenitores o descendientes) son capaces de una proliferación indefinida y se caracterizan por una actividad alta de la telomerasa. Los niveles anormales de productos o niveles disminuidos de productos del gene de la hTRT pueden dar como resultado una producción inadecuada o anormal de espermatozoides, lo que producirá infertilidad o trastornos en la reproducción. De acuerdo con esto, la invención proporciona ensayos (métodos y reactivos) para la diagnosis y el tratamiento de trastornos reproductivos "basados en la telomerasa". De manera similar, los ensayos pueden utilizarse para monitorear la eficacia de los anticonceptivos (por ejemplo, los anticonceptivos masculinos) que se enfocan en o afectan indirectamente la producción de esperma (y que reducirían los niveles de la hTRT o actividad de la telomerasa) .

En otro aspecto, la invención proporciona ensayos para el análisis de los niveles y función de la telomerasa y la hTRT en las células germinales, células fetales, células embriónicas, linfocitos activados y células germinales hematopoyéticas. Por ejemplo, los ensayos para la detección del producto del gene de la hTRT pueden utilizarse para monitorear la función inmune por lo general (por ejemplo, monitoreando la prevalencia de los linfocitos activados o la abundancia de células impulsoras progenitoras) , para identificar o seleccionar o aislar los linfocitos activados o las células impulsoras (en base a los niveles de la hTRT elevados) , y para monitorear la eficacia de las intervenciones terapéuticas que se enfocan en estos tejidos (por ejemplo, agentes inmunosupresores o intentos terapéuticos para extender una población de células impulsoras) .

Ensayos pueden ser utilizados para la identificación de inmunoglobulinas anti-telomerasa y anti-TRT (que se encuentran en el suero de un paciente) . Los materiales y ensayos descritos en la presente invención pueden ser utilizados para identificar los pacientes en los que se encuentran estos anticuerpos autoinmunes, permitiendo el diagnóstico y el tratamiento de la condición asociada con las inmunoglobulinas.

4) MONITOREO DE LAS CÉLULAS EN EL CULTIVO

Los ensayos descritos en la presente invención también son útiles para monitorear la expresión de los productos del gene de la hTRT y la caracterización de los genes de la hTRT en las células ex vivo o in vitro. Como los niveles de hTRT elevados son característicos de las células inmortalizadas, los ensayos de la invención pueden ser utilizados, por ejemplo, para clasificar, o para identificar, las células inmortalizadas o para identificar un agente capaz de mortalizar las células inmortalizadas inhibiendo la expresión o función de la hTRT. Por ejemplo, el ensayo será útil para identificar las células inmortalizadas por la expresión aumentada de la hTRT en la célula, por ejemplo, mediante la expresión de una hTRT recombinante o mediante la expresión aumentada de una hTRT codificada de manera endógena (por ejemplo, mediante la activación del promotor) .

De manera similar, estos ensayos pueden utilizarse para monitorear la expresión de la hTRT en las células o animales transgénicos (por ejemplo, levadura o células humanas que contienen un gene de la hTRT) . En particular, los efectos de ciertos tratamientos (por ejemplo, la aplicación de antagonistas de la telomerasa conocidos o putativos) en los niveles de la hTRT en células humanas y no humanas que expresan la hTRT de la invención, pueden utilizarse para identificar los medicamentos útiles y los candidatos del medicamento (por ejemplo, medicamentos moduladores de la actividad de la telomerasa) .

B) VALORES NORMALES, DEL DIAGNÓSTICO Y DEL PROGNÓSTICO

Pueden llevarse a cabo ensayos para la presencia o la cantidad de los productos del gene de la hTRT y los resultados pueden interpretarse en una variedad de formas, dependiendo del formato del ensayo, la naturaleza de la muestra que se está sometiendo a ensayo y la información buscada. Por ejemplo, la abundancia de estado continuo de los productos del gene de la hTRT es tan baja en la mayoría de los tejidos somáticos humanos que no es detectable por ciertos ensayos. Además, por lo general no existe actividad de telomerasa en las células de estos tejidos, lo que facilitaba la verificación de la actividad. Por el contrario, la proteína de hTRT y/o el mRNA de hTRT o la telomerasa es lo suficientemente abundante en otros tejidos de telomerasa positiva, por ejemplo, los tumores malignos, de tal forma que esta misma puede detectarse utilizando los mismos ensayos. Incluso en aquellos tipos de células somáticas en las cuales pueden detectarse normalmente los niveles bajos de la actividad de la telomerasa (por ejemplo, células impulsoras y ciertas células del sistema hematopoyético activado) , los niveles del mRNA de hTRT y la actividad de la telomerasa son una pequeña fracción (por ejemplo, calculada en aproximadamente 1% o menos) de los niveles en las células inmortales; por lo tanto, las células inmortales y mortales pueden distinguirse fácilmente a través de los métodos de la presente invención. Podrá apreciarse que, cuando se utiliza un ensayo "menos sensible", la detección pura del producto del gene de la hTRT en una muestra biológica puede en sí ser diagnóstica, sin el requerimiento de análisis adicionales. Además, a pesar de que los ensayos descritos posteriormente pueden llevarse a cabo de una manera exquisitamente sensible, también pueden, si se desea, realizarse de una manera menos sensible (por ejemplo, a través de una elección juiciosa de amortiguadores, condiciones de lavado, números de redondeos de amplificación, reactivos y/o la elección de amplificadores de señal) . De esta manera, puede designarse virtualmente cualquier ensayo para que detecte los productos del gene de la hTRT sólo en las muestras biológicas en las que estén presentes a una concentración particular, por ejemplo, una concentración más alta que en el tejido sano u otro tejido de control. En este caso, cualquier nivel detectable del mRNA de hTRT o de la proteína será considerado como elevado en células del tejido somático humano post-natal (que no sean las células hematopoyéticas y otras células impulsoras) .

Sin embargo, en algunos casos, será deseable establecer valores normales o de línea base (o rangos) para los niveles de expresión del producto del gene de la hTRT, particularmente cuando se utilizan ensayos muy sensibles capaces de detectar niveles muy bajos de los productos del gene de la hTRT que pudieran estar presentes en las células somáticas normales. Pueden determinarse niveles normales de expresión o productos de expresión normal para cualquier población en particular, subpoblación, o grupo de organismos de acuerdo con los métodos estándares conocidos para las personas capacitadas en la técnica y empleando los métodos y reactivos de la invención. Por lo general, los niveles de la línea base (normales) de la proteína de la hTRT o el mRNA de la hTRT son determinados mediante la cuantificación de la cantidad de proteína y/o el mRNA de la hTRT en las muestras biológicas (por ejemplo, fluidos, células o tejidos) obtenidas de sujetos normales (sanos) , por ejemplo, un sujeto humano. Para ciertas muestras y propósitos, podríamos desear cuantificar la cantidad del producto del gene de la hTRT en una base por célula, o por célula tumorosa. Para determinar la celularidad de una muestra, podemos medir el nivel de un producto del gene expresado constitutivamente u otro producto del gene expresado en niveles conocidos en las células del tipo del cual se tomó la muestra. De manera alternativa, los valores normales de la proteína de la hTRT o el mRNA de la hTRT pueden determinarse cuantificando la cantidad de RNA/proteína de hTRT en las células o tejidos que se sabe que están sanos, que se obtienen del mismo paciente del cual se recolectaron las células enfermas (o posiblemente enfermas) o de un individuo sano. De manera alternativa, los niveles de la línea base pueden definirse en algunos casos como el nivel presente en las células somáticas humanas no inmortales en el cultivo. Es posible que los valores normales (línea base) puedan diferir de cierta forma entre los diferentes tipos de células (por ejemplo, los niveles del mRNA de hTRT serán más altos en los testículos que en el riñón) , o de acuerdo con la edad, sexo, o condición física de un paciente. De esta manera, por ejemplo, cuando se utiliza un ensayo para determinar cambios en los niveles de la hTRT asociados con el cáncer, las células utilizadas para determinar el rango normal de la expresión del producto del gene de la hTRT, pueden ser las células de personas de la misma edad o de edad diferente, dependiendo de la naturaleza del estudio. La aplicación de métodos estadísticos estándares utilizados en la genética molecular permite la determinación de niveles de expresión de línea base, así como también permite la identificación de desviaciones significativas de los niveles de la línea base mencionados.

Al llevar a cabo los métodos de diagnóstico y prognóstico de la invención, tal como se describió anteriormente, algunas veces será útil referirse a los valores de "diagnóstico" y de "prognóstico". Tal como se utiliza en la presente invención, el "valor de diagnóstico" se refiere a un valor que está determinado para el producto del gene de la hTRT detectado en una muestra que, al compararse con un rango normal (o de "línea base") del producto del gene de la hTRT indica la presencia de una enfermedad. La enfermedad puede estar caracterizada por una actividad alta de la telomerasa (por ejemplo, cáncer) , la ausencia de actividad de la telomerasa (por ejemplo, infertilidad) o algún valor intermedio. El "valor de prognóstico" se refiere a una cantidad del producto del gene de la hTRT detectado en un tipo de célula dada (por ejemplo, una célula de tumor maligno) que es consistente con un diagnóstico y un prognóstico particular para la enfermedad (por ejemplo, cáncer) . La cantidad (incluyendo una cantidad de cero) del producto del gene de la hTRT detectada en una muestra se compara con el valor del prognóstico para la célula de tal forma que la comparación relativa de los valores indica la presencia de la enfermedad o el probable resultado de la progresión de la enfermedad (por ejemplo, cáncer) . En una forma de realización, por ejemplo, para evaluar la prognosis del tumor, se recolectan datos para obtener una correlación estadísticamente significativa de los niveles de la hTRT con diferentes clases o grados de tumor. Se establece un rango predeterminado de niveles de la hTRT para la misma muestra de célula o tejido obtenida a partir de sujetos que tienen resultados clínicos conocidos. Se realiza un número suficiente de mediciones para producir un valor estadísticamente significativo (o rango de valores) con el cual se realizará la comparación. El rango predeterminado de los niveles de la hTRT o actividad para una muestra de célula o tejido dado puede utilizarse entonces para determinar un valor o rango para el nivel del producto del gene de la hTRT que se correlacionaría con una prognosis favorable (o menos desfavorable) (por ejemplo, un "nivel bajo" en el caso del cáncer) . También puede determinarse de manera similar un rango correspondiente a un "nivel alto" correlacionado con una (o más) prognosis desfavorables en el caso del cáncer. El nivel del producto del gene de la hTRT a partir de una muestra biológica (por ejemplo, la muestra de un paciente) puede de esta manera ser determinado y comparado con los rangos altos y bajos y pueden utilizarse para predecir un resultado clínico.

A pesar de que la discusión anterior se refiere al cáncer para ilustrar el ejemplo, se entenderá que los valores de diagnóstico y prognóstico también podrán determinarse para otras enfermedades (por ejemplo, enfermedades de proliferación celular) y condiciones y que, para las enfermedades o condiciones que no sean cáncer, puede correlacionarse un nivel "alto" con el resultado deseado y puede correlacionarse un nivel "bajo" con un resultado desfavorable. Por ejemplo, algunas enfermedades pueden caracterizarse por una deficiencia (por ejemplo, nivel bajo) en la actividad de la telomerasa en las células impulsoras, linfocitos activados o las células de la línea germinal. En estos casos, los niveles "altos" de productos del gene de la hTRT en relación con las células de edad y/o tipo similar (por ejemplo, de otros pacientes u otros tejidos en un paciente en particular) pueden correlacionarse con un resultado favorable.

Podrá apreciarse que los métodos del ensayo no requieren necesariamente la medición de los valores absolutos de la hTRT, a menos que se desee, debido a que los valores relativos con suficientes para muchas aplicaciones de los métodos de la presente invención. Cuando se desea la cuantificación, la presente invención proporciona reactivos, de tal forma que puede utilizarse virtualmente cualquier método conocido para cuantificar los productos del gene.

Los ensayos de la invención también pueden utilizarse para evaluar la eficacia de un régimen de tratamiento terapéutico particular en estudios de animales, en pruebas clínicas, o en el monitoreado del tratamiento de un paciente individual. En estos casos, puede ser deseable establecer la línea base para el paciente antes de iniciar la terapia y repetir los ensayos una o más veces a lo largo del curso del tratamiento, por lo general en una base regular, para evaluar si los niveles de la hTRT se están moviendo hacia el punto final deseado (por ejemplo, la expresión reducida de la hTRT cuando el ensayo es para el cáncer) como resultado del tratamiento.

Una persona capacitada en la técnica apreciará que, además de la cantidad o abundancia de los productos del gene de la hTRT, también pueden identificarse patrones de expresión anormal o variante (por ejemplo, cantidades anormales de los variantes de empalme del RNA) o productos de expresión anormal o variante (por ejemplo, transcripciones mutadas, polipéptidos sin sentido o truncados) mediante una comparación con los niveles de expresión normales y los productos de expresión normales. En estos casos, la determinación de "normal" o "línea base" implica la identificación de organismos y/o tejidos sanos (es decir, organismos y/o tejidos sin desregulación de la expresión de la hTRT o desarrollo neoplástico) y la medición de los niveles de expresión de los productos del gene de la hTRT variante (por ejemplo, variantes del empalme) , o la secuenciación o detección del gene de la hTRT, el mRNA, o el cDNA transcrito inverso para obtener o detectar variaciones típicas (normales) de la secuencia. La aplicación de los métodos estadísticos estándares utilizados en la genética molecular permite la determinación de desviaciones significativas a partir de los niveles de la línea base mencionados.

C) DETECCIÓN Y CUANTIFICACIÓN DE LOS PRODUCTOS DEL GENE DE LA TRT

Tal como se ha enfatizado en la presente invención, los productos del gene de la hTRT se encuentran por lo general en la mayoría de las células somáticas normales en niveles extremadamente bajos. Por ejemplo, el mRNA que codifica la proteína de la hTRT es extremadamente raro o ausente en todos los tipos de células con telomerasa negativa estudiados hasta la fecha. En las células inmortales, como por ejemplo las células 293, el mRNA de la hTRT puede estar presente en sólo aproximadamente 100 copias por célula, mientras que las células somáticas normales pueden tener incluso una o cero copias por célula. Por lo tanto, será aparente que, cuando se desean ensayos altamente sensibles para los productos del gene de la hTRT, algunas veces se tendrá la ventaja de incorporar tecnologías de amplificación de señales o de objetivo dentro del formato del ensayo. Consultar, por ejemplo, Plenat y colaboradores, 1997, Patología An. 17:17 (amplificación de señales de tiramida de fluoresceinilo) ; Zehbe y colaboradores, 1997, Boletín de Patología, 150:1553 (deposición del informador catalizado) ; otras referencias enlistadas en la presente (por ejemplo, para la amplificación de señales del bDNA, para la PCR y otros formatos de amplificación objetivo) ; y otras técnicas conocidas en la técnica.

Tal como se indicó anteriormente, con frecuencia es innecesario cuantificar el mRNA de la hTRT o la proteína en los ensayos presentados en esta invención, porque la detección de un producto del gene de la hTRT (bajo condiciones del ensayo en las que el producto no sea detectable en el control, por ejemplo, las células de telomerasa negativa) es en sí suficiente para un diagnóstico. Como otro ejemplo, cuando los niveles del producto encontrados en una prueba (por ejemplo, un tumor) y las muestras de control (por ejemplo, una célula sana) se comparan directamente, la cuantificación puede ser superflua.

Sin embargo, cuando se desee, las cantidades del producto del gene de la hTRT medido en los ensayos descritos en la presente invención pueden describirse en una variedad de formas, dependiendo del método de medición y conveniencia. Por lo tanto, las cantidades normales, el diagnóstico, el prognóstico, las cantidades altas o bajas de mRNA/proteína de la hTRT, pueden expresarse como unidades estándares de peso por cantidad de muestra biológica (por ejemplo, picogramos por gramo de tejido, picogramos por células 1012) , como un número de moléculas por cantidad de muestra biológica (por ejemplo, transcripciones/célula, moles/célula) , como unidades de actividad por célula o por otra cantidad unitaria, o mediante métodos similares. La cantidad del producto del gene de la hTRT también puede expresarse en relación a la cantidad de otra molécula; los ejemplos incluyen: número de transcripciones de la hTRT en la muestra/número de transcripciones del rRNA 28S en la muestra; nanogramos de proteína de la hTRT/nanogramos de proteína total; y similares.

Al medir los productos del gene de la hTRT en dos (o más) muestras diferentes, algunas veces será útil tener una base común de comparación para las dos muestras. Por ejemplo, al comparar una muestra de tejido normal y una muestra de tejido canceroso, pueden compararse cantidades equivalentes del tejido (por peso, volumen, número de células, etc.) . De manera alternativa, pueden utilizarse equivalentes de una molécula del marcador (por ejemplo, 28S rRNA, hTR, actividad de la telomerasa, longitud del telómero, actina) . Por ejemplo, la cantidad de proteína de la hTRT en una muestra de tejido sano que contiene 10 picogramos de 28S rRNA puede compararse con una muestra de un tejido enfermo que contiene la misma cantidad de 28S rRNA.

También será reconocido por aquellas personas capacitadas en la técnica que virtualmente cualquiera de los ensayos descritos en la presente puede designarse como cuantitativo. Por lo general, una cantidad o fuente conocida de un producto del gene de la hTRT (por ejemplo, producido utilizando los métodos y las composiciones de la invención) se utiliza para calibrar el ensayo.

En ciertas formas de realización, se seleccionan formatos del ensayo que detecten la presencia, ausencia o abundancia de un alelo de la hTRT o un producto del gene en cada célula en una muestra (o en un muestreo representativo) . Los ejemplos de estos formatos incluyen aquellos que detectan una señal mediante histología (por ejemplo, inmunohistoquímica con intensificación de señal o pasos de amplificación intensificadores del objetivo) o el análisis de células activado por fluorescencia o clasificación celular (FACS) . Estos formatos tienen ventajas particulares cuando tratan con una población de células altamente heterogéneas (por ejemplo, que contiene tipos de células múltiples en las que sólo uno o unos cuantos tipos poseen niveles de hTRT elevados, o una población de células similares que expresen la telomerasa a niveles diferentes) .

D) RECOLECCIÓN DE MUESTRAS

El gene de la hTRT o el producto del gene (es decir, el mRNA o el polipéptido) se detecta y/o se cuantifica de preferencia en una muestra biológica. Estas muestras incluyen, pero sin limitarse a, células (incluyendo células enteras, fracciones de células, extractos de células y células cultivadas o líneas de células) , tejidos (incluyendo la sangre, células sanguíneas (por ejemplo, glóbulos blancos) y muestras de tejidos como por ejemplo las muestras de biopsia con aguja fina (por ejemplo, de la próstata, seno, tiroides, etc.) ) , fluidos corporales (por ejemplo, orina, saliva, fluido amniótico, sangre, fluido peritoneal, fluido pleural, semen) o células recolectadas de lo anterior (por ejemplo, células de la vesícula de la orina, linfocitos de la sangre) , medios (de las células cultivadas o las líneas de células) , y lavados (por ejemplo, de la vesícula y el pulmón) . Las muestras biológicas también pueden incluir secciones de tejidos como por ejemplo, las secciones congeladas tomadas para propósitos histológicos. Para el diagnóstico y prognóstico del cáncer, se obtendrá una muestra de un tejido o un tumor canceroso o precanceroso o sospechoso de ser canceroso. Algunas veces será conveniente congelar una muestra biológica para un análisis posterior (por ejemplo, al monitorear la eficacia de los tratamientos medicinales) .

En algunos casos, las células o tejidos pueden fraccionarse antes del análisis. Por ejemplo, en una biopsia de tejido de un paciente, puede utilizarse un clasificador de células (por ejemplo, un clasificador de células activado con fluorescencia) para clasificar las células de acuerdo con características tales como la expresión de un antígeno en la superficie (por ejemplo, un antígeno específico de un tumor) de acuerdo con métodos conocidos.

A pesar de que la muestra por lo general se toma de un paciente humano o una línea celular, pueden utilizarse los ensayos para detectar los genes homólogos de la hTRT o los productos del gene en muestras de otros animales. De manera alternativa, los genes de la hTRT y los productos del gene pueden someterse a un ensayo en animales u organismos transgénicos que expresen una secuencia de ácido nucleico o proteína de TRT humana.

La muestra puede ser pretratada según sea necesario mediante la dilución en un concentrado o solución amortiguadora apropiada, si se desea. Puede utilizarse cualquier de cierto número de soluciones amortiguadoras acuosas estándares, que empleen uno de una variedad de amortiguadores, como el fosfato amortiguador Tris, o similares, con un pH fisiológico.

Una "muestra biológica" obtenida de un paciente puede referirse ya sea como "muestra biológica" o una "muestra del paciente". Podrá apreciarse que el análisis de una "muestra del paciente" no requiere necesariamente el retiro de células o tejido del paciente. Por ejemplo, los agentes de enlace de la hTRT etiquetados adecuadamente (por ejemplo, anticuerpos o ácidos nucleicos) pueden inyectarse a un paciente y visualizarse (cuando están enlazados al objetivo) utilizando una tecnología de reproducción de imágenes estándares (por ejemplo, CAT, NMR, y similares) .

E) ENSAYOS DEL ÁCIDO NUCLEICO

En una forma de realización, esta invención proporciona los métodos para detectar y/o cuantificar la expresión de los mRNAs de la hTRT (incluyendo el empalme o los variantes de la secuencia y los alelos alternativos) . En una forma de realización alternativa, la invención proporciona métodos para detectar y analizar los genes de la hTRT normales o anormales (o fragmentos de los mismos) . La forma de estos ensayos cualitativos o cuantitativos incluye, pero no se limita a, ensayos basados en la amplificación con o sin amplificación de señales, ensayos basados en la hibridación, y ensayos de amplificación-hibridación en combinación. Las personas capacitadas en la técnica apreciarán que la distinción entre hibridación y amplificación se hace únicamente por conveniencia: tal como se ilustra en los ejemplos posteriores, muchos formatos del ensayo implican elementos tanto de la hibridación como de la amplificación, de tal forma que la categorización se considera en cierta forma arbitraria en algunos casos.

1) PREPARACIÓN DE ÁCIDOS NUCLEICOS

En algunas formas de realización, los ensayos de ácidos nucleicos se llevan a cabo con una muestra de ácido nucleico aislado de la célula, tejido, organismo o línea celular que se somete a prueba. El ácido nucleico (por ejemplo, DNA genómico, ARN o cDNA) puede "aislarse" de la muestra de acuerdo con cualquiera de cierto número de métodos perfectamente conocidos por aquellas personas capacitadas en la técnica. En este contexto, "aislado" se refiere a cualquier separación de las especies u objetivo que será detectado de cualquier otra sustancia en la mezcla, pero no indica necesariamente un grado significativo de purificación del objetivo. Una persona capacitada en la técnica apreciará que, cuando tengan que detectarse alteraciones en el número de copia del gene de la hTRT, el DNA genómico es el objetivo que debe ser detectado. Por el contrario, cuando tienen que detectarse los niveles de expresión de un gene o genes, el ARN es el objetivo que debe ser detectado en un ensayo basado en el ácido nucleico. En una forma de realización preferida, la muestra del ácido nucleico es el mRNA total (es decir, poli (A) + RNA) en una muestra biológica. Los métodos para aislar los ácidos nucleicos son bastante conocidos para las personas capacitadas en la técnica y se describen, por ejemplo, en Tijssen, P. ed. de TÉCNICAS DELABORATORIO EN BIOQUÍMICA Y BIOLOGÍA MOLECULAR: HIBRIDACIÓN CON SONDAS DE ÁCIDO NUCLEICO, PARTE I. TEORÍA Y PREPARACIÓN DEL ÁCIDO NUCLEICO, Elsevier, N.Y. (1993) Capítulo 3, que se incorpora a la presente invención por referencia. En una forma de realización, el ácido nucleico total se aísla a partir de una muestra dada utilizando un método de extracción de guanidinio-fenol-cloroformo ácido y el mRNA poli (A) + se aísla por medio de una cromatografía de columna de oligo-dT o utilizando cuentas magnéticas (dT) n (consultar, por ejemplo, Sambrook y colaboradores, y Ausubel y colaboradores, mencionado anteriormente) .

En formas de realización alternativas, no es necesario aislar los ácidos nucleicos (por ejemplo, el ARN total o poli (A) +) de la muestra biológica antes de llevar a cabo la amplificación, hibridación u otros ensayos. Estas formas de realización tienen ciertas ventajas cuando tiene que medirse el ARN de la hTRT, ya que reduce la posibilidad de pérdida del mRNA de la hTRT durante el aislamiento y el manejo. Por ejemplo, varias técnicas de amplificación como la PCR y la RT-PCR definidas anteriormente, pueden llevarse a cabo utilizando células permeabilizadas (muestras histológicas y análisis de FACS) , células lisadas completas, o fracciones de células crudas como por ejemplo ciertos extractos de células. De preferencia, se toman en consideración pasos para preservar la integridad del ácido nucleico objetivo (por ejemplo, el mRNA) si es necesario (por ejemplo, añadidura de inhibidores de RNAasa) . Los ensayos de amplificación e hibridación también pueden llevarse a cabo in situ, por ejemplo, en las secciones de tejido delgado de una muestra de biopsia o de una monocapa celular (por ejemplo, células sanguíneas o células de cultivo de un tejido no agregado) . La amplificación también puede llevarse a cabo en una célula completa intacta o en células fijas. Por ejemplo, pueden llevarse a cabo los métodos de amplificación de PCR, RT-PCR o LCR, tal como se conocen en la técnica, in situ, por ejemplo, utilizando una polimerasa o una ligasa, un iniciador o iniciadores, y trifosfatos de (desoxi) ribonucleósidos (si se emplea una polimerasa) y una transcriptasa inversa e iniciador (si se va a transcribir el ARN y se va a detectar el cDNA) sobre células fijas, permeabilizadas, o microinyectadas para amplificar el DNA o ARN de la hTRT objetivo. Las células que contienen ARN de la hTRT (por ejemplo, las células de telomerasa positiva) o una secuencias del DNA de la hTRT de interés pueden detectarse de esta manera. Este método con frecuencia es útil cuando se emplean dNTPs etiquetados de manera fluorescente, iniciadores, u otros componentes en conjunto con la microscopía, el análisis de FACS o su equivalente.

2) ENSAYOS BASADOS EN LA AMPLIFICACIÓN

En una forma de realización, los ensayos de la presente invención son ensayos basados en la amplificación para la detección de un gene de la hTRT o un producto del gene. En un ensayo basado en la amplificación, todo o una parte de un gene de la hTRT o transcripción (por ejemplo, mRNA o cDNA; en lo sucesivo también referido como "objetivo") se amplifica, y el producto de la amplificación se detecta posteriormente de manera directa o indirecta. Cuando no existe un gene o un producto del gene implícito para actuar como molde, no se produce el producto de la amplificación (por ejemplo, del tamaño esperado) , o la amplificación no es específica y por lo general no existe un producto de la amplificación único. En contraste, cuando el gene o el producto del gene implícito está presente, la secuencia objetivo se amplifica, proporcionando una indicación de la presencia y/o cantidad del gene implícito o mRNA. Los ensayos basados en la amplificación del objetivo son bastante conocidos por las personas capacitadas en la técnica.

La presente invención comprende la utilización de una amplia variedad de iniciadores y sondas para la detección de los genes de la hTRT y los productos del gene. Estos iniciadores y sondas son lo suficientemente complementarios para el gene de la hTRT o el producto del gene para someter a hibridación el ácido nucleico objetivo. Los iniciadores son por lo general de por lo menos 6 bases de longitud, comúnmente de aproximadamente 10 y aproximadamente 100 bases, por lo general entre aproximadamente 12 y aproximadamente 50 bases, y con frecuencia entre aproximadamente 14 y aproximadamente 25 bases de longitud. Una persona con capacidades en la técnica, después de haber revisado la presente invención, podrá, utilizando los métodos de rutina, seleccionar iniciadores para amplificar todo, o cualquier parte del gene de la hTRT o el producto del gene, o distinguir entre productos del gene variantes, alelos de la hTRT, y similares. La Tabla 2 enlista los iniciadores ilustrativos útiles para la amplificación mediante la PCR de la hTRT, o regiones o productos del gene de la hTRT específicos. Tal como se conoce en la técnica, los oligómeros sencillos (por ejemplo, Patente de los Estados Unidos Nº 5, 545, 522) , los conjuntos inclusivos de oligómeros, o incluso una agrupación degenerada de oligómeros pueden emplearse para la amplificación, por ejemplo, tal como se ilustra mediante la amplificación del cDNA de la TRT del Tetrahymena tal como se describe posteriormente.

La invención proporciona una variedad de métodos para la amplificación y la detección de un gene de la hTRT o un producto del gene, incluyendo la reacción en cadena de la polimerasa (incluyendo todas las variantes, por ejemplo, la PCR de transcriptasa inversa; el Sistema de Amplificación Sunrise (Oncor, Inc., Gaithersburg MD) ; y varios otros conocidos en la técnica) . En una forma de realización ilustrativa, la amplificación mediante PCR se lleva a cabo en una solución de 1l que contiene la muestra del ácido nucleico (por ejemplo, el cDNA obtenido a través de la transcripción inversa del ARN de la hTRT) , 100 1M en cada dNTP (dATP, dCTP, dGTP y dTTP; Pharmacia LKB Biotechnology, NY) , el iniciador de la PCR específico de la hTRT, 1 unidad/polimerasa Taq (Perkin Elmer, Norwalk CT) , 1x de amortiguador de la PCR (50 mM de KCl, 10 mM de Tris, pH 8.3 a temperatura ambiental, 1.5 mM de MgCl2, 0.01% de gelatina) con el recorrido de la amplificación durante aproximadamente 30 ciclos a 94º durante 45 segundos, 55º durante 45 segundos y 72º durante 90 segundos. Sin embargo, tal como se apreciará, pueden realizarse diferentes variaciones para perfeccionar la amplificación de la PCR para cualquier reacción en particular.

Otros métodos de amplificación de objetivos adecuados incluyen la reacción en cadena de la ligasa (LCR; por ejemplo, Wu y Wallace, 1989, Genómica 4:560; Landegren y colaboradores, 1988, Ciencia, 241: 1077, Barany, 1991, Procedimientos Científicos de la Academia Nacional E.U.A., 88: 189 y Barringer y colaboradores, 1990, Genes, 89:117) ; amplificación por desplazamiento de filamentos (SDA; por ejemplo, Walker y colaboradores, 1992, Procedimientos Científicos de la Academia Nacional E.U.A., 89: 392-396) ; amplificación por transcripción (por ejemplo, Kwoh y colaboradores, 1989, Procedimientos Científicos de la Academia Nacional E.U.A., 86: 1173) ; duplicación de secuencia autosostenida (3SR; por ejemplo, Fahy y colaboradores, 1992, Aplicación de Métodos de la PCR, 1: 25, Guatelli y colaboradores, 1990, Procedimientos Científicos de la Academia Nacional E.U.A., 87: 1874) ; la amplificación basada en la secuencia del ácido nucleico (NASBA, Cangene, Mississauga, Ontario; por ejemplo, Compton, 1991, Naturaleza, 350:91) ; el sistema de amplificación basado en la transcripción (TAS) ; y el sistema de duplicación de secuencia autosostenida (SSR) . Cada una de las publicaciones antes mencionadas se incorporan en la presente por referencia. Una variante útil de la PCR es la PCR ELISA (por ejemplo, Boehringer Mannheim Cat. NI 1 636 111) en donde se incorpora la digoxigenina-dUTP dentro del producto de la PCR. La mezcla de la reacción de la PCR se desnaturaliza y se somete a hibridación con un oligonucleótido etiquetado con biotina diseñado para templarse en una secuencia interna del producto de la PCR. Los productos de la hibridación se inmovilizan en placas recubiertas de estreptavidina y se detectan utilizando anticuerpos de anti-digoxigenina. Los ejemplos de técnicas suficientes para dirigir a personas capacitadas en la técnica a través de los métodos de amplificación in vitro se encuentran en TECNOLOGÍA DE LA PCR: PRINCIPIOS Y APLICACIONES PARA LAAMPLIFICACIÓN DEL DNA, H. Erlich, Ed. Freeman Press, Nueva York, NY (1992) ; PROTOCOLOS DE LA PCR: UNA GUÍA PARA LOS MÉTODOS Y APLICACIONES, eds. Innis, Gelfland, Snisky y White, Academic Press, SanDiego, CA (1990) ; Mattila y colaboradores, 1991, Investigación de Ácidos Nucleicos, 19:4967; Eckert y Kunkel, (1991) MÉTODOS Y APLICACIONES DE LA PCR, 1: 17; PCR, eds. McPherson, Quirkes y Taylor, IRL Press, Oxford; Patentes de los E.U.A. NI 4, 683, 195, 4, 683, 202 y 4, 965, 188; Barringer y colaboradores, 1990, Gene, 89:117; Lomell y colaboradores, 1989, Boletín de Química Clínica, 35:1826, cada una de las cuales se incorpora a la presente invención para todos los propósitos.

Los productos amplificados pueden analizarse directamente, por ejemplo, por tamaño conforme a lo determinado por la electrofóresis con gel; mediante la hibridación a un ácido nucleico objetivo inmobilizado sobre un soporte sólido como por ejemplo una cuenta, membrana, portaobjetos o microplaqueta; mediante la secuenciación; inmunológicamente, por ejemplo, mediante la PCR-ELISA, mediante la detección de una señal fluorescente, fosforescente o radioactiva; o por medio de cualquier de una variedad de otros medios conocidos. Por ejemplo, un ejemplo ilustrativo de un método de detección utiliza los iniciadores de la PCR aumentados con circuitos de horquillas enlazados a la fluoresceína y un ácido benzoico derivado que sirve como extinguidor, de tal forma que la fluorescencia se emite únicamente cuando los iniciadores se desdoblan para enlazar sus objetivos y se presenta la duplicación.

Debido a que el mRNA de la hTRT se expresa por lo general como una transcripción extremadamente rara, presente a niveles muy bajos incluso en las células de telomerasa positiva, con frecuencia es conveniente optimizar o incrementar la señal resultante del paso de la amplificación. Una forma de hacer esto es aumentando el número de ciclos de la amplificación. Por ejemplo, a pesar de que 20-25 ciclos son adecuados para la amplificación de la mayor parte de los mRNAs utilizando la reacción en cadena de la polimerasa bajo condiciones de reacción estándares, la detección del mRNA de la hTRT en muchas muestras puede requerir tantos como 30 a 35 ciclos de amplificación, dependiendo del formato de la detección y la eficiencia de la amplificación. Podrá reconocerse que la selección juiciosa de las condiciones de la amplificación, incluyendo el número de ciclos de amplificación, puede utilizarse para designar un ensayo que da como resultado una producto de la amplificación sólo cuando existe una cantidad del objetivo del umbral en la muestra de prueba (es decir, de tal forma que sólo las muestras con un nivel alto de mRNA de la hTRT proporcionen un resultado "positivo") . Además, se sabe que los métodos incrementan la señal producida por la amplificación de la secuencia del objetivo. Los métodos para aumentar la capacidad de detectar el objetivo amplificado incluyen el sistema de amplificación de señales como: la amplificación de señales del DNA ramificado (por ejemplo, Patente de los Estados Unidos NI 5, 124, 246; Urdea, 1994, Bio/Tecnología, 12:926) ; el sistema de amplificación de señales de tiramida (TSA) (Du Pont) ; la amplificación de señales catalíticas (CSA; Dako) ; los sistemas de Q Beta Replicasa (Tyagi y colaboradores, 1996, Procedimientos Científicos de la Academia Nacional E.U.A., 93:5395) ; o similares.

Una persona capacitada en la técnica se dará cuenta de que sea cual sea el método de amplificación que se utilice, pueden emplearse una variedad de métodos cuantitativos conocidos en la técnica si se desea realizar la cuantificación. Por ejemplo, cuando se desee, dos o más polinucleótidos pueden co-amplificarse en una sola muestra. Este método puede utilizarse como un método conveniente para cuantificar la cantidad del mRNA de la hTRT en una muestra, porque las reacciones de transcripción inversa y de amplificación se llevan a cabo en la misma reacción para un polinucleótido objetivo y de control. La coamplificación del polinucleótido de control (por lo general presente en una concentración o número de copia conocida) puede utilizarse para la normalización con el número de células en la muestra en comparación con la cantidad de la hTRT en la muestra. Los polinucleótidos de control adecuados para las reacciones de la amplificación incluyen el DNA, el ARN expresado a partir de los genes de mantenimiento, los genes expresados de manera constitutiva, y los RNAs sintetizados in vitro o los DNAs agregados a la mezcla de la reacción. Los polinucleótidos de control endógenos son aquellos que ya están presentes en la muestra, mientras que los polinucleótidos de control exógenos se agregan a una muestra, creando una reacción "con inflorescencia de espigas". Los RNAs de control que se ilustran incluyen el ARN de º-actina, el ARN de GAPDH, los snRNAs, la hTR y el rRNA 28S expresado de manera endógena (consultar Khan y colaboradores, 1992, Carta Neurociencia, 147:114) . Los polinucleótidos de control exógenos incluyen un cM AW106 sintético, que puede sintetizarse como un filamento de sentido a partir de pAW106 por medio de la polimerasa T7. Podrá apreciarse que para que el método de coamplificación sea útil para la cuantificación, los polinucleótidos de control y de objetivo deben por lo general amplificarse ambos en un rango lineal. Los protocolos detallados para laPCR cuantitativa pueden encontrarse en PROTOCOLOS DE LA PCR, UNA GUÍA PARA LOS MÉTODOS Y APLICACIONES, Innis y colaboradores, Academic Press Inc., N.Y., (1990) ; y Ausubel y colaboradores, mencionado anteriormente (Unidad 15) y Diaco, R. (1995) Consideraciones Prácticas para el Diseño de Ensayos de PCR Cuantitativos, en ESTRATEGIAS DE LA PCR, p. 84-108, Innis y colaboradores, eds. Academic Press, Nueva York.

Dependiendo de la secuencia del estándar endógeno o exógeno, pueden utilizarse diferentes conjuntos de iniciadores para la reacción de la coamplificación. En un método, denominado amplificación competitiva, la PCR cuantitativa implica la coamplificación de manera simultánea de una cantidad conocida de una secuencia de control utilizando los mismos iniciadores utilizados para la amplificación del ácido nucleico objetivo (un par de dos iniciadores) . En una forma de realización alternativa, conocida como competencia no competitiva, la secuencia de control y la secuencia de objetivos (por ejemplo, el cDNA de la hTRT) se amplifican utilizando diferentes iniciadores (es decir, dos pares de dos iniciadores) . En otra forma de realización alternativa, llamada amplificación semicompetitiva, se utilizan tres iniciadores, uno de los cuales es específico de la hTRT, otro es específico del control y otro es capaz de templar ambas secuencias de objetivo y de control. La amplificación semicompetitiva se describe en la Patente de los Estados Unidos NI 5, 629, 154, que se incorpora a la presente invención por referencia.

3) ENSAYOS BASADOS EN LA HIBRIDACIÓN

a) ASPECTOS GENERALES

Las personas capacitadas en la técnica conocen una variedad de métodos para la medición específica del DNA y el ARN utilizando las técnicas de hibridación del ácido nucleico (consultar Sambrook y colaboradores, mencionado anteriormente) . Los ensayos basados en la hibridación se refieren a ensayos en los cuales se somete a hibridación un ácido nucleico de sonda para producir un ácido nucleico objetivo. Por lo general, las sondas de hibridación del ácido nucleico utilizadas en la invención son total o sustancialmente idénticas a una secuencia contigua de la secuencia del ARN o el gene de la hTRT. De preferencia, las sondas del ácido nucleico son por lo menos de aproximadamente 10 bases, con frecuencia de por lo menos aproximadamente 20 bases, y algunas veces de por lo menos aproximadamente 200 bases o más de longitud. Los métodos para seleccionar las secuencias de la sonda del ácido nucleico para utilizarse en la hibridación del ácido nucleico se discuten en Sambrook y colaboradores, mencionado anteriormente. En algunos formatos, por lo menos o el objetivo o la sonda se inmovilizan. El ácido nucleico inmovilizado puede ser el DNA, el ARN o algún otro oligo- o poli-nucleótido, y puede incluir nucleótidos de ocurrencia natural o no natural, análogos de nucleótidos, o columnas vertebrales. Estos ensayos pueden encontrarse en cualquiera de varios formatos incluyendo: manchados Southern, Northern, de puntos y de aberturas, disposiciones de polinucleótidos u oligonucleótidos de alta densidad (por ejemplo, GeneChipsD Affymetrix) , varillas de aforar, pasadores, microplaquetas o cuentas. Todas estas técnicas son bastante conocidas en la técnica y son la base de muchos paquetes de diagnóstico disponibles comercialmente. Las técnicas de hibridación se describen porlo general en Hames y colaboradores, ed. HIBRIDACIÓN DEL ÁCIDO NUCLEICO, UN ENFOQUE PRÁCTICO, IRL Press, (1985) ; Gall y Pardue Procedimientos Científicos de la Academia Nacional, E.U.A., 63:378-383 (1969) ; y John y colaboradores, Naturaleza, 223:582-587 (1969) .

Las personas capacitadas en la técnica conocen una variedad de formatos de hibridación del ácido nucleico. Por ejemplo, un formato común es la hibridación directa, en la que un ácido nucleico objetivo se hibrida en una sonda complementaria, etiquetada. Por lo general, los ácidos nucleicos etiquetados se utilizan para la hibridación, donde la etiqueta proporciona la señal detectable. Un método para evaluar la presencia, ausencia o cantidad del mRNA de la hTRT es llevar a cabo una transferencia Northern del ARN a partir de una muestra y realizar la hibridación de una sonda del ácido nucleico específico de la hTRT etiquetada, de acuerdo con lo ilustrado en el Ejemplo 2. Tal como fue indicado anteriormente, el mRNA de la hTRT, cuando está de hecho presente, aparece en cantidades muy pequeñas en la mayoría de las células. Por lo tanto, cuando se utiliza la hibridación Northern, con frecuencia será conveniente utilizar un paso de amplificación (o, de manera alternativa, grandes cantidades del ARN de inicio) . Un método útil para evaluar la presencia, ausencia o cantidad del DNA que codifica las proteínas de la hTRT en una muestra, implica llevar a cabo una transferencia Southern del DNA a partir de una muestra y realizar la hibridación de una sonda del ácido nucleico específico de la hTRT etiquetada.

Otros formatos de hibridación comunes incluyen los ensayos de sándwich y los ensayos de competencia o de desplazamiento. Los ensayos de sándwich son ensayos de hibridación útiles comercialmente para detectar o aislar las secuencias del ácido nucleico. Estos ensayos utilizan un ácido nucleico de "captura" inmovilizado de manera covalente a un soporte sólido y un ácido nucleico de "señal" etiquetado en solución. La muestra biológica o clínica proporcionará el ácido nucleico objetivo. La sonda del ácido nucleico de "señal" y del ácido nucleico de "captura" se hibrida con el ácido nucleico objetivo para formar un complejo de hibridación de "sándwich". Para que sea efectiva, el ácido nucleico de señal no puede hibridarse con el ácido nucleico de captura.

b) ENSAYOS BASADOS EN MICROPLAQUETAS Y BASADOS EN PORTAOBJETOS

La presente invención también proporciona ensayos de hibridación basados en sonda para los productos del gene de la hTRT que emplean disposiciones de oligonucleótidos o polinucleótidos inmovilizados en los cuales puede hibridarse un ácido nucleico de la hTRT (es decir, en algunos, pero por lo general no todos o incluso la mayoría, de los oligo- o poli- nucleótidos inmovilizados) . Las disposiciones de polinucleótidos o las disposiciones de oligonucleótidos de alta densidad proporcionan un medio para detectar de manera eficiente la presencia y las características (por ejemplo, la secuencia) de un ácido nucleico objetivo (por ejemplo, el gene de la hTRT, el mRNA

o el cDNA) . Se conocen técnicas para producir disposiciones que contienen miles de oligonucleótidos complementarios para secuencias definidas, en ubicaciones definidas sobre una superficie utilizando técnicas fotolitográficas para la síntesis in situ (consultar, por ejemplo, la Patente de los Estados Unidos NI 5, 578, 832; 5, 556, 752; y 5, 510, 270; Fodor y colaboradores, 1991, Ciencia, 251:767; Pease y colaboradores, 1994, Procedimiento Científico de la Academia Nacional E.U.A. 91:5022; y Lockhart y colaboradores, 1996, Biotec. de la Naturaleza, 14:1675) u otros métodos para la síntesis y deposición rápidas de los oligonucleótidos definidos (Blanchard y colaboradores, 1996, Biosensores y Bioelectrónica 11:687) . Cuando se utilizan estos métodos, los oligonucleótidos (por ejemplo, 20-meros) de la secuencia conocida se sintetizan directamente sobre una superficie como por ejemplo un portaobjetos de vidrio derivado. Por lo general, la disposición producida es redundante, teniendo que detectar varias sondas del oligonucleótido en la microplaqueta específica para el polinucleótido de la hTRT.

Pueden designarse combinaciones de sondas del oligonucleótido para detectar de manera alternativa mRNAs empalmados, o para identificar cuál de diferentes alelos de la hTRT está expresado en una muestra en particular.

En una forma de realización ilustrativa, se amplifica el cDNA preparado por medio de una transcripción inversa del ARN total a partir de una célula de prueba (por ejemplo, utilizando la PCR) . Por lo general, el producto de la amplificación está etiquetado, por ejemplo, mediante la incorporación de una dNTP etiquetada de manera fluorescente. Los cDNAs etiquetados se hibridan posteriormente a una microplaqueta que incluye las sondas de los oligonucleótidos complementarias para varias subsecuencias del gene de la hTRT. Las posiciones de la hibridación son determinadas (por ejemplo, de acuerdo con los métodos generales de Shalon y colaboradores, 1996, Investigación de Genomas, 6:639 o de Schena y colaboradores, 1996, Investigación de Genomas, 6:639) , y la secuencia (u otra información) se deduce del patrón de la hibridación, a través de medios conocidos en la técnica.

En una forma de realización, dos muestras de cDNA, cada una etiquetada con un grupo fluorescente diferente, se hibridan a la misma microplaqueta. La relación de la hibridación de cada muestra etiquetada para los sitios complementarios al gene de la hTRT se somete a ensayo posteriormente. Si ambas muestras contienen la misma cantidad de mRNA de la hTRT, la relación de las dos fluoritas será de 1:1 (se podrá apreciar que la señal de las fluoritas puede necesitar ajuste para tomar en cuenta cualquier diferencia en la sensibilidad molar de las fluoritas) . En contraste, si una muestra es de un tejido sano (o de control) y la segunda muestra es de un tejido canceroso, la fluorita utilizada en la segunda muestra será la que predomine.

c) HIBRIDACIÓN IN SITU

Un medio alternativo para detectar la expresión de un gene que codifica una proteína de la hTRT es la hibridación in situ. Los ensayos de la hibridación in situ son bastante conocidos y por lo general se describen en Angerer y colaboradores, MÉTODOS DE ENZIMOLOGÍA, 152:649-660 (1987) y Ausubel y colaboradores, mencionado anteriormente. En un ensayo de hibridación in situ, las muestras de células o tejido se fijan a un soporte sólido, por lo general en un estado permeabilizado, comúnmente sobre un portaobjetos de vidrio. Las células se ponen en contacto posteriormente con una solución de hibridación a una temperatura moderada para permitir el templado de las sondas del ácido nucleico etiquetado (por ejemplo, ribosondas etiquetadas como 35S, sondas etiquetadas de manera fluorescente) complementarias total o sustancialmente a la hTRT. La sonda libre se elimina mediante el lavado y/o la digestión de la nucleasa, y la sonda de enlace se visualiza directamente en el portaobjetos mediante la autoradiografía o técnicas de reproducción de imágenes apropiadas, tal como se conocen en la técnica.

4) DETECCIÓN ESPECÍFICA DE VARIANTES

Tal como se indicó anteriormente y se ilustró en los Ejemplos (por ejemplo, Ejemplo 9) , pueden seleccionarse iniciadores o sondas de amplificación para proporcionar productos de amplificación que abarquen eliminaciones específicas, truncamientos e inserciones, facilitando de esta manera la detección de variantes específicas o anormalidades en el mRNA de la hTRT.

Un ejemplo de un producto del gene de la hTRT variante que puede detectarse es un ARN de la hTRT, como el producto (ID DE SECUENCIA NI 4) descrito anteriormente y en el Ejemplo 9. La función biológica, si la hay, de la (s) variante (s) D182 no se conoce; sin embargo, la proteína de la hTRT truncada, codificada de manera putativa por la variante, puede estar implicada en la regulación de la actividad de la telomerasa, por ejemplo, mediante el ensamble de una RNP de telomerasa no funcional que valore los componentes de la telomerasa. De manera alternativa, la regulación negativa de la actividad de la telomerasa podría lograrse dirigiendo el procesamiento del pre-RNA de la hTRT (mRNA incipiente) en una manera tal que conduzca a la eliminación del mRNA de longitud completa y reduzca los niveles del mRNA de la hTRT e incremente los niveles del ARN de la hTRT de la L182. Por estas y otras razones es útil la capacidad para detectar las variantes L182. Además, algunas veces será conveniente, en las muestras en las cuales estén presentes dos especies de ARN de la hTRT (como el ARN de la hTRT de la L182 y el ARN de la hTRT que codifica la proteína de la hTRT de longitud completa) comparar su abundancia relativa y/o absoluta.

La invención proporciona una variedad de métodos para la detección de variantes L182. Por ejemplo, la amplificación que emplea los pares del iniciador que abarcan la eliminación del par de base 182, dará como resultado productos de tamaños diferentes correspondientes a los RNAs de la hTRT eliminados y no eliminados, si ambos están presentes, lo que puede distinguirse en base al tamaño (por ejemplo, mediante la electrofóresis con gel) . Los ejemplos de los pares del iniciador útiles para amplificar la región que abarca la eliminación del 182 bp, incluyen el TCP1.14 y TCP1.15 (juego 1 del iniciador) , ó TCP1.25 y bTCP6 (juego 2 del iniciador) (consultar Tabla 2) . Estos pares del iniciador pueden utilizarse individualmente o en un experimento de la PCR inclusivo donde se utilice primero el juego 1 del iniciador. También será aparente para las personas capacitadas en la técnica que los métodos de hibridación (por ejemplo, la hibridación Northern) o los ensayos de protección de la RNAsa que utilizan una sonda del ácido nucleico de la hTRT pueden utilizarse para detectar y distinguir las variantes del ARN de la hTRT.

Otro método adecuado incorpora la amplificación de la PCR (o su equivalente) utilizando tres iniciadores. Análogo al método de la PCR cuantitativo, semicompetitivo, descrito con mayor detalle anteriormente, un iniciador es específico para cada una de las especies del ARN de la hTRT (por ejemplo, tal como se ilustra en la Tabla 4) y un iniciador es complementario para ambas especies (por ejemplo, TCP1.25 (2270-2288) ) . Un ejemplo de un iniciador específico para la ID DE LA SECUENCIA No:1 es aquel que se templa dentro de la secuencia del nucleótido 182 (es decir, los nucleótidos 2345 al 2526 de la ID DE LA SECUENCIA No:1) por ejemplo, TCP1.73 (2465-2445) . Por ejemplo, un iniciador específico para la ID DE LA SECUENCIA No:4 (una variante de L182) es aquel que se templa en los nucleótidos 2358 a la 2339 de la ID DE LA SECUENCIA No:4 (es decir, el sitio correspondiente a la inserción del nucleótido 182 en la ID DE LA SECUENCIA No:1) . La abundancia absoluta de la especie del mRNA de la hTRT de la L182 o su abundancia relativa en comparación con las especies que codifican la proteína de la hTRT de longitud completa, puede analizarse para su correlación con el estado celular (por ejemplo, la capacidad de proliferación indefinida) . Se podrá apreciar que pueden seleccionarse varios otros iniciadores o métodos de amplificación o detección en base a esta presentación.

TABLA 4

INICIADORES ILUSTRATIVOS

Iniciador específico de la especie L182 (por ejemplo, ID DE LA SECUENCIA No 4) : 5'-GGCACTGGACGTAGGACGTG-3 Iniciador específico (TCP1.73) de la HTRT (ID DE LA SECUENCIA No 1) : 5'-CACTGCTGGCCTCATTCAGGG-3 Iniciador común (avance) (TCP1.25) : 5'-TACTGCGTGCGTCGGTATG-3'

Otros genes de la hTRT de la variante o productos del gene que pueden detectarse incluyen aquellos caracterizados por codones de paro prematuro, eliminaciones, sustituciones o inserciones. Las eliminaciones pueden detectarse por el tamaño disminuido del gene, la transcripción del mRNA, o el cDNA. De manera similar, pueden detectarse inserciones por medio del tamaño incrementado del gene, la transcripción del mRNA, o el cDNA. Las inserciones y eliminaciones también podrían provocar cambios en la configuración de lectura que conduce a los codones de paro prematuro o las configuraciones de lectura abierta más grandes. Las sustituciones, eliminaciones e inserciones también pueden ser detectadas mediante la hibridación de la sonda. Las alteraciones también pueden detectarse observando los cambios en el tamaño del polipéptido de la hTRT de la variante (por ejemplo, a través del análisis Western) o mediante la hibridación o la amplificación específica según sea adecuado. De manera alternativa, las mutaciones pueden determinarse mediante la secuenciación del gene o el producto del gene de acuerdo con los métodos estándares. Además, y tal como se indicó anteriormente, los ensayos de amplificación y las sondas de hibridación pueden seleccionarse para enfocarse en anormalidades particulares específicamente. Por ejemplo, pueden seleccionarse las sondas del ácido nucleico o los iniciadores de amplificación que hibriden específicamente en o que amplifiquen, respectivamente, la región que abarca la eliminación, sustitución o inserción. Cuando el gene de la hTRT contenga esta mutación, la sonda ya sea (1) no podrá hibridarse o la reacción de la amplificación no proporcionará la amplificación específica o provocará un cambio en el tamaño del producto de la amplificación o la señal de hibridación; o (2) la sonda o la reacción de la amplificación comprende toda la eliminación o cualquier extremo de la eliminación (empalme de la eliminación) ; o (3) de manera similar, pueden seleccionarse sondas e iniciadores de la amplificación que se enfoquen específicamente en las mutaciones de puntos o inserciones.

5) DETECCIÓN DE ALELOS DE LA hTRT MUTANTES

Las mutaciones en el gene de la hTRT pueden ser responsables del inicio de la enfermedad o pueden contribuir a una condición enferma. Las alteraciones del DNA genómico de la hTRT pueden afectar los niveles de la transcripción del gene, cambiar los residuos del aminoácido en la proteína de la hTRT, provocar la producción de polipéptidos de la hTRT truncada, alterar las vías de procesamiento previas del mRNA (que pueden alterar los niveles del mRNA de la hTRT) y provocar también otras consecuencias.

Las alteraciones del DNA genómico en los sitios que no son de hTRT también pueden afectar la expresión de la hTRT o la telomerasa alterando las enzimas o los procesos celulares que son responsables de la regulación de la hTRT, la hTR, y la expresión y procesamiento de la proteína asociada con la telomerasa, y el ensamble y transporte de la RNP. Las alteraciones que afectan la expresión de la hTRT, el procesamiento, o el ensamble de la RNP podrían ser importantes para la progresión del cáncer, para las enfermedades de envejecimiento, para las enfermedades de daño del DNA y otras.

La detección de mutaciones en el mRNA de la hTRT o su gene y los elementos de control del gene puede lograrse de acuerdo con los métodos de la presente invención de varias formas. Los ejemplos ilustrativos incluyen los siguientes: puede emplearse una clasificación de iniciadores por términos técnicos; los iniciadores de la PCR se designan como aquellos cuyo terminación de 3' se templa con los nucleótidos en un DNA de muestra (o RNA) que tienen una probable mutación. Si el DNA (ó RNA) es amplificado por los iniciadores, entonces la terminación de 3' se acopló con los nucleótidos en el gene; si el DNA no está amplificado, entonces una o ambas terminaciones no acoplaron los nucleótidos en el gene, indicando que se presentó una mutación. Puede utilizarse un diseño de iniciador similar para someter a ensayo las mutaciones por puntos que utilizan la Reacción en Cadena de la Ligasa (LCR, descrita con anterioridad) . El polimorfismo de la longitud del fragmento de restricción, RFLP (Pourzand, c., Cerutti, P. (1993) Res. Mutat. 288:113-121) es otra técnica que puede aplicarse en el método actual. Se sondeó un manchado Southern de DNA genómico humano digerido con varias enzimas de restricción con una sonda específica para la hTRT. Las diferencias en el número o los tamaños de fragmentos entre la muestra y el control indican una alteración de la muestra experimental, por lo general una inserción o eliminación. El polimorfismo de conformación del filamento único, SSCP (Orrita, M., y colaboradores, (1989) PNAS EUA 86:2766-70) es otra técnica que puede aplicarse en el presente método. El SSCP se basa en la migración diferencial del DNA de filamento único mutante y el de tipo silvestre desnaturalizado (generado comúnmente por la PCR) . El DNA de filamento único tomará una conformación tridimensional que es específica de la secuencia. Las diferencias en la secuencia tan pequeñas como un sencillo cambio de base pueden dar como resultado un cambio de movilidad en un gel no desnaturalizado. El SSCP es uno de los métodos de clasificación de mutación más ampliamente utilizados debido a su sencillez. La Electrofóresis con Gel del Gradiente de Desnaturalización, DGGE (Myers, R.M., Maniatis, T., y Lerman, L., (1987) Métodos de Enzimología, 155: 501-527) es otra técnica que puede aplicarse en el presente método. La DGGE identifica las mutaciones en base al comportamiento en la fusión del DNA de filamento doble. Se utiliza un equipo especializado de electrofóresis de desnaturalización para observar el perfil de la fusión de los DNAs experimental y de control: un DNA que contiene una mutación tendrá una movilidad diferente en comparación con el control en estos sistemas de geles. Los ejemplos discutidos ilustran la metodología empleada comúnmente; existen muchas otras técnicas que son conocidas por aquellas personas capacitadas en la técnica y pueden aplicarse de acuerdo con las instrucciones de la presente.

F) ANÁLISIS DEL CARIOTIPO

La presente invención proporciona además reactivos para el análisis del cariotipo u otro análisis cromosómico utilizando sondas de la secuencia de la hTRT y/o detectando o localizando las secuencias del gene de la hTRT en los cromosomas de un paciente humano, una línea de células humanas o una célula no humana. La amplificación (es decir, el cambio en el número de copia) , la eliminación (es decir, la eliminación parcial) , la inserción, sustitución o los cambios en la ubicación cromosómica (por ejemplo, la translocación) de un gene de la hTRT pueden estar correlacionadas con la presencia de una condición patológica o una predisposición para desarrollar una condición patológica (por ejemplo, cáncer) .

Los inventores de la presente han determinado que, en las células humanas normales, el gene de la hTRT se traza cerca del telómero del cromosoma 5p (consultar Ejemplo 5, mencionado posteriormente) . El marcador de STS más cercano es el D5S678 (consultar la Figura 8) . La ubicación puede utilizarse para identificar los marcadores que están enlazados estrechamente al gene de la hTRT. Los marcadores pueden utilizarse para identificar los YACs, STSs, cosmidos, BACs, fago lambda ó P1, u otros clones que contienen secuencias genómicas de la hTRT o elementos de control. Los marcadores o la ubicación del gene pueden utilizarse para rastrear muestras de tejido humano para evaluar alteraciones en la ubicación normal del gene de la hTRT, la organización o la secuencia que se asocian con la ocurrencia de un tipo de cáncer o enfermedad. Esta información puede ser utilizada en una forma de diagnóstico o prognóstico para la enfermedad o cáncer implicado. Además, la naturaleza de cualquier alteración al gene de la hTRT puede ser informativa con respecto a la naturaleza por la cual las células se vuelven inmortales. Por ejemplo, un evento de translocación podría indicar que la activación de la expresión de la hTRT se presenta en algunos casos reemplazando el promotor de la hTRT por otro promotor que dirija la transcripción de la hTRT de una manera adecuada. Los métodos y reactivos de la invención de este tipo pueden utilizarse para inhibir la activación de la hTRT. La ubicación también puede ser útil para determinar la naturaleza de la represión del gene de la hTRT en células somáticas normales, por ejemplo, si la ubicación es parte de la heterocromatina sin expresión. Los ensayos de hipersensibilidad de la nucleasa para distinguir la heterocromatina y la eucromatina se describen por ejemplo, en Wu y colaboradores, 1979, Célula, 16:767; Groudine y Weintraub, 1982, Célula 30:131; Gross y Garrard, 1988, Revisión Anual de Bioquímica, 57:159.

En una forma de realización, las alteraciones al gene de la hTRT se identifican mediante un análisis del cariotipo, utilizando cualquiera de una variedad de métodos conocidos en la técnica. Una técnica útil es la hibridación in situ (ISH) . Por lo general, cuando se utilizan las técnicas de la hibridación in situ para el análisis del cariotipo, una sonda detectable o etiquetada de manera detectable se hibrida a una muestra cromosómica in situ para localizar una secuencia del gene de la hTRT. Por lo general, la ISH incluye uno o más de los siguientes pasos: (1) fijación del tejido, célula u otra estructura biológica que deba ser analizada; (2) tratamiento de prehibridación de la estructura biológica para incrementar la accesibilidad del DNA objetivo (por ejemplo, la desnaturalización con calor o álcali) , y para reducir el enlace no específico (por ejemplo, mediante el bloqueo de la capacidad de hibridación de las secuencias repetitivas, por ejemplo, utilizando el DNA genómico humano) ; (3) hibridación de una o más sondas del ácido nucleico (por ejemplo, ácidos nucleicos convencionales, PNAs, o sondas que contienen otros análogos del ácido nucleico) al ácido nucleico en la estructura biológica o el tejido; (4) lavados posteriores a la hibridación para eliminar los fragmentos del ácido nucleico no enlazados en la hibridación; y, (5) detección de los fragmentos del ácido nucleico hibridado. Los reactivos utilizados en cada uno de estos pasos y condiciones para su uso, varían dependiendo de la aplicación en particular. Podrá apreciarse que estos pasos pueden modificarse en una variedad de formas bastante conocidas para aquellas personas capacitadas en la técnica.

En una forma de realización de la ISH, la sonda de la hTRT se etiqueta con una etiqueta fluorescente (hibridación in situ fluorescente) ; ("FISH") . Por lo general, es conveniente utilizar una hibridación in situ fluorescente con color doble, en la que se utilicen dos sondas, cada una etiquetada con un tinte fluorescente diferente. Una sonda de la prueba que se hibrida a la secuencia de la hTRT de interés está etiquetada con un tinte, y una sonda de control que se hibrida a una región diferente está etiquetada con un segundo tinte. Un ácido nucleico que se hibrida a una porción estable del cromosoma de interés, como la región del centromero, puede utilizarse como la sonda de control. De esta manera, se puede dar cuenta de las diferencias entre la eficiencia de la hibridación de una muestra a otra.

Los métodos de la ISH para detectar las anormalidades cromosómicas (por ejemplo, FISH) pueden realizarse en cantidades de nanogramos de los ácidos nucleicos del sujeto. Pueden utilizarse secciones del tumor o el tejido normal embebido con parafina, al igual que material, tejidos o secciones frescas o congeladas. Como la FISH puede aplicarse a material limitado, también pueden utilizarse preparaciones de contacto preparadas a partir de tumores primarios no cultivados (consultar, por ejemplo, Kallioniemi y colaboradores, 1992, Citogenética, Genética Celular, 60: 190) . Por ejemplo, pueden utilizarse pequeñas muestras de tejido de biopsia proveniente de tumores para las preparaciones de contacto (consultar por ejemplo, Kallioniemi y colaboradores, mencionado anteriormente) . También pueden analizarse pequeños números de células obtenidas a partir de una biopsia de aspiración o células en los fluidos corporales (por ejemplo, sangre, orina, saliva y similares) . Para el diagnóstico prenatal, las muestras apropiadas incluirán el fluido amniótico, sangre materna, y similares. Los protocolos de hibridación útiles que pueden aplicarse a los métodos y a los reactivos presentados aquí se describen en Pinkel y colaboradores, 1988, Procedimiento Científico de la Academia Nacional E.U.A., 85:9138; EPO Pub. Nº 430, 402; Choo, ed., MÉTODOS DEBIOLOGÍA MOLECULAR VOL. 33: PROTOCOLOS DE HIBRIDACIÓN IN SITU, Humana Press, Totowa, Nueva Jersey, (1994) ; y Kallioniemi y colaboradores, mencionado anteriormente.

Otras técnicas útiles para el análisis del cariotipo incluyen, por ejemplo, las técnicas como el manchado Southern cuantitativo, la PCR cuantitativa, o la hibridación genómica comparativa (Kallioniemi y colaboradores, 1992, Ciencia, 258:818) , utilizando las sondas y los iniciadores de la hTRT de la invención que pueden ser utilizados para identificar la amplificación, eliminación, inserción, sustitución o cualquier otra redisposición de las secuencias de la hTRT en los cromosomas en una muestra biológica.

G. ENSAYOS DEL POLIPÉPTIDO DE LA TRT

1) ASPECTOS GENERALES

La presente invención proporciona métodos y reactivos para detectar y cuantificar los polipéptidos de la hTRT. Estos métodos incluyen los métodos bioquímicos analíticos como la electrofóresis, la espectroscopia de masa, el cambio de gel, la electrofóresis capilar, los métodos cromatográficos como la cromatografía de exclusión de tamaños, la cromatografía líquida de alto rendimiento (HPLC) , la cromatografía de capa delgada (TLC) , la cromatografía de hiperdifusión y similares, o diferentes métodos inmunológicos como las reacciones de precipitina de fluidos o gel, la inmunodifusión (sencilla o doble) , la inmunoelectrofóresis, el radioinmunoensayo (RIA) , los ensayos inmunoabsorbentes enlazados con la enzima (ELISAs) , los ensayos inmunofluorescentes, el manchado Western, la espectroscopia de masa y otros descritos posteriormente y aparentes para aquellas personas capacitadas en la técnica después de la revisión de esta presentación.

2) ENSAYOS ELECTROFORÉTICOS

Los polipéptidos de la hTRT pueden ser detectados en una separación de la proteína electroforética; en un aspecto, se emplea un sistema de electrofóresis bidimensional. Los medios para la detección de proteínas utilizando técnicas electroforéticas son bastante conocidos por aquellas personas capacitadas en la técnica (consultar por lo general, R.Scopes (1982) PURIFICACIÓN DE LA PROTEÍNA, Springer-Verlag, N.Y.; Deutscher, (1990) MÉTODOS DE ENZIMOLOGÍA, VOL. 182: GUÍA PARA LA PURIFICACIÓN DE LAS PROTEÍNAS, Academic Press, Inc. N.Y.) .

También se puede utilizar un ensayo de cambio de movilidad (consultar, por ejemplo, Ausubel y colaboradores, mencionado anteriormente) . Por ejemplo, la hTR etiquetada se asociará con la hTRT y migrará con una movilidad alterada después de la electrofóresis en un gel de poliacrilamida no desnaturalizado o algo similar. De esta manera, por ejemplo, si una sonda de la hTR (etiquetada opcionalmente) o un iniciador de telomerasa (etiquetado opcionalmente) se mezclan con una muestra que contiene hTRT, o se coexpresan con la hTRT (por ejemplo, en un sistema de expresión libre de células) la presencia de la proteína de la hTRT (o un polinucleótido que codifique la hTRT) en la muestra dará como resultado una alteración detectable de la movilidad de la hTR.

3) INMUNOENSAYOS

a) ASPECTOS GENERALES

La presente invención también proporciona métodos para la detección de los polipéptidos de la hTRT que emplean uno o más reactivos del anticuerpo de la invención (es decir, los inmunoensayos) . Tal como se utiliza en la presente invención, un inmunoensayo es un ensayo que utiliza un anticuerpo (tal como se define ampliamente en la presente y que incluye específicamente fragmentos, quimeras y otros agentes de enlace) que enlaza específicamente un polipéptido o epítopo de la hTRT. Los anticuerpos de la invención pueden ser elaborados por una variedad de medios bastante conocidos para aquellas personas capacitadas en la técnica, por ejemplo, tal como se describió anteriormente.

Se conoce cierto número de formatos de ensayos de enlace inmunológico perfectamente establecidos, adecuados para la práctica de la invención (consultar, por ejemplo, las Patentes de los Estados Unidos Nº 4, 366, 241; 4, 376, 110;4, 517, 288; y 4, 837, 168) . Consultar, por ejemplo, los MÉTODOS DE BIOLOGÍA CELULAR, VOLUMEN 37:ANTICUERPOS EN LA BIOLOGÍA CELULAR, Asai, ed., Academic Press, Inc. Nueva York (1993) ; INMUNOLOGÍABÁSICA Y CLÍNICA, 7º edición, Stites & Terr, eds. (1991) ; Harlow y Lane, mencionado anteriormente [por ejemplo, Capítulo 14] y Ausubel y colaboradores, mencionado anteriormente [por ejemplo, Capítulo 11], cada una de las cuales se incorpora por referencia en su totalidad y para todos los propósitos. Por lo general, los ensayos de enlace inmunológicos (o inmunoensayos) utilizan un "agente de captura" para enlazarse específicamente a, y con frecuencia, para inmovilizar el analito. En una forma de realización, el agente de captura es una mitad que se enlaza específicamente a un polipéptido o una subsecuencia de la hTRT, como por ejemplo un anticuerpo anti-hTRT. Alternativamente, el agente de captura puede enlazar una proteína asociada con la hTRT ó ARN bajo condiciones en las cuales la molécula asociada con la hTRT permanece enlazada a la hTRT (de tal forma que si la molécula asociada con la hTRT se inmoviliza, también se inmoviliza la proteína de la hTRT de manera similar) . Deberá entenderse que en los ensayos en los cuales se captura una molécula asociada con la hTRT, la proteína de la hTRT asociada estará presente por lo general y por lo tanto podrá detectarse, por ejemplo, utilizando un anticuerpo antihTRT o algo similar. Los inmunoensayos para la detección de complejos de proteínas son conocidos en la técnica (consultar, por ejemplo, Harlow y Lane, mencionado anteriormente, en la página 583) .

Por lo general, el producto del gene de la hTRT que se somete a ensayo se detecta directamente o indirectamente utilizando una etiqueta detectable. La etiqueta particular o el grupo detectable utilizado en el ensayo por lo general no es un aspecto importante de la invención, siempre y cuando no interfiera de manera significativa con el enlace específico del anticuerpo o los anticuerpos utilizados en el ensayo. La etiqueta puede estar unida de manera covalente al agente de captura (por ejemplo, un anticuerpo anti-TRT) , o puede estar unida a una tercera porción, como por ejemplo otro anticuerpo, que se enlace específicamente a, por ejemplo: el polipéptido de la hTRT (en un epítopo diferente al reconocido por el agente de captura) , el agente de captura (por ejemplo, una anti- (primer anticuerpo) inmunoglobulina) ; un anticuerpo anti-TRT; un anticuerpo que enlace un anticuerpo anti-TRT; o un complejo de anticuerpo/telomerasa (por ejemplo, a través del enlace con una molécula asociada como la proteína asociada con la telomerasa) . Otras proteínas capaces de enlazar un anticuerpo utilizadas en el ensayo, como la proteína A o la proteína G, también pueden etiquetarse. En algunas formas de realización, será útil emplear más de una molécula etiquetada (es decir, unas que puedan distinguirse de otras) . Además, cuando el objetivo enlazado (por ejemplo, inmovilizado) por el agente de captura (por ejemplo, un anticuerpo anti-hTRT) es un compuesto (es decir, un compuesto de la hTRT y una proteína asociada con la TRT, hTR u otra molécula asociada con la TRT) , puede utilizarse un anticuerpo etiquetado que reconozca la proteína o el ARN asociado con la proteína de la hTRT. Cuando el compuesto es un compuesto de la proteína-ácido nucleico (por ejemplo, TRT-hTRT) , la molécula informadora puede ser un polinucleótido u otra molécula (por ejemplo, una enzima) que reconozca el componente del ARN del compuesto.

Algunos formatos del inmunoensayo no requieren el uso de componentes etiquetados. Por ejemplo, los ensayos de aglutinación pueden utilizarse para detectar la presencia de los anticuerpos objetivo. En este caso, las partículas recubiertas de antígeno se aglutinan por muestras que incluyen los anticuerpos objetivo. En este formato, los componentes no necesitan estar etiquetados, y la presencia del anticuerpo objetivo puede detectarse mediante una inspección visual sencilla.

b) FORMATOS DE ENSAYO NO COMPETITIVO

La presente invención proporciona métodos y reactivos para los inmunoensayos competitivos y no competitivos para la detección de polipéptidos de la hTRT. Los inmunoensayos no competitivos son ensayos en los cuales la cantidad de analito capturado (en este caso la hTRT) se mide directamente. Uno de estos ensayos es un inmunoensayo basado en dos sitios, monoclonal, que utiliza anticuerpos monoclonales reactivos a dos epítopos que no interfieren en la proteína de la hTRT. Consultar, por ejemplo, Maddox y colaboradores, 1983, Boletín Med. Exp., 158:1211 para información de antecedentes. En un ensayo de "sándwich" preferido, el agente de captura (por ejemplo, un anticuerpo anti-TRT) se enlaza directamente a un substrato sólido donde queda inmovilizado. Estos anticuerpos inmovilizados capturan posteriormente cualquier proteína de la hTRT presente en la muestra de prueba. La hTRT inmovilizada de esta manera puede etiquetarse posteriormente, es decir, enlazándose a un segundo anticuerpo antihTRT que porte una etiqueta. De manera alternativa, el segundo anticuerpo anti-hTRT puede carecer de una etiqueta, pero puede estar enlazado por un tercer anticuerpo etiquetado específico para los anticuerpos de las especies de las cuales se deriva el segundo anticuerpo. Alternativamente, el segundo anticuerpo puede ser modificado con una porción detectable, como la biotina, a la cual puede enlazarse específicamente una tercera molécula etiquetada, como la estreptavidina etiquetada como enzima.

c) FORMATOS DE ENSAYO COMPETITIVO

En los ensayos competitivos, la cantidad de proteína de la hTRT presente en la muestra se mide de manera indirecta midiendo la cantidad de una hTRT agregada (exógena) desplazada (o competida fuera) de un agente de captura (por ejemplo, un anticuerpo anti-TRT) por la proteína de la hTRT presente en la muestra. En un ensayo competitivo, se agrega una cantidad conocida de proteína de la hTRT etiquetada a la muestra y la muestra se pone en contacto posteriormente con un agente de captura (por ejemplo, un anticuerpo que enlaza específicamente la proteína de la hTRT) . La cantidad de proteína de la hTRT exógena (etiquetada) enlazada al anticuerpo, es inversamente proporcional a la concentración de la proteína de la hTRT presente en la muestra. En una forma de realización, el anticuerpo se inmoviliza en un substrato sólido. La cantidad de proteína de la hTRT enlazada al anticuerpo puede determinarse ya sea midiendo la cantidad de la proteína de la hTRT presente en el compuesto de la TRT/anticuerpo, o de manera alternativa, midiendo la cantidad de la proteína de la TRT no compuesta restante. La cantidad de proteína de la hTRT puede detectarse suministrando una molécula de la hTRT etiquetada.

Un ensayo de inhibición de hapteno es otro ejemplo de un ensayo competitivo. En este ensayo, la proteína de la hTRT se inmoviliza en un substrato sólido. Se agrega una cantidad conocida de anticuerpo anti-TRT a la muestra y la muestra se pone en contacto posteriormente con la proteína de la hTRT inmovilizada. En este caso, la cantidad de anticuerpo anti-TRT enlazado a la proteína de la hTRT inmovilizada es inversamente proporcional a la cantidad de proteína de la hTRT presente en la muestra. La cantidad de anticuerpo inmovilizado puede determinarse detectando ya sea la fracción inmovilizada del anticuerpo o la fracción del anticuerpo que permanece en la solución. En este aspecto, la detección puede ser directa, cuando el anticuerpo está etiquetado, o indirecta cuando la etiqueta está enlazada a una molécula que se enlaza específicamente al anticuerpo tal como se describió anteriormente.

d) OTROS FORMATOS DE ENSAYO

La invención también proporciona reactivos y métodos para detectar y cuantificar la presencia de la hTRT en la muestra utilizando un formato de inmunomanchado (manchado Western) . En este formato, los polipéptidos de la hTRT en una muestra se separan de otros componentes de la muestra mediante una electrofóresis con gel (por ejemplo, en base al peso molecular) , las proteínas separadas se transfieren a un soporte sólido adecuado (como por ejemplo un filtro de nitrocelulosa, un filtro de nylon, un filtro de nylon derivado, o algo similar) , y el soporte se incuba con anticuerpos anti-TRT de la invención. Los anticuerpos anti-TRT se enlazan específicamente a la hTRT u otra TRT en el soporte sólido. Estos anticuerpos pueden estar etiquetados directamente o de manera alternativa, pueden detectarse después utilizando anticuerpos etiquetados (por ejemplo, anticuerpos anti-ratón de oveja etiquetados) u otros reactivos de etiquetación que se enlacen específicamente al anticuerpo anti-TRT.

Otros formatos de ensayo incluyen los inmunoensayos de liposomas (LIA) , que utilizan los liposomas designados para enlazar moléculas específicas (por ejemplo, los anticuerpos) y liberan los reactivos o marcadores encapsulados. Los químicos liberados pueden detectarse posteriormente de acuerdo con las técnicas estándares (consultar, Monroe y colaboradores, 1986, Rev. Prod. Clín. Amer. 5:34) .

Tal como se indicó anteriormente, los formatos de ensayos que utilizan FACS (y los instrumentos o métodos equivalentes) tienen ventajas al medir los productos del gene de la hTRT en una muestra heterogénea (como una muestra de biopsia que contiene tanto células normales como malignas) .

e) SUBSTRATOS, SOPORTES SÓLIDOS, MEMBRANAS, FILTROS.

Tal como se indicó anteriormente, dependiendo del ensayo, varios componentes, incluyendo el antígeno, el anticuerpo objetivo, o el anticuerpo anti-hTRT, pueden enlazarse a una superficie o soporte sólido (es decir, un substrato, membrana, o papel filtro) . En la técnica se conocen varios métodos para inmovilizar las biomoléculas en una variedad de superficies sólidas. Por ejemplo, la superficie sólida puede ser una membrana (por ejemplo, nitrocelulosa) , una placa de microvaloración (por ejemplo, PVC, polipropileno o poliestireno) , un tubo de prueba (vidrio o plástico) , una varilla de aforar (por ejemplo, PVC, polipropileno, poliestireno, látex y similares) , un tubo microcentrífugo, o una cuenta de vidrio o plástico. El componente deseado puede estar enlazado de manera covalente o unido de manera no covalente a través de un enlace no específico.

Una amplia variedad de polímeros orgánicos e inorgánicos, tanto naturales como sintéticos, pueden emplearse como el material para la superficie sólida. Los polímeros ilustrativos incluyen el polietileno, polipropileno, poli (4metilbuteno) , poliestireno, polimetacrilato, poli (tereftalato de etileno) , rayón, nylon, poli (butirato vinílico) , difluoruro de polivinilideno (PVDF) , siliconas, poliformaldehído, celulosa, acetato de celulosa, nitrocelulosa y similares. Otros materiales que pueden emplearse incluyen el papel, vidrio, cerámica, metales, metaloides, materiales semiconductores, cementos o similares. Además, las sustancias que forman geles, como las proteínas (por ejemplo, las gelatinas) , lipopolisacáridos, silicatos, agarosa y poliacrilamidas también pueden utilizarse. Los polímeros que forman varias fases acuosas, como el dextran, glicoles de polialquileno o los surfactantes, como los fosfolípidos, las sales de amonio de alquilo de cadena larga (12-24 átomos de carbono) y similares también son adecuados. Cuando la superficie sólida es porosa, pueden emplearse diferentes tamaños de poros dependiendo de la naturaleza del sistema.

Al preparar la superficie, puede emplearse una pluralidad de materiales diferentes, particularmente como laminados, para obtener varias propiedades. Por ejemplo, los recubrimientos de proteína, como la gelatina, pueden utilizarse para evitar un enlace no específico, para simplificar la conjugación covalente, mejorar la detección de la señal o aspectos similares.

Si se desea el enlace covalente entre un compuesto y la superficie, la superficie será por lo general polifuncional o capaz de ser polifuncionalizada. Los grupos funcionales que pueden estar presentes en la superficie y utilizarse para el enlace pueden incluir los ácidos carboxílicos, aldehídos, grupos amino, grupos ciano, grupos etilénicos, grupos hidroxil, grupos mercapto y similares. La manera de enlazar una amplia variedad de compuestos con diferentes superficies es bastante conocida y se ilustra ampliamente en la literatura. Consultar, por ejemplo, Enzimas Inmovilizadas, Ichiro Chibata, Halsted Press, Nueva York, 1978, y Cuatrecasas (1970) , Boletín de Biol. Quím., 245 3059) .

Además del enlace covalente, pueden utilizarse diferentes métodos para el enlace no covalente de un componente del ensayo. El enlace no covalente es por lo general la absorción no específica de un compuesto a la superficie.

Una persona capacitada en la técnica apreciará que con frecuencia es deseable reducir el enlace no específico en los inmunoensayos. De manera particular, cuando el ensayo implica un antígeno o anticuerpo inmovilizado en un substrato sólido, es deseable reducir la cantidad de enlace no específico al substrato. Los medios para reducir este enlace no específico son bastante conocidos para las personas capacitadas en la técnica. Por lo general, esto implica el recubrimiento del substrato con una composición proteinácea. En particular, las composiciones de proteínas como la albúmina de suero de bovino (BSA) , la leche en polvo sin grasa y la gelatina se utilizan ampliamente, de las cuales la leche en polvo algunas veces es la preferida. De manera alternativa, se designa la superficie de tal forma que enlaza de una manera no específica un componente pero no enlaza significativamente el otro. Por ejemplo, una superficie que tiene una lectina como la Concanavalina A enlazará un carbohidrato que contiene compuesto, pero no una proteína etiquetada que carece de glucosilación. Las diversas superficies sólidas para utilizarse en la unión no covalente de los componentes del ensayo se revisan en las Patentes de los Estados Unidos Nos. 4, 447, 576 y 4, 254, 082.

H) ENSAYOS PARA ANTICUERPOS ANTI-TRT

La presente invención también proporciona reactivos para la detección de inmunoglobulinas específicas de la hTRT. La hTRT inmovilizada (por ejemplo, la hTRT recombinante enlazada a una placa de microensayo) puede ser incubada con suero de un paciente bajo condiciones en las cuales los anticuerpos anti-hTRT, si están presentes, enlazan la hTRT inmovilizada. Después del lavado para eliminar la inmunoglobulina enlazada de una manera no específica, pueden detectarse los anticuerpos del suero enlazados, si están presentes, agregando anticuerpos anti (Ig humano) etiquetados de una manera detectable (los enfoques alternativos y las variaciones son bastante conocidos para las personas capacitadas en la técnica; consultar, por ejemplo, Harlow, mencionado anteriormente, en el Cap. 14) . Estos ensayos son útiles para detectar los anticuerpos anti-hTRT en cualquier fuente incluyendo el suero humano o animal o un portador como la salina. Se puede utilizar los ensayos para detectar o monitorear una respuesta inmunológica a las proteínas de la hTRT en un paciente, particularmente una respuesta autoinmune (por ejemplo, anti-telomerasa) . Los anticuerpos anti-hTRT pueden estar presentes en el suero u otros tejidos o fluidos de un paciente que sufre de una enfermedad u otra condición autoinmune.

I) COMBINACIONES DE ENSAYOS

Los ensayos de diagnóstico y prognóstico descritos en la presente invención pueden realizarse en diferentes combinaciones y también pueden llevarse a cabo junto con otras pruebas de diagnóstico o prognóstico. Por ejemplo, cuando se utilizan los métodos actuales para detectar la presencia de células cancerosas en la muestra de un paciente, la presencia de hTRT puede utilizarse para determinar la etapa de la enfermedad, si es probable que un tumor en particular invada el tejido cercano o se disemine por metástasis a un sitio distante, y si es probable una recurrencia del cáncer. Las pruebas que pueden ofrecer información adicional incluyen el análisis microscópico de muestras de la biopsia, detección de antígenos (por ejemplo, marcadores de la superficie de las células) asociados con la tumorigenicidad (por ejemplo, utilizando la histocitoquímica, FACS o algo similar) , métodos de reproducción de imágenes (por ejemplo, después de la administración a un paciente de anticuerpos anti-tumor etiquetados) , ensayos de actividad de la telomerasa, ensayos de longitud del telómero, ensayos de la hTR, o similares. Estas pruebas de combinación pueden ofrecer información útil con respecto a la progresión de una enfermedad.

También podrá reconocerse que las combinaciones de ensayos pueden ofrecer información útil. Por ejemplo, tal como se indicó anteriormente, los ensayos para el mRNA de la hTRT pueden combinarse con ensayos para la hTR (RNA de telomerasa humana) o ensayos de la actividad de la telomerasa (es decir, TRAP) para proporcionar información sobre el ensamble y la función de la telomerasa.

J) PAQUETES

La presente invención también proporciona paquetes útiles para la clasificación, monitoreo, diagnosis y prognosis de pacientes con una condición relacionada con la telomerasa, o para la determinación del nivel de expresión de la hTRT en las células o las líneas celulares. Los paquetes incluyen uno o más reactivos para determinar la presencia o ausencia de un producto del gene de la hTRT (RNA o proteína) o para cuantificar la expresión del gene de la hTRT. Los reactivos preferidos incluyen las sondas y los iniciadores del ácido nucleico que se enlazan de una manera específica al gene de la hTRT, el RNA, el cDNA, o porciones de los mismos, junto con proteínas, péptidos, anticuerpos e iniciadores de control, sondas, oligonucleótidos, proteínas, péptidos y anticuerpos. Pueden incluirse otros materiales, incluyendo las enzimas (por ejemplo, transcriptasas inversas, polimerasas del DNA, ligasas) , amortiguadores, reactivos (etiquetas, dNTPs) .

Los paquetes pueden incluir de una manera alternativa, o en combinación con cualquiera de los demás componentes descritos en la presente invención, un anticuerpo que se enlaza específicamente con los polipéptidos de la hTRT o las secuencias de los mismos. El anticuerpo puede ser monoclonal o policlonal. El anticuerpo puede conjugarse con otra porción como por ejemplo una etiqueta y/o puede inmovilizarse en un soporte sólido (substrato) . El (los) paquete (s) puede (n) incluir también un segundo anticuerpo para la detección de los complejos del anticuerpo/polipéptido de la hTRT o para la detección de sondas del ácido nucleico hibridado, así como uno o más proteínas o péptidos de la hTRT para utilizarse como control u otros reactivos.

El anticuerpo o la sonda de hibridación pueden estar libres o inmovilizados en un soporte sólido como por ejemplo un tubo de prueba, una placa del microvalorador, una varilla de aforar y similares. El paquete también puede contener materiales de instrucción que enseñen el uso del anticuerpo o la sonda de hibridación en un ensayo para la detección de la TRT. El paquete puede contener reactivos apropiados para la detección de etiquetas, o para etiquetar controles positivos y negativos, lavar soluciones, amortiguadores de dilución y similares.

En una forma de realización, el paquete incluye un par del iniciador para la amplificación del mRNA de la hTRT. Este paquete también puede incluir una sonda para el DNA amplificado de la hTRT y/o una polimerasa, amortiguador, dNTPs y similares. En otra, el paquete incluye una sonda, de una manera opcional se trata de una sonda etiquetada. En otra, el paquete incluye un anticuerpo.

X. IDENTIFICACIÓN DE MODULADORES DE LA ACTIVIDAD DE LA TELOMERASA.

A. ASPECTOS GENERALES

La invención permite compuestos y tratamientos que modulan la actividad o la expresión de una telomerasa o un componente de la telomerasa (por ejemplo, la proteína de la hTRT) . La invención proporciona ensayos y métodos de clasificación (incluyendo clasificaciones de alto rendimiento) para la identificación de compuestos y tratamientos que modulan la actividad o expresión de la telomerasa. Estos moduladores de la actividad y expresión de la telomerasa (en lo sucesivo denominados como "moduladores") incluyen los agonistas de la telomerasa (que aumentan la actividad y/o expresión de la telomerasa) y los antagonistas de la telomerasa (que disminuyen la actividad y/o expresión de la telomerasa) .

Los moduladores identificados en la invención tienen una amplia variedad de usos. Por ejemplo, se contempla que los moduladores de la telomerasa serán agentes terapéuticos efectivos para el tratamiento de enfermedades humanas. La clasificación de la actividad agonista y los activadores de la transcripción o la traducción se proporcionan para las composiciones que incrementan la actividad de la telomerasa en una célula (incluyendo la capacidad de duplicación dependiente de un telómero, o una actividad de la telomerasa "parcial") . Estas composiciones agonistas ofrecen métodos para inmortalizar células no transformadas de otra forma normales, incluyendo las células que pueden expresar proteínas útiles. Estos agonistas también pueden proporcionar métodos para controlar el envejecimiento celular. Por el contrario, la clasificación de una actividad antagonista proporciona composiciones que disminuyen la capacidad de duplicación dependiente de un telómero, mortalizando de esta manera células que de otra forma son inmortales, como las células del cáncer. La clasificación de la actividad antagonista proporciona composiciones que disminuyen la actividad de la telomerasa, previniendo de esta manera la división celular ilimitada de las células que presentan un crecimiento celular no regulado, como las células del cáncer. Las enfermedades y condiciones ilustrativas que pueden tratarse utilizando moduladores se enlistan en la presente invención, por ejemplo, en las Secciones VII y IX, mencionadas anteriormente. En general, los moduladores identificados en la invención pueden utilizarse cuando se desee incrementar o disminuir la actividad de la telomerasa en una célula u organismo. Por lo tanto, además del uso en el tratamiento de la enfermedad, un modulador que incrementa los niveles de expresión de la hTRT puede utilizarse para producir una línea celular humana cultivada que posee propiedades como las descritas en general en la Sección VIII, mencionada anteriormente, y varios otros usos que serán aparentes para las personas capacitadas en la técnica.

Un compuesto o tratamiento modula la "expresión" de la telomerasa o un componente de la telomerasa cuando la administración del compuesto o tratamiento cambia la velocidad o el nivel de la transcripción del gene que codifica un componente de la telomerasa (por ejemplo, el gene que codifica el mRNA de la hTRT) , afecta la estabilidad o el procesamiento posterior a la transcripción del ARN que codifica un componente de la telomerasa (por ejemplo, transporte, empalme, poliadenilación u otra modificación) , afecta la traducción, estabilidad, procesamiento posterior a la transcripción o modificación de una proteína codificada (por ejemplo, la hTRT) , o cambia de otra forma el nivel de RNP de la telomerasa funcional (por ejemplo, catalíticamente activa) . Un compuesto o tratamiento afecta la "actividad" de la telomerasa cuando la administración del compuesto o tratamiento cambia la actividad de una telomerasa como por ejemplo cualquiera de las actividades descritas en la Sección IV (B) mencionada anteriormente (por ejemplo, incluyendo la actividad catalítica de la telomerasa en proceso o que no está en proceso; la capacidad de proceso de la telomerasa; la actividad de la transcriptasa inversa convencional; la actividad nucleolítica; la actividad de enlace del iniciador o substrato; la actividad de enlace de dNTP; la actividad de enlace del RNA, el ensamble de la RNP de la telomerasa; y la actividad de enlace de la proteína) .

Podrá apreciarse que no existe necesariamente una delineación aguda entre los cambios en la "actividad" y los cambios en la "expresión", y que estos términos se utilizan para facilitar la explicación y no como limitación. También podrá apreciarse que los moduladores identificados en la invención deben afectar específicamente la actividad o expresión de la telomerasa (por ejemplo, sin cambiar de manera general la expresión de las proteínas de mantenimiento como la actina) más que, por ejemplo, reducir la expresión de un componente de la telomerasa mediante el envenenamiento no específico de una célula objetivo.

B. ENSAYOS PARA LA IDENTIFICACIÓN DE LOS MODULADORES DE LA TELOMERASA

La invención proporciona métodos y reactivos para clasificar las composiciones o compuestos capaces de afectar la expresión de una telomerasa o un componente de la telomerasa, capaces de modificar la capacidad de duplicación del DNA de la telomerasa, o que de alguna otra forma modifiquen la capacidad de la enzima de la telomerasa y la proteína de la TRT para sintetizar el DNA telomérico ("actividad completa") . Se puede proporcionar clasificaciones para los moduladores de cualquiera o todas las "actividades parciales" de la hTRT. Se puede proporcionar también ensayos que pueden ser utilizados para clasificar los agentes que incrementan la actividad de la telomerasa, por ejemplo, provocando que la proteína o la telomerasa de la hTRT sea expresada en una célula en la cual no se expresa normalmente, o incrementando los niveles de actividad de la telomerasa en las células de telomerasa positiva.

La telomerasa o las proteínas de la subunidad de la telomerasa o sus fragmentos u oligopéptidos catalíticos o inmunógenos de los mismos, pueden utilizarse para clasificar los compuestos terapéuticos en cualquiera de una variedad de técnicas de clasificación de medicamentos. El fragmento empleado en esta prueba puede estar libre en la solución, fijo a un soporte sólido, sostenido en una superficie celular, o ubicado intracelularmente. Puede medirse la formación de complejos de enlace, entre la telomerasa o la proteína de la subunidad y el agente que se somete a la prueba.

En varias formas de realización, la invención incluye métodos para la clasificación de los antagonistas que: se enlazan al sitio activo de la enzima; inhiben la asociación de su porción de RNA, proteínas asociadas con la telomerasa, nucleótidos, o DNA telomérico con la proteína de la hTRT o la telomerasa; promueven la disociación del complejo de la enzima; interfieren con la transcripción de la porción del ARN de la telomerasa (por ejemplo, la hTR) ;

o inhiben cualquiera de las "actividades parciales" descritas en la presente invención. La invención proporciona métodos para la clasificación de composiciones que inhiben la asociación del ácido nucleico y/o las composiciones asociadas con la telomerasa con la hTRT, como la asociación de la hTR con la hTRT o la asociación de la hTRT con los homólogos humanos de p80 ó p95 u otra proteína asociada, o la asociación de la hT con un telómero o un nucleótido; la clasificación de composiciones que promueven la disociación o promueven la asociación (es decir, el ensamble) del complejo de la enzima, como un anticuerpo dirigido para la hTR o la hTRT; la clasificación de agentes que afectan la capacidad de proceso de la enzima; y la clasificación de ácidos nucleicos y otras composiciones que se enlazan a la telomerasa, como un ácido nucleico complementario a la hTR. La invención contempla además la clasificación de composiciones que aumentan o disminuyen la transcripción del gene de la hTRT y/o la traducción del producto del gene de la hTRT. La invención también contempla un método de clasificación para los moduladores de la telomerasa en los animales, en una forma de realización, reconstituyendo la actividad de una telomerasa, o la actividad de una anti-telomerasa, en un animal, como por ejemplo un animal transgénico. La invención proporciona sistemas de ensayos in vivo que incluyen modelos de "derribamiento", en los cuales una o varias unidades de la telomerasa endógena, la porción de ARN de la telomerasa y/o las proteínas asociadas con la telomerasa han sido eliminadas o inhibidas. La actividad de la telomerasa endógena, total o parcial, puede permanecer o estar ausente.

En una forma de realización se reconstituye la actividad de una telomerasa exógena, total o parcial.

Se puede proporcionar una variedad de ensayos de telomerasa con actividad parcial para identificar una variedad de diferentes clases de moduladores de la actividad de la telomerasa. Los ensayos de "actividad parcial" permiten la identificación de las clases de moduladores con actividad de la telomerasa que de otra forma no podrían ser detectados en un ensayos de telomerasa de "actividad completa". Un ensayo de actividad parcial implica la actividad fuera de proceso de la TRT y la telomerasa. La naturaleza en proceso de la telomerasa es descrita por Morin (1989) Célula, 59:521-529; consultar también Prowse (1993) "Identificación de la actividad de una telomerasa fuera de proceso a partir de células de ratón", Procedimientos Científicos de la Academia Nacional E.U.A., 90:1493-1497. Otro ensayo de actividad parcial explota la actividad "parecida a la transcriptasa inversa" de la telomerasa. En estos ensayos, se somete a ensayo la actividad de la transcriptasa inversa de la proteína de la hTRT. Consultar Lingner (1997) "Motivos de la transcriptasa inversa en la subunidad catalítica de la telomerasa", Ciencia 276:561-567. Otro ensayo de actividad parcial explota la "actividad nucleótica" de la hTRT y la telomerasa, implicando la eliminación de la enzima de por lo menos un nucleótido, por lo general la guanosina, del filamento de 3' de un iniciador. Esta actividad nucleótica ha sido observada en la telomerasa del Tetrahymena por Collins (1993) "La telomerasa del Tetrahymena cataliza la disociación nucleolítica y el alargamiento fuera de proceso" Dev. Genes 7:1364-1376. Otro ensayo de actividad parcial implica el análisis de la capacidad de la hTRT y la telomerasa de enlazar nucleótidos como parte de su actividad de polimerización del DNA en proceso enzimático. Otro ensayo de actividad parcial implica el análisis de la capacidad de la hTRT o la telomerasa de enlazar su porción del RNA, es decir, la hTR para las células humanas, utilizada como molde para la síntesis del telómero. Los ensayos de actividad parcial adicionales implican el análisis de la capacidad de la hTRT o la telomerasa de enlazar su los cromosomas in vivo, o de enlazar los iniciadores del oligonucleótido in vitro o en sistemas reconstituidos, o de enlazar las proteínas asociadas con la estructura cromosómica (consultar, para un ejemplo de esta proteína, Harrington (1995) Boletín de Biol. Quím. 270:8893-8901) . Las estructuras cromosómicas que enlazan la hTRT incluyen, por ejemplo, el DNA de repetición telomérica, las proteínas del telómero, histonas, proteína de la matriz nuclear, proteínas de control de la división celular/ciclo celular, y similares.

En una forma de realización, un ensayo para la identificación de moduladores consta de poner en contacto una o más células (es decir, "células de prueba") con un compuesto de prueba, y determinar si el compuesto de prueba afecta la expresión o actividad de una telomerasa (o el componente de la telomerasa) en la célula. Por lo general, esta determinación incluye comparar la actividad o la expresión en la célula de prueba en comparación con una célula o células similares (es decir, células de control) que no se han puesto en contacto con el compuesto de prueba. De manera alternativa, pueden utilizarse extractos de células en lugar de células intactas. En una forma de realización relacionada, el compuesto de prueba se administra a un organismo multicelular (por ejemplo, una planta o un animal) . La telomerasa o el componente de la telomerasa puede ser totalmente endógeno a la célula o el organismo multicelular (es decir, codificado por los genes endógenos de ocurrencia natural) , o puede ser una célula recombinante o un organismo transgénico que incluye uno o más componentes de la telomerasa expresados de una manera recombinante (por ejemplo, hTRT, hTR, proteínas asociadas con la telomerasa) , o pueden tener componentes tanto endógenos como recombinantes. De esta manera, en una forma de realización, los moduladores de la actividad de la telomerasa se administran a células mortales. En otra forma de realización, los moduladores de la actividad de la telomerasa se administran a células inmortales. Por ejemplo, los antagonistas de la duplicación del DNA mediado con telomerasa pueden identificarse administrando la composición inhibitoria putativa a una célula que se sabe que muestra cantidades significativas de actividad de la telomerasa, como las células del cáncer, y midiendo si se observa una disminución en la actividad de la telomerasa, la longitud del telómero o la capacidad proliferativa, todo lo cual indica un compuesto con actividad antagonista.

En otra forma de realización, un modulador se identifica monitoreando un cambio en la actividad de una telomerasa de un complejo de ribonucleoproteína (RNP) que incluye una TRT (por ejemplo, la hTRT) y un ARN de molde (por ejemplo, la hTR) , cuya RNP está reconstituida in vitro (por ejemplo, tal como se describe en el Ejemplo 7, mencionado posteriormente) .

En otra forma de realización más, el modulador es identificado mediante el monitoreo de un cambio en la expresión de un producto del gene de la TRT (por ejemplo, el ARN o la proteína) en una célula, animal, sistema de expresión in vitro u otro sistema de expresión.

Todavía en otra forma de realización, el modulador se identifica cambiando la expresión de un gene informador, como el descrito en el Ejemplo 15, cuya expresión está regulada, total o parcialmente, por un elemento regulatorio de la TRT de ocurrencia natural como un promotor o intensificador. En una forma de realización relacionada, se somete a ensayo la capacidad de un compuesto de prueba para enlazarse a un componente de la telomerasa (por ejemplo, la hTRT) , RNA, o secuencia regulatoria del gene (por ejemplo, el promotor del gene de la TRT) .

En otra forma de realización, el modulador se identifica observando los cambios en el procesamiento previo del mRNA de la hTRT, por ejemplo, productos empalmados alternativamente, eventos de poliadenilación alternativos, disociación del DNA, y similares. En una forma de realización relacionada, la actividad del modulador puede observarse monitoreando la producción de polipéptidos de la hTRT variante, algunos de los cuales pueden poseer una actividad de regulación de la telomerasa negativa dominante.

Los formatos del ensayo para la identificación de compuestos que afectan la expresión y la actividad de las proteínas son bastante conocidos en las industrias biotecnológicas y farmacéuticas, y para las personas capacitadas en la técnica serán aparentes varios ensayos adicionales y variaciones de los ensayos ilustrativos especificados anteriormente.

Los cambios en la actividad o la expresión de la telomerasa pueden medirse a través de cualquier método adecuado. Los cambios en los niveles de expresión de un componente de la telomerasa (por ejemplo, la proteína de la hTRT) o un precursor (por ejemplo, el mRNA de la hTRT) pueden someterse a ensayo utilizando métodos bastante conocidos para aquellas personas capacitadas en la técnica, algunos de los cuales se describen más arriba, por ejemplo, en la Sección IX e incluyen el monitoreo de niveles de los productos del gene de la TRT (por ejemplo, la proteína y los RNAs) mediante hibridación (por ejemplo, utilizando las sondas de TRT y los iniciadores de la invención) , inmunoensayos (por ejemplo, utilizando los anticuerpos anti-TRT de la invención) , ensayos de protección de la RNAsa, ensayos de amplificación, o cualquier otro método de detección adecuado descrito en la presente o conocido en la técnica. La cuantificación de las cantidades de ácido nucleico en una muestra (por ejemplo, evaluando los niveles RNA, por ejemplo, el mRNA de la hTR o hTRT) también es útil para evaluar los reguladores de transcripción cis- ó trans-.

De manera similar, los cambios en la actividad de la telomerasa pueden medirse utilizando métodos como los descritos en la presente (por ejemplo, en la Sección IV (B) , mencionada anteriormente) u otros ensayos de la función de la telomerasa. La cuantificación de la actividad de la telomerasa, cuando se desee, puede llevarse a cabo a través de cualquier método, incluyendo aquellos presentados aquí. Los antagonistas de la telomerasa que pueden provocar o acelerar la pérdida de la estructura telomérica pueden identificarse monitoreando y midiendo su efecto en la actividad de la telomerasa in vivo, ex vivo, o in vitro, o a través de sus efectos en la longitud del telómero (conforme a lo medido o detectado a través del entintado, el uso de sondas de hibridación etiquetadas u otros medios) o, sencillamente, mediante la inhibición de la división celular de las células de cáncer con telomerasa positiva (la disminución crítica de la telomerasa da como resultado un fenómeno llamado "crisis" o envejecimiento M2 (Shay, 1991) Ley de Bioquím. Biofís. 1072:1-7) , que estas células del cáncer han desviado por la activación de la telomerasa, pero que, en la ausencia de telomerasa, dará como resultado su envejecimiento o muerte a través de la eliminación y redisposición cromosómica) . La reconstitución de la actividad de la telomerasa humana in vivo ofrece un método para la clasificación de los moduladores de la telomerasa en células o animales de cualquier origen. Estos agonistas pueden identificarse en un ensayo de la actividad, que incluye las mediciones de los cambios en la longitud del telómero. Otros ejemplos de ensayos que miden la actividad de la telomerasa en las células incluyen los ensayos para la acumulación o pérdida de la estructura del telómero, el ensayo TRAP o un ensayo de reacción en cadena de la polimerasa cuantitativa.

En una forma de realización, los ensayos de la invención también incluyen un método en el que el compuesto de prueba produce una disminución estadísticamente significativa en la actividad de la hTRT conforme a lo medido por la incorporación de un nucleótido etiquetado dentro de un substrato en comparación con la cantidad relativa de la etiqueta incorporada en una reacción paralela que carezca del compuesto de prueba, determinando de esta forma que el compuesto de prueba es un inhibidor de la telomerasa.

Los métodos de la invención están sujetos a adaptaciones de los protocolos descritos en la literatura científica y de la patente y los conocidos en la técnica. Por ejemplo, cuando se utiliza una telomerasa o proteína de la TRT característica de esta invención para identificar las composiciones que actúan como moduladores de las actividades de la telomerasa, pueden clasificarse grandes números de moléculas potencialmente útiles en una sola prueba. Los moduladores pueden tener un efecto inhibitorio (antagonista) o de potenciación (agonista) sobre la actividad de la telomerasa. Por ejemplo, si se va a clasificar un panel de 1, 000 inhibidores, todos los 1, 000 inhibidores pueden colocarse potencialmente dentro de una fuente de microvaloración y someterse a prueba de manera simultánea. Si se descubre el inhibidor mencionado, entonces la agrupación de 1, 000 puede subdividirse en 10 agrupaciones de 100 y el proceso se repite hasta que se identifica un inhibidor individual.

En la clasificación de medicamentos, se examina un gran número de compuestos para evaluar su capacidad de actuar como moduladores de la telomerasa, un proceso acelerado en gran medida por las técnicas de clasificación de alto rendimiento. Los ensayos para la actividad de la telomerasa, total o parcial, descritos en la presente invención, pueden adaptarse para utilizarse en una técnica de alto rendimiento. Aquellas personas capacitadas en la técnica se dan cuenta de que existen diversos métodos para lograr este propósito.

Otra técnica para la clasificación de medicamentos que puede aplicarse para la clasificación de alto rendimiento de los compuestos que poseen una afinidad de enlace adecuada con la telomerasa o la subunidad de la proteína de la telomerasa se describe con detalles en la "Determinación de la Antigenicidad de la Secuencia del Aminoácido" por Geysen (Geysen, Solicitud WO 84/03564, publicada el 13 de septiembre de 1984, incorporada a la presente por referencia) . En resumen, grandes cantidades de diferentes compuestos de prueba de péptidos pequeños se sintetizan sobre un substrato sólido, como pasadores de plástico o alguna otra superficie. Los compuestos de prueba del péptido se someten a reacción con los fragmentos de telomerasa o las subunidades de la proteína de la telomerasa y se lavan. La telomerasa o la subunidad de la proteína de la telomerasa enlazadas se detectan posteriormente mediante métodos bastante conocidos en la técnica. La telomerasa o la subunidad de la proteína de la telomerasa purificadas sustancialmente también pueden recubrirse directamente sobre placas para utilizarse en las técnicas de clasificación del medicamento antes mencionadas. De manera alternativa, pueden utilizarse anticuerpos no neutralizadores para capturar el péptido e inmovilizarlo sobre un soporte sólido.

Esta invención también contempla el uso de ensayos de clasificación de medicamentos competitivos en donde los anticuerpos de neutralización capaces de enlazar la telomerasa o la proteína de la subunidad, compiten específicamente con un compuesto de prueba para enlazar la telomerasa o la proteína de la subunidad. También pueden utilizarse anticuerpos para detectar la presencia de cualquier péptido que comparta uno o más determinantes antigénicos con la telomerasa o la proteína de la subunidad.

Los métodos adicionales para identificar los moduladores de la actividad de una telomerasa han sido descritos en la Patente de los Estados Unidos Nº 5, 645, 986, que se incorpora a la presente por referencia. Podrá apreciarse que la presente invención proporciona mejoras a los métodos conocidos previamente, en parte al proporcionar reactivos como los polinucleótidos de la hTRT, sondas e iniciadores, hTR altamente purificada, hTRT y telomerasa, así como anticuerpos anti-telomerasa y anti-TRT, todos los cuales pueden utilizarse en ensayos, por ejemplo, como controles, estándares, agentes de enlace o hibridación, o de cualquier otra manera.

Podrá reconocerse que la telomerasa y la TRT producidas de manera recombinante (por ejemplo, la hTRT) características de la invención serán útiles en los ensayos para la identificación de los moduladores. El ensayo de clasificación puede utilizar telomerasa ó hTRT derivadas de una reconstitución completa o parcial de la actividad de la telomerasa, o por medio de un aumento en la actividad existente. El ensayo o las clasificaciones proporcionadas por la invención pueden utilizarse para someter a prueba la capacidad de la telomerasa para sintetizar el DNA telomérico o para probar cualquiera o todas las "actividades parciales" de la hTRT y las TRTs en general, tal como se describió anteriormente. El ensayo puede incorporar la modificación ex vivo de las células que han sido manipuladas para expresar la telomerasa con o sin su porción de ARN o las proteínas asociadas, y éstas pueden reimplantarse dentro de un animal, que puede utilizarse para una prueba in vivo. De esta manera, esta invención proporciona ensayos in vivo, y animales transgénicos pueden ser útiles para los mismos. Estos sistemas de ensayos in vivo pueden emplear células de "derribamiento", en las cuales una o varias unidades del complejo de la enzima de telomerasa endógena han sido eliminadas o inhibidas, así como células en las cuales se reconstituye o se activa la actividad de la telomerasa exógena o endógena.

Las telomerasas y las proteína de la TRT que han sido modificadas de una manera específica en el sitio (mediante una mutación específica en el sitio) para modificar o eliminar cualquiera o todas las funciones de la enzima de la telomerasa o la proteína de la TRT, también pueden emplearse en las clasificaciones de la invención para descubrir los agentes terapéuticos. Por ejemplo, la TRT puede diseñarse para perder su capacidad de enlazar el DNA del substrato, para enlazar su porción del ARN (como la hTR) , para catalizar la añadidura del DNA telomérico, para enlazar el substrato del desoxinucleótido, para tener actividad nucleolítica, para enlazar proteínas asociadas con el telómero o estructuras cromosómicas, y similares. Las "proteínas mutantes" o "muteens" resultantes pueden utilizarse para identificar los compuestos que modulan específicamente una, varias o todas las funciones o actividades de la proteína de la TRT o la telomerasa.

C. MODULADORES DE LA TELOMERASA EJEMPLARES.

1) ASPECTOS GENERALES

Los compuestos de prueba referidos con anterioridad pueden ser cualquiera de una amplia variedad de compuestos, tanto de ocurrencia natural como sintéticos, orgánicos e inorgánicos, e incluyendo polímeros (por ejemplo, oligopéptidos, polipéptidos, oligonucleótidos y polinucleótidos) , moléculas pequeñas, anticuerpos (conforme a lo definido ampliamente en la presente) , azúcares, ácidos grasos, nucleótidos y análogos de nucleótidos, análogos de estructuras de ocurrencia natural (por ejemplo, miméticos de péptidos, análogos de ácidos nucleicos, y similares) , y varios otros compuestos.

La invención permite proporcionar moduladores de todos los tipos, sin limitación de ningún mecanismo particular de acción. Para propósitos ilustrativos, los ejemplos de los moduladores incluyen compuestos o tratamientos que:

(i) se enlazan al polipéptido de la hTRT (por ejemplo, el sitio activo de la enzima) u otro componente de la telomerasa, y afecta una actividad de la telomerasa;

(ii) inhiben o promueven la asociación, o inhiben o promueven la disociación, de un componente de la telomerasa (por ejemplo, la hTRT o la RNP de la hTRT-hTRT) con o a partir de una proteína asociada con la telomerasa (por ejemplo, incluyendo las descritas en la Sección IV (D) , mencionadas anteriormente) ;

(iii) inhiben o promueven la asociación, o inhiben o promueven la disociación, de polipéptidos de la telomerasa (por ejemplo, la hTRT) con o a partir de ARN de la telomerasa (por ejemplo, la hTR) ;

(iv) inhiben o promueven la asociación, o inhiben o promueven la disociación, de polipéptidos de la telomerasa (por ejemplo, la hTRT) con o a partir de los cromosomas (por ejemplo, los telómeros) o el DNA cromosómico (por ejemplo, el DNA telomérico) ;

(v) aumentan o reducen la expresión de un producto del gene del componente de la telomerasa (por ejemplo, los productos del gene de la hTRT) , incluyendo el cambio de velocidad o nivel de transcripción del gene de la TRT, o la traducción, transporte o estabilidad del producto de un gen, o similar, mediante el enlace conel gene o el producto del gene (por ejemplo, mediante la interacción con un factor (por ejemplo, una proteína regulatoria de la transcripción) que afecta la transcripción del gene de la hTRT u otro componente de la telomerasa) .

2) MODULADORES DE PÉPTIDOS

Los moduladores potenciales de la actividad de la telomerasa también incluyen a los péptidos (por ejemplo, moduladores de péptidos inhibitorios (antagonistas) y activadores (agonistas) ) . Por ejemplo, los oligopéptidos con secuencias generadas de manera aleatoria pueden clasificarse para descubrir moduladores de péptidos (agonistas o inhibidores) de la actividad de la telomerasa. Estos péptidos pueden utilizarse directamente como medicamentos o para encontrar la orientación o posición de un grupo funcional que pueda inhibir la actividad de la telomerasa y que, a su vez, conduzca a la designación y prueba de un inhibidor de moléculas pequeñas, o se convierta en la columna vertebral de las modificaciones químicas que aumentan la utilidad farmacológica. Los péptidos pueden ser miméticos estructurales, y se pueden utilizar los programas de modelado molecular para designar los miméticos en base a la estructura secundaria característica y/o la estructura terciaria de la enzima de telomerasa y la proteína de la hTRT. Estos miméticos estructurales también pueden utilizarse terapéuticamente, in vivo, como moduladores de la actividad de la telomerasa (agonistas y antagonistas) . Los miméticos estructurales también pueden utilizarse como sustancias inmunógenas para deducir los anticuerpos de proteínas de anti-telomerasa o anti-TRT.

3) COMPUESTOS NATURALES INHIBITORIOS COMO MODULADORES DE LA ACTIVIDAD DE LA TELOMERASA

Además, puede clasificarse un gran número de compuestos modificadores de la actividad potencialmente útiles, en extractos de productos naturales como material de origen. Las fuentes de estos extractos pueden ser de un gran número de especies de hongos, actinomices, algas, insectos, protozoarios, plantas y bacterias. Aquellos extractos que muestran una actividad inhibitoria pueden analizarse posteriormente para aislar la molécula activa. Consultar por ejemplo, Turner (1996) Boletín de Etnofarmacología 51 (1-3) :39-43; Suh (1995) Investigación Anticáncer 15:233

239.

4) OLIGONUCLEÓTIDOS INHIBITORIOS

Un grupo de inhibidores particularmente útiles permitido por la presente invención incluye a los oligonucleótidos, que son capaces de enlazar el mRNA que codifica la proteína de la hTRT o el gene de la hTRT, previniendo o inhibiendo en cualquier caso la producción de proteína de la hTRT funcional. Otros oligonucleótidos interactúan con la porción del ARN de la telomerasa, como la hTR, o son capaces de evitar el enlace de la telomerasa o la hTRT con su DNA objetivo, o un componente de la telomerasa con otro, o con un substrato. Estos oligonucleótidos también pueden enlazar la enzima de la telomerasa, la proteína de la hTRT, o tanto la proteína como el RNA, e inhiben una actividad parcial tal como se describió anteriormente (como por ejemplo su actividad de proceso, su actividad de la transcriptasa inversa, su actividad nucleolítica, y similares) . La asociación puede ser a través de una hibridación específica de la secuencia con otro ácido nucleico o por medio de un enlace general, como en un aptamero, o ambos.

La actividad de la telomerasa puede inhibirse señalizando el mRNA de la hTRT con oligonucleótidos capaces de enlazar el mRNA de la hTRT.

Otra clasificación útil de inhibidores incluye a los oligonucleótidos que provocan la inactivación o disociación del mRNA de la hTRT o la hTR. Es decir, el oligonucleótido se modifica químicamente, o tiene actividad de enzima, lo que provoca la disociación mencionada, como en el caso de una ribozima, un oligonucleótido en cautividad con EDTA, o un oligonucleótido enlazado de manera covalente, como el psoralen u otro oligonucleótido enlazado con un reactivo de enlace cruzado. Como se observó anteriormente, se puede clasificar una agrupación de varios oligonucleótidos diferentes con la actividad deseada.

Otra clasificación útil de inhibidores incluye a los oligonucleótidos que enlazan los polipéptidos. Las moléculas de ARN de uno o dos filamentos o de DNA de uno o dos filamentos que se enlazan a objetivos de polipéptidos específicos se denominan "aptameros". La asociación específica del oligonucleótido-polipéptido puede mediarse a través de interacciones electrostáticas. Por ejemplo, los aptameros se enlazan específicamente a exocitos enlazadores de aniones en la trombina, que se enlaza fisiológicamente a la heparina polianiónica (Bock (1992) Naturaleza 355:564-566) . Debido a que la proteína de la hTRT se enlaza tanto a la hTR como a su substrato del DNA, y debido a que la presente invención proporciona la hTRT y otras proteínas de TRT en forma purificada en grandes cantidades, aquellas personas capacitadas en la técnica pueden clasificar fácilmente los aptameros enlazadores de TRT utilizando los métodos de la invención.

Los oligonucleótidos (por ejemplo, los oligonucleótidos del RNA) que enlazan la telomerasa, la hTRT, la hTR, o porciones de éstas, pueden generarse utilizando las técnicas de SELEX (Tuerk, 1997, Métodos de Biología Molecular 67, 2190) . En esta técnica, se enlaza una agrupación muy grande (106-109) de ácidos nucleicos de la secuencia aleatoria al objetivo (por ejemplo, la hTRT) utilizando condiciones que dan como resultado una gran cantidad de discriminación entre las moléculas con alta afinidad y baja afinidad para enlazar el objetivo. Las moléculas enlazadas se separan de las no enlazadas, y las moléculas enlazadas se amplifican por virtud de una secuencia específica del ácido nucleico incluida en su terminación y reactivos de amplificación adecuados. Este proceso se repite varias veces hasta que queda un número relativamente pequeño de moléculas que poseen una afinidad de enlace alta para el objetivo. Estas moléculas pueden someterse a prueba posteriormente para evaluar su capacidad de modular la actividad de la telomerasa tal como se describió en la presente.

Los antagonistas de la duplicación del DNA mediado con telomerasa también pueden basarse en la inhibición de la hTR (Norton (1996) Biotecnología de la Naturaleza 14:615-619) a través del reconocimiento o disociación de la secuencia complementaria, como por ejemplo a través de las ribozimas.

Los oligonucleótidos inhibitorios pueden transferirse dentro de la célula utilizando una variedad de técnicas bastante conocidas en el entorno. Por ejemplo, los oligonucleótidos pueden entregarse dentro del citoplasma sin una modificación específica. De manera alternativa, pueden entregarse mediante el uso de liposomas que se fusionan con la membrana celular o experimentan una endocitosis, es decir, empleando ligandos unidos al liposoma o directamente al oligonucleótido, que se enlaza a los receptores de la proteína de la membrana superficial de la célula, lo que da como resultado la endocitosis. De manera alternativa, las células pueden permeabilizarse para mejorar el transporte de los oligonucleótidos dentro de la célula, sin lastimar a las células huésped. Se puede utilizar una proteína de enlace del DNA, por ejemplo, la HBGF-1, que se sabe que transporta un oligonucleótido a la célula.

5) RIBOZIMAS INHIBITORIAS

Las ribozimas actúan enlazándose a un ARN objetivo a través de la porción enlazadora del ARN objetivo de una ribozima que permanece en proximidad cercana con una porción enzimática de la ribozima que disocia el ARN objetivo. De esta manera, la ribozima reconoce y se enlaza a un ARN objetivo por lo general a través de la formación de pares de base complementaria, y una vez enlazada al sitio correcto, actúa enzimáticamente para disociar e inactivar el ARN objetivo. La disociación de un ARN objetivo de cierta manera destruirá su capacidad de dirigir la síntesis de una proteína codificada si la disociación ocurre en la secuencia de codificación. Después de que una ribozima ha enlazado y disociado su ARN objetivo, por lo general se libera de este ARN y de esta forma puede enlazar y disociar objetivos nuevos de manera repetida.

6) IDENTIFICACIÓN DE PROTEÍNAS ASOCIADAS CON LA TELOMERASA PARA UTILIZARSE COMO MODULADORES

En una forma de realización de la invención, la telomerasa se utiliza para identificar las proteínas asociadas con la telomerasa, es decir, las proteínas accesorias de la telomerasa que modulan o de otra forma complementan la actividad de la telomerasa. Como se mencionó anteriormente, estas proteínas o fragmentos de las mismas pueden modular la función provocando la disociación o evitando la asociación del complejo de la enzima de telomerasa, previniendo el ensamble del complejo de la telomerasa, evitando que la hTRT se enlace al complemento de su ácido nucleico o al molde de su DNA, previniendo que la hTRT enlace los nucleótidos, o previniendo, aumentando o inhibiendo cualquiera, varias o todas las actividad parciales de la enzima de telomerasa o la proteína de la hTRT, como se describió anteriormente.

Una persona capacitada en la técnica puede utilizar los métodos de la invención para identificar qué porciones (por ejemplo, dominios) de las proteínas de asociación con la telomerasa están en contacto con la telomerasa. En una forma de realización de la invención, estas proteínas de asociación con la telomerasa o fragmentos de las mismas se utilizan como moduladores de la actividad de la telomerasa.

7) PROTEÍNAS ASOCIADAS CON LA TELOMERASA COMO MUTANTES NEGATIVOS DOMINANTES

En una forma de realización de la invención, las proteínas asociadas con la telomerasa se utilizan como moduladores de la actividad de la telomerasa. Las proteínas asociadas con la telomerasa incluyen estructuras cromosómicas, como las histonas, proteínas de la matriz nuclear, proteínas de control de la división celular y el ciclo celular, y similares. Otras proteínas asociadas con la telomerasa que pueden utilizarse como moduladores para el propósito de la invención incluyen las proteínas p80 y p95 y sus homólogos humanos, como TP1 y TRF-1 (Chong, 1995, Ciencia 270:1663-1667) . Además, los fragmentos de estas proteínas asociadas con la telomerasa pueden ser identificados por los técnicos capacitados de acuerdo con los métodos de la invención y pueden utilizarse como moduladores de la actividad de la telomerasa.

8) MUTANTES NEGATIVOS DOMINANTES

Ocho motivos altamente conservados han sido identificados entre las TRTs de diferentes especies no humanas, tal como se describió con anterioridad (consultar también Lingner (1997) Ciencia 276:561-567) . La Figura 4 muestra un esquema de la secuencia del aminoácido de TRT humana (a partir de pGRN121) y los motivos de RT en comparación con Trt1 p de S. pombe, p123 de Euplotes y Est2 p de S. cerevisiae. Se puede proporcionar ácidos nucleicos recombinantes y sintéticos en donde los codones de los residuos del aminoácido conservados en cada uno, por sí solos o junto con uno o más codones adicionales, de todos estos ocho motivos, han sido cambiados a cada uno de los otros codones. Una variedad de las secuencias de codificación resultantes expresa una hTRT no funcional. Consultar por ejemplo el Ejemplo 16. Una amplia variedad de enzimas de telomerasa "mutadas" y proteínas de TRT pueden tener una actividad parcial pero no una actividad completa de telomerasa. Por ejemplo, una de estas telomerasas es capaz de enlazar estructuras teloméricas, pero no enlaza el ARN asociado con la telomerasa (es decir, la hTR) . Si se expresa a niveles lo suficientemente altos, este mutante de la telomerasa puede reducir un componente de la telomerasa necesario (por ejemplo, la hTR) y por lo tanto, funciona como inhibidor de la actividad de la telomerasa tipo silvestre. Una telomerasa mutada que actúa de esta forma es una antagonista o un mutante denominado como "negativo-dominante".

9) ANTICUERPOS

En general, los anticuerpos de la invención pueden utilizarse para identificar, purificar o inhibir cualquier o toda la actividad de la enzima de la telomerasa y la proteína de la hTRT. Los anticuerpos pueden actuar como antagonistas de la actividad de la telomerasa en una variedad de formas, por ejemplo, previniendo que el complejo de la telomerasa o el nucleótido se enlacen con los substratos de su DNA, evitando que los componentes de la telomerasa formen un complejo activo, manteniendo una estructura cuaternaria funcional (complejo de telomerasa) o enlazándose a uno de los sitios activos de la enzima u otros sitios que tengan efectos alostéricos en la actividad (las diferentes actividades parciales de la telomerasa se describen con más detalles en otras partes de esta especificación) .

D) SÍNTESIS DEL MODULADOR

Se contempla que los moduladores de la telomerasa identificables en la invención se elaborarán utilizando los métodos conocidos en el campo farmacéutico, incluyendo los métodos combinatorios y las técnicas de designación de medicamentos racionales.

1) METODOLOGÍA DE LA QUÍMICA COMBINATORIA

La creación y clasificación simultánea de grandes bibliotecas de moléculas sintéticas puede llevarse a cabo utilizando técnicas bastante conocidas en la química combinatoria, por ejemplo, consultar van Breemen (1997) Química Analítica 69:2159-2164; Lam (1997) Des. Medicamentos Anticáncer 12:145-167 (1997) .

Como se indicó anteriormente, la metodología de la química combinatoria puede utilizarse para crear grandes números de oligonucleótidos (u otros compuestos) que pueden ser clasificados rápidamente para evaluar los oligonucleótidos (o compuestos) específicos que tienen afinidades y especificidades de enlace adecuadas hacia cualquier objetivo, como las proteínas de TRT características de la invención (para información sobre antecedentes generales, consultar Gold (1995) Boletín de Biol. Quím. 270:13581-13584) .

2) DESIGNACIÓN DE MEDICAMENTOS RACIONALES

La designación de medicamentos racionales implica un conjunto integrado de metodologías que incluyen el análisis estructural de las moléculas objetivo, químicas sintéticas y herramientas de cómputo avanzadas. Cuando se utiliza para designar moduladores, como los antagonistas/inhibidores de los objetivos de la proteína, como la enzima de la telomerasa y la proteína de la hTRT, el objetivo de la designación de medicamentos racionales es entender la configuración tridimensional y la química de la molécula. La designación de medicamentos racionales es auxiliada por datos cristalográficos de rayos X o datos NMR, que pueden determinarse actualmente para la proteína de la hTRT y la enzima de telomerasa de acuerdo con los métodos y utilizando los reactivos proporcionados por la invención. También son útiles los cálculos sobre electrostática, las hidrofobicidades y la accesibilidad de solventes. Consultar, por ejemplo, Coldren (1997) Procedimientos Científicos de la Academia Nacional E.U.A., 94:6635-6640.

E) PAQUETES

La invención también proporciona paquetes que pueden utilizarse para ayudar a determinar si un compuesto de prueba es un modulador de la actividad de una TRT. El paquete por lo general incluye uno o más de los siguientes componentes: un polipéptido o polinucleótido de TRT purificado sustancialmente (incluyendo sondas e iniciadores) ; un plásmido capaz de expresar una TRT (por ejemplo, la hTRT) cuando se introduce dentro de una célula o un sistema de expresión libre de células; un plásmido capaz de expresar una TR (por ejemplo, la hTR) cuando se introduce dentro de una célula o un sistema de expresión libre de células; células o líneas celulares; una composición para detectar un cambio en la actividad de la TRT, y un material de instrucción para enseñar los medios para detectar y medir un cambio en la actividad de la TRT, indicando que un cambio en la actividad de la telomerasa en presencia del compuesto de prueba es un indicador de que el compuesto de prueba modula la actividad de la telomerasa, y uno o más recipientes. El paquete también puede incluir los medios, como los reactivos del ensayo TRAP o los reactivos para un ensayo de reacción en cadena de la polimerasa cuantitativa, para medir un cambio en la actividad de la TRT. El paquete también puede incluir material de instrucción para enseñar los medios para detectar y medir un cambio en la actividad de la TRT, indicando que un cambio en la actividad de la telomerasa en presencia del compuesto de prueba es un indicador de que el compuesto de prueba modula la actividad de la telomerasa.

XI. ORGANISMOS TRANSGÉNICOS (CÉLULAS DE DERRIBAMIENTO DE LA TELOMERASA Y MODELOS ANIMALES)

Se puede proporcionar organismos multicelulares no humanos transgénicos (por ejemplo, plantas y animales no humanos) u organismos unicelulares (por ejemplo, levadura) que constan de una secuencia del gene de la TRT exógena, que puede ser una secuencia de codificación o una secuencia regulatoria (por ejemplo, promotora) . El organismo puede expresar un polipéptido de TRT exógeno, que posee una secuencia de una proteína de TRT humana. El organismo también puede expresar un componente del ARN de la telomerasa (por ejemplo, la hTR) .

Se puede proporcionar organismos unicelulares y multicelulares (o células de los mismos) en los que por lo menos un gene codifica un componente de la telomerasa (por ejemplo, la TRT o TR) o la proteína asociada con la telomerasa está mutada o eliminada (es decir, en una región regulatoria o de codificación) de tal forma que la telomerasa nativa no se expresa, o se expresa en niveles reducidos o con diferentes actividades al compararla con células u organismos tipo silvestre. Estas células y organismos con frecuencia se refieren como las células u organismos de "derribamiento del gene".

Se puede proporcionar células y organismos en los que un gene de telomerasa endógena (por ejemplo, TRT de murino) está ya sea presente o mutado o eliminado opcionalmente y se introduce y se expresa un gene o variante de telomerasa exógena (por ejemplo, TRT humana) . Las células y organismos de este tipo serán útiles, por ejemplo, como sistemas modelo para identificar moduladores de la actividad o expresión de la hTRT; determinar los efectos de las mutaciones en los genes del componente de la telomerasa, y otros usos como la determinación del tiempo de desarrollo y la ubicación de tejidos de actividad de la telomerasa (por ejemplo, para evaluar cuándo se debe administrar un modulador de telomerasa y para evaluar cualquier efecto secundario potencial) .

Los ejemplos de organismos multicelulares incluyen plantas, insectos, y animales no humanos como ratones, ratas, conejos, monos, simios, cerdos y otros mamíferos no humanos. Un ejemplo de un organismo unicelular es una levadura.

Los métodos para la alteración o disrupción de genes específicos (por ejemplo, los genes de TRT endógenos) son bastante conocidos para aquellos capacitados en la técnica; consultar, por ejemplo, Baudin y colaboradores, 1993, Inv. Ácidos Nucleicos 21:3329; Wach y colaboradores, 1994, Levadura 10:1793; Rothstein, 1991, Métodos de Enzimología 194:281; Anderson, 1995, Métodos de Biología Celular 48:31; Pettitt y colaboradores, 1996, Desarrollo 122:4149-4157; Ramirez-Solis y colaboradores, 1993, Métodos de Enzimología 225:855; y Thomas y colaboradores, 1987, Célula 51:503, y cada uno de estos se incorpora a la presente por referencia en su totalidad para todos los propósitos.

Las células de "derribamiento" y los animales incluyen células y animales en los cuales se han eliminado o inhibido una o varias unidades del complejo de la enzima de telomerasa endógena. La reconstitución de la actividad de la telomerasa ayudará a la célula o al animal contra el envejecimiento o, para las células de cáncer, contra la muerte celular provocada por su incapacidad para mantener los telómeros. Los métodos para alterar la expresión de los genes endógenos son bastante conocidos por aquellas personas capacitadas en la técnica. Por lo general, estos métodos implican la alteración o el reemplazo de todas o una parte de las secuencias regulatorias que controlan la expresión del gene particular que se va a regular. Las secuencias regulatorias pueden alterarse, por ejemplo, el promotor nativo. La técnica convencional para la mutación enfocada de los genes implica la colocación de un fragmento del DNA genómico que contiene el gene de interés dentro de un vector, seguida por la clonación de los dos brazos genómicos asociados con el gene enfocado alrededor de un estuche de resistencia a la neomicina seleccionable en un vector que contiene cinasa de timidina. Esta construcción de "derribamiento" se transfecta posteriormente dentro de la célula huésped apropiada, es decir, la célula impulsora embriónica (ES) de un ratón, que se somete subsecuentemente a una selección positiva (utilizando G418, por ejemplo, para seleccionar la resistencia a la neomicina) y una selección negativa (utilizando, por ejemplo, FIAU para excluir las células que carecen de cinasa de timidina) , permitiendo la selección de células que han pasado por una recombinación homóloga con el vector de derribamiento. Este enfoque conduce a la inactivación del gene de interés. Consultar, por ejemplo, las Patentes de los Estados Unidos NI 5, 464, 764; 5, 631, 153; 5, 487, 992; y 5, 627, 059.

La expresión de "derribamiento" de un gene endógeno también puede lograrse mediante el uso de la recombinación homóloga para introducir un ácido nucleico heterólogo dentro de las secuencias regulatorias (por ejemplo, un promotor) del gene de interés. Para evitar la expresión de la enzima o el producto funcional, pueden ser adecuadas las mutaciones sencillas que ya sea alteran la configuración de lectura o interrumpen el promotor. Para regular hacia arriba la expresión, un promotor nativo puede sustituirse por un promotor heterólogo que induce niveles más altos de transcripción. También, la "inserción de trampa del gene" puede utilizarse para desintegrar un gene huésped, y las células ES de ratón pueden utilizarse para producir animales transgénicos de derribamiento, tal como se describe para el ejemplo, en Holzschu (1997) Inv. Transgénica 6:97-106.

La alteración de la expresión de los genes endógenos mediante una recombinación homóloga también puede lograrse utilizando secuencias del ácido nucleico que incluyen el gene estructural en cuestión. Las secuencias ascendentes se utilizan para enfocar las construcciones de recombinación heterólogas. Utilizando la información sobre la secuencia del gene estructural de la TRT, como la ID DE LA SECUENCIA No:1, una persona capacitada en la técnica puede crear construcciones de recombinación homóloga únicamente con experimentación de rutina. La recombinación homóloga para alterar la expresión de los genes endógenos se describe en las Patentes de los Estados Unidos Números 5, 272, 071 y WO 91/09955, WO 93/09222, WO 96/29411, WO 95/31560 y WO 91/12650. La recombinación homóloga en microbacterias se describe por Azad (1996) Procedimientos Científicos de la Academia Nacional E.U.A. 93:4787; Baulard (1996) Boletín de Bacteriología 178:3091; y Pelicic (1996) Microbiología Molecular 20:919. La recombinación homóloga en animales ha sido descrita por Moynahan (1996) Genética Molecular Humana 5:875, y en plantas por Offringa (1990) EMBO J. 9:3077.

XII. GLOSARIO

Los siguientes términos se definen posteriormente para ofrecer una orientación adicional para aquellas personas capacitadas en la practica de la invención: adyuvante, alelo (y secuencia alélica) , aminoácidos (incluyendo hidrofóbicos, polares, cargados) , sustitución conservadora, elementos de control (y secuencias regulatorias) , derivado, etiqueta detectable, nivel elevado, epítopo, prognosis favorable y no favorable, proteína de fusión, producto del gene, hTR, inmortal, sustancia inmunógena e inmunogénico, aislado, modulador, motivo, ácido nucleico (polinucleótido) , oligonucleótidos (y oligómeros) , enlazado de manera operativa, polipéptido, sonda (incluyendo sondas del ácido nucleico y sondas de anticuerpo) , recombinante, sistema de selección, secuencia, enlace especifico, condiciones de hibridación severa (y severidad) , identidad sustancial (y similaridad sustancial) , sustancialmente puro (y sustancialmente purificado) , células de telomerasa negativa y telomerasa positiva, actividad catalítica de la telomerasa, relacionado con la telomerasa, y compuestos de prueba.

Tal como se utiliza en la presente invención, el termino "adyuvante" se refiere a su significado ordinario de cualquier substancia que aumenta la respuesta inmunológica hacia un antígeno con el cual se mezcla. Los adyuvantes útiles en la presente invención incluyen, pero no se limitan a, geles minerales de Freund como el hidróxido de aluminio, y substancias activas en la superficie como por ejemplo la lisolecitina, polioles plurónicos, polianiones, péptidos, emulsiones de aceite, hemocianina de lapa en forma de bocallave, y dinitrofenol. El BCG (Bacillus Calmette-Guerin) y el Cor y nebacterium parvum son adyuvantes potencialmente útiles.

Tal como se utiliza en la presente invención, los términos "alelo" o "secuencia alélica" se refieren a una forma alternativa de una secuencia del ácido nucleico (es decir, un ácido nucleico que codifica la proteína de la hTRT) . Los alelos resultan de mutaciones (es decir, cambios en la secuencia del ácido nucleico) , y por lo general producen mRNAs o polipéptidos alterados y/o regulados de manera diferente, cuya estructura y/o función puede o no estar alterada. Los cambios de mutación comunes que dan origen a los alelos se adjudican por lo general a eliminaciones naturales, añadiduras o sustituciones de nucleótidos que pueden o no afectar los aminoácidos codificados. Cada uno de estos tipos de cambios pueden presentarse por si solos, en combinación con los demás, o una o mas veces dentro de un gene dado, cromosoma u otro ácido nucleico celular. Cualquier gene dado puede no tener, tener una o varias formas alélicas. Tal como se utiliza en la presente invención, el termino "alelo" se refiere a cualquiera o ya sea a un gene o a un mRNA transcrito del gene.

Tal como se utiliza en la presente invención, los "aminoácidos" se especifican algunas veces utilizando el código deuna letra estándar: Alanina (A) , Serina (S) , Treonina (T) , Ácido Aspártico (D) , Acido Glutámico (E) , Asparagina (N) , Glutamina (Q) , Arginina (R) , Lisina (K) , Isoleucina (I) , Leusina (L) , Metionina (M) , Valina (V) , Fenilalanina (F) , Tirosina (Y) , Triptofan (W) , Prolina (P) , Grlicina (G) , Histidina (H) , Cisteína (C) . Se incluyen los análogos de aminoácidos de ocurrencia sintética y no natural (y/o los enlaces de péptidos) .

Tal como se utiliza en la presente invención, "aminoácidos hidrofóbicos" se refiere a A, L, I, V, P, F, W y M. Tal como se utiliza en la presente invención, los "aminoácidos polares" se refieren a G, S, T, Y, C, N y Q. Tal como se utiliza en la presente invención, los "aminoácidos cargados" se refieren a D, E, H, K y R.

Tal como se utiliza en la presente invención, "sustitución conservadora", al describir una proteína, se refiere a un cambio en la composición del aminoácido de la proteína que no altera sustancialmente la actividad de la proteína. De esta manera, las "variaciones modificadas de manera conservadora" de una secuencia de aminoácido en particular, se refiere a las sustituciones del aminoácido de aquellos aminoácidos que no son importantes para la actividad de la proteína o la sustitución de aminoácidos por otros aminoácidos que poseen propiedades similares (por ejemplo, ácidos, básicos, cargados positiva o negativamente, polares o no polares, etc.) de tal forma que las sustituciones de aminoácidos incluso críticos no altera sustancialmente la actividad. Las tablas de sustitución conservadora que ofrecen aminoácidos funcionalmente similares son muy conocidas en la técnica. Cada uno de los siguientes seis grupos contiene aminoácidos que son sustituciones conservadoras de otros: 1) Alanina, Serina (S) , Treonina (T) ; 2) Acido Aspártico (D) , Acido Glutámico (E) ; 3) , Asparagina (N) , Glutamina (Q) ; 4) Arginina (R) , Lisina (K) ; 5) Isoleucina (I) , Leusina (L) , Metionina (M) , Valina (V) ; y 6) Fenilalanina (F) , Tirosina (Y) , Triptofan (W) (consultar también, Creighton (1984) Proteínas, W.H. Freeman and Company) . Las personas capacitadas en la técnica apreciaran que las sustituciones antes identificadas no son las únicas sustituciones conservadoras posibles. Por ejemplo, podríamos tomar en consideración todos los aminoácidos cargados como sustituciones conservadoras entre los mismos ya sean positivos o negativos. Además, las sustituciones individuales, eliminaciones o añadiduras que alteren, agreguen o eliminen un solo aminoácido o un pequeño porcentaje de aminoácidos en una secuencia codificada, también pueden considerarse como "variaciones modificadas de manera conservadora". También se puede realizar una "sustitución conservadora" en una proteína recombinante utilizando uno o mas codones que difieran de los codones empleados por el gene tipo silvestre o nativo. En este caso, una sustitución conservadora también incluye la sustitución de un codón para un aminoácido por un diferente codón para el mismo aminoácido.

Tal como se utiliza en la presente invención, "elementos de control" o "secuencias regulatorias" incluyen intensificadores, promotores, terminadores de transcripción, orígenes de duplicación, secuencias de integración cromosómicas, regiones no traducidas 5´y 3´, con las cuales las proteínas u otras biomoléculas interactúan para llevar a cabo la transcripción y traducción. Para las células eucarióticas, las secuencias de control incluirán un promotor y de preferencia un intensificador, por ejemplo, derivados de los genes de inmunoglobulina, SV40, citomegalovirus, y una secuencia de poliadenilación, y pueden incluir secuencias de donante de empalme y aceptadoras. Dependiendo del sistema del vector y el huésped utilizados, puede utilizarse cualquier numero de elementos adecuados de transcripción y traducción, incluyendo promotores constitutivos e inductibles.

Tal como se utiliza en la presente invención, un polinucleótido, oligonucleótido o ácido nucleico "derivado", se refieren a los oligo- y polinucleótidos que incluyen un sustituyente derivado. En algunas formas de realización, el sustituyente no interfiere de manera sustancial con respecto a la hibridación para los polinucleótidos complementarios. Los oligo-o polinucleótidos derivados que han sido modificados con sustituyentes químicos anexados (por ejemplo, mediante la modificación de un oligo-o poli-nucleótido ya sintetizado, o mediante la incorporación de una base modificada o un análogo de la columna vertebral durante la síntesis) pueden ser introducidos dentro de una célula eucariótica metabólicamente activa para generar híbridos con un DNA de hTRT, RNA, o una proteína donde produzcan una alteración y una modificación química al DNA, RNA, o proteína local. De manera alternativa, los oligo o polinuclétidos derivados pueden interactuar con y alterar los polipéptidos de hTRT, las proteínas asociadas con la telomerasa, y otros factores que interactúen con el DNA de hTRT o los productos del gene de la hTRT, o alterar o modular la expresión o función del DNA de hTRT, el ARN o la proteína. Los substituyentes químicos anexados ilustrativos incluyen: Texapirina de Europio (III) , agentes de enlace cruzado, psoralem, quelados metálicos (por ejemplo, hierro/quelado EDTA para la disociación catalizada de hierro) topoisomerasa, endonucleasas, exonucleasa, ligasas, fosfodiesterasas, porfirinas fotodinámicas, medicamentos quimioterapéuticos (por ejemplo, adriamiciano, doxirubicina) , agentes de intercalación, agentes de modificación de bases, cadenas de inmunoglobulina y oligonucleótidos. Los quelados de hierro/EDTA son substituyentes químicos utilizados con frecuencia cuando se desea llevar a cabo la disociación local de una secuencia de polinucleótido (Hertzberg y colaboradores, 1982, Boletín de la Sociedad Norteamericana de Química 104:313; hertzber y Dervan, 1984, Bioquímica 23: 3934; Taylor y colaboradores, 1984, Tetraedro 40: 457; Dervan, 1986, Ciencia 232: 464. Las químicas de enlace ilustrativas incluyen: enlace directo, por ejemplo, a través de un grupo de amino reactivo anexado (Corey y Schultz (1988) Ciencia 238:1401, que se incorpora a la presente invención por referencia) y otras químicas de enlace directo, a pesar de que también pueden utilizarse los métodos de enlace de anticuerpos de estreptavidina /biotina y digoxigenina/anti-digoxigenina. Los métodos para enlazar los substituyentes químicos se suministran en las patentes de los Estados Unidos 5, 135, 720, 5, 093, 245 y 5, 055, 556, que se incorporan a la presente invención por referencia. Pueden utilizarse otras químicas de enlace a juicio del practicante.

Tal como se utiliza en la presente invención, una "etiqueta detectable" tiene el significado ordinario en la técnica y se refiere a un átomo (por ejemplo, radionucleótidos) , moléculas, (por ejemplo, fluoresceína) , o complejo, que es o puede ser utilizado para detectar (por ejemplo, debido a una propiedad física o química) , indicar la presencia de una molécula o permitir el enlace de otra molécula a la cual esta unida de manera covalente o esta asociada de cualquier otra forma. El termino "etiqueta" también se refiere a las moléculas unidas de manera covalente o asociadas de cualquier otra forma (por ejemplo, una biomolécula como una enzima) que actúan sobre un substrato para producir un átomo, molécula o complejo detectable. Las etiquetas detectables adecuadas para utilizarse en la presente invención incluyen cualquier composición detectable mediante medios espectroscópicos, fotoquímicos, bioquímicos, inmunoquímicos, eléctricos, ópticos o químicos. Las etiquetas útiles en la presente invención incluyen la biotina para el manchado con el conjugado de estreptavidina etiquetado, cuentas magnéticas (por ejemplo, Dynabeads™) , tintes fluorescentes (por ejemplo, fluoresceína, rojo de Texas, rodamina, proteína fluorescente verde, proteína fluorescente verde aumentada, lisamina, ficoeritrina, Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, FluorX [Amersham], SyBR Verde I & II [Sondas moleculares], y similares) , radioetiquetas (por ejemplo, 3H, 125I, 35S, 14C, ó 32P) , enzimas (por ejemplo, hidrolasas, particularmente fosfatasas como la fosfatasa alcalina, esterasas y glucosidadas, u oxidoreductasas, en particular peroxidasas como por ejemplo la peroxidasa de rábano picante, y otras utilizadas comúnmente en ELISAs) , substratos, cofactores, inhibidores, grupos quimioluminiscentes, agentes cromogénicos, y etiquetas colorimétricas como por ejemplo las cuentas doradas coloidales o de cristal coloreado o plástico (por ejemplo, poliestireno, polipropileno, látex, etc.) . Las patentes que hablan sobre el uso de estas etiquetas incluyen las patentes de los Estados Unidos Números 3, 817, 837; 3, 850, 752; 3, 939, 350; 3, 996, 345; 4, 277, 437; 4, 275, 149 y 4, 366, 241. Los medios para detectar estas etiquetas son bastante conocidos para aquellas personas capacitadas en la técnica. De esta manera, por ejemplo, pueden detectarse las radioetiquetas y las etiquetas quimioluminiscentes utilizando una película fotográfica o contadores de centelleo, los marcadores fluorescentes pueden detectarse utilizando un fotodetector para detectar la luz emitida (por ejemplo, igual que en la clasificación de células activadas por fluorescencia) . Las etiquetas enzimáticas por lo general son detectadas suministrando a la enzima un substrato y detectando el producto de la reacción producido por la acción de la enzima sobre el substrato, y las etiquetas colorimétricas son detectadas visualizando simplemente la etiqueta de color. De esta manera, una etiqueta es cualquier composición detectable a través de medios espectroscópicos, fotoquímicos, bioquímicos, inmunoquímicos, eléctricos, ópticos o químicos. La etiqueta puede estar acoplada directa o indirectamente al componente deseado del ensayo de acuerdo con los métodos conocidos en la técnica. Las etiquetas no radioactivas con frecuencia se enlazan mediante medios indirectos. Por lo general, una molécula de ligando (por ejemplo, la biotina) está enlazada de manera covalente a la molécula. El ligando se enlaza posteriormente a una molécula de anti-ligando (por ejemplo, la estreptavidina) , que es ya sea detectable de manera inherente o está enlazada de manera covalente a un sistema de generación de señal, al igual que una enzima detectable, un compuesto fluorescente, o un compuesto quimioluminiscente. Puede utilizarse cierto número de ligandos y antiligandos. Cuando un ligando posee un antiligando natural, por ejemplo, la biotina, tiroxina y cortisol, este puede utilizarse junto con los antiligandos etiquetados, de ocurrencia natural. Alternativamente, cualquier compuesto hapténico o antihigiénico puede utilizarse en combinación con un anticuerpo. Las moléculas también pueden conjugarse directamente a los compuestos generadores de señales, por ejemplo, mediante la conjugación con una enzima o fluoroforo. Los medios para detectar etiquetas son bastante conocidos para aquellas personas capacitadas en la técnica. De esta manera, por ejemplo, cuando la etiqueta es una etiqueta radioactiva, los medios para la detección incluyen un contador de centelleo, una película fotográfica como en la autoradiografía, o una reproducción de imágenes de fósforo por almacenamiento. Cuando la etiqueta es una etiqueta fluorescente, esta puede detectarse excitando el fluorocromo con la longitud de onda adecuada de luz y detectando la fluorescencia resultante. La fluorescencia puede detectarse de manera visual, por medio de una película fotográfica, mediante el uso de detectores electrónicos como los dispositivos acoplados de carga (CCDs) o fotomultiplicadores y aparatos similares. De la misma forma, las etiquetas enzimáticas pueden detectarse proporcionando los substratos adecuados para la enzima y detectando el producto de reacción resultante. También, las etiquetas colorimétricas sencillas pueden detectarse observando el color asociado con la etiqueta. Podrá apreciarse que cuando se utilicen pares de fluoroforos en un ensayo, con frecuencia se prefiere que posean distintos patrones de emisión (longitudes de onda) de tal forma que puedan distinguirse fácilmente.

La frase "nivel elevado" se refiere a una cantidad de producto del gene de la hTRT (u otra substancia o actividad específica) en una célula que sea elevada o mayor al nivel en un estándar de referencia, por ejemplo, para el diagnóstico, el nivel en las células de telomerasa negativa normales en un individuo o en otros individuos que no sufran por la condición, y para el pronóstico, el nivel en las células del tumor a partir de una variedad de grados o clases de, por ejemplo, los tumores.

Tal como se utiliza en la presente invención, el término "epítopo" tiene su significado ordinario de un sitio en un antígeno reconocido por un anticuerpo. Los epítopos por lo general son segmentos de aminoácidos que son una pequeña porción de toda la proteína. Los epítopos pueden tener diferentes disposiciones (es decir, discontinuos) . Esto quiere decir, pueden estar formados a partir de aminoácidos codificados por partes no contiguas de una secuencia primaria que ha sido yuxtapuesta por el doblamiento de proteínas.

Los términos "prognosis favorable" y "prognosis desfavorable" son conocidos en la técnica. En el contexto de los cánceres, una "prognosis favorable" significa que existe la probabilidad de la regresión de un tumor o de tiempos de supervivencia mayores para los pacientes con una prognosis favorable en relación con aquellos que tienen una prognosis desfavorable, mientras que "prognosis desfavorable" significa que es probable que el tumor sea más agresivo, es decir, de un crecimiento más rápido o que se disemina por metástasis, lo que produce un resultado deficiente o un curso más rápido de la progresión de la enfermedad para el paciente.

Tal como se utiliza en la presente invención, el término "proteína de fusión", se refiere a una proteína compuesta, es decir, una secuencia de aminoácido contiguo sencilla, constituida por dos (o más) polipéptidos distintos y heterólogos que no están fusionados normalmente entre si en una sola secuencia del aminoácido. De esta manera, una proteína de fusión puede incluir una secuencia de aminoácido sencilla que contiene dos secuencias de aminoácido totalmente distintas o dos secuencias de polipéptido similares o idénticas, siempre y cuando estas secuencias no se encuentren normalmente juntas en la misma configuración en una secuencia de aminoácido sencilla encontrada en la naturaleza. Las proteínas de fusión por lo general pueden prepararse utilizando ya sean los métodos del ácido nucleico recombinante, es decir, como resultado de la transcripción y traducción de un producto de la fusión del gene recombinante, donde la fusión incluye un segmento que codifica un polipéptido característico de la invención y un segmento que codifica una proteína heteróloga, o a través de métodos de síntesis química conocidos en la técnica. Las regiones que no poseen hTRT de la proteína de fusión pueden fusionarse al término de amino del polipéptido de la hTRT o el término de carboxil, o a ambos, o la región que no posee hTRT puede insertarse dentro del interior de la secuencia de la proteína (insertando la mitad o reemplazando los aminoácidos) o pueden llevarse a cabo combinaciones de lo antes mencionado.

Tal como se utiliza en la presente invención, el término "producto del gene" se refiere a una molécula de ARN transcrita a partir de un gene, o una proteína codificada por el gene o traducida del RNA.

Tal como se utiliza en la presente invención, "hTR" (RNA de telomerasa humana) se refiere al componente del ARN de la telomerasa humana y cualquier alelo y variante de ocurrencia natural o variantes recombinantes. La hTR se describe con detalles en la patente de los Estados Unidos Núm. 5, 583, 016, que se incorpora a la presente por referencia en su totalidad para todos los propósitos.

Tal como se utiliza en la presente invención, el término "inmortal", cuando se refiere a una célula, tiene su significado normal en el campo de la telomerasa y se refiere a las células que poseen un potencial de duplicación aparentemente ilimitado. Inmortal también puede referirse a las células con una capacidad de proliferación creciente en relación con sus contrapartes no modificadas. Los Ejemplos de células humanas inmortales son las células tumorosas malignas, las células de la línea germinal, y ciertas líneas de células humanas transformadas cultivadas in vitro (por ejemplo, las células que se han convertido en inmortales después de la transformación por oncogenes virales o de otra forma) . En contraste, la mayoría de las células somáticas humanas normales son mortales, es decir, tienen un potencial de duplicación limitado y llegan a envejecer después de un número finito de divisiones celulares.

Tal como se utiliza en la presente invención, los términos "sustancia inmunógena" e "inmunogénico" tienen su significado ordinario en la técnica, es decir, una sustancia inmunógena es una molécula, como por ejemplo una proteína u otro antígeno, que puede producir una respuesta inmunológica de adaptación después de inyectarse a una persona o un animal.

Tal como se utiliza en la presente invención, "aislado", al referirse a una molécula o composición, como por ejemplo, una RNP (por ejemplo, por lo menos una proteína y por lo menos un RNA) , significa que la molécula o composición está separada de por lo menos uno de otros compuestos, como por ejemplo una proteína, otros RNAs, u otros contaminantes con los cuales está asociada in vivo o en su estado de ocurrencia natural. De esta manera, una RNP se considera aislada cuando la RNP ha sido aislada a partir de cualquier otro componente con el cual está naturalmente asociada, por ejemplo, la membrana celular, como en un extracto celular. Sin embargo, una composición aislada también puede ser substancialmente pura.

Tal como se utiliza en la presente invención, "modulador" se refiere a cualquier compuesto o composición sintética o natural que puede cambiar en cualquier forma cualquiera o tanto la "actividad completa" como cualquier "actividad parcial" de una transcriptasa inversa tipo telomerasa (TRT) . Un modular puede ser agonista o antagonista. Un modulador puede ser cualquier compuesto orgánico e inorgánico; incluyendo, pero sin limitarse a, por ejemplo, moléculas pequeñas, péptidos, proteínas, azúcares, ácidos nucleicos, ácidos grasos y similares.

Tal como se utiliza en la presente, "motivo" se refiere a una secuencia de aminoácidos contiguos (o a una secuencia del ácido nucleico que codifica una secuencia de aminoácidos contiguos) que define una característica o estructura en una proteína que es común a o que está conservada en todas las proteínas de la clase o tipo definidos. La secuencia del motivo o consenso puede incluir tanto residuos conservados como no conservados. Los residuos conservados en la secuencia del motivo indican que el residuo o clase conservada (es decir, hidrofóbica, polar, no polar, o cualquier otra clase) de residuos está por lo general presente en la ubicación indicada en cada proteína (o gene o mRNA) de la clase de proteínas definidas por el motivo. Los motivos pueden diferir de acuerdo con la clase de proteínas. De esta manera, por ejemplo, las enzimas de transcriptasa inversa forman una clase de proteínas que puede estar definida a través de uno o más motivos, y esta clase incluye a las enzimas de telomerasa. Sin embargo, las enzimas de telomerasa también pueden ser definidas como la clase de enzimas con motivos característicos para esta clase. Aquellas personas con capacidad en la técnica reconocen que la identificación de un residuo como residuo conservado en un motivo no significa que cada miembro de la clase definida por el motivo posee el residuo indicado (o clase de residuo) en la posición indicada, y que uno o más miembros de la clase pueden tener un residuo diferente en la posición observada.

Tal como se utiliza en la presente invención, los términos "ácido nucleico" y "polinucleótido" se utilizan de manera intercambiable. El uso del término "polinucleótido" no tiene el propósito de excluir a los oligonucleótidos (es decir, polinucleótidos cortos) y también puede referirse a los ácidos nucleicos sintéticos y/o que no tienen ocurrencia natural (es decir, incluyen los análogos del ácido nucleico y los residuos o enlaces modificados de la columna vertebral) .

Tal como se utiliza en la presente invención, los "oligonucleótidos" o los "oligómeros" se refieren a una secuencia de un ácido nucleico de aproximadamente 7 nucleótidos o más, y hasta por una cantidad de aproximadamente 100 nucleótidos, que puede utilizarse como iniciador, sonda o amplímero. Los oligonucleótidos con frecuencia tienen entre aproximadamente 10 y aproximadamente 50 nucleótidos de longitud, con más frecuencia entre aproximadamente 14 y aproximadamente 35 nucleótidos, de manera muy frecuente entre aproximadamente 15 y aproximadamente 25 nucleótidos, y los términos de oligonucleótidos u oligómeros también pueden referirse a ácidos nucleicos sintéticos y/o que no tienen ocurrencia natural (es decir, que incluyen análogos del ácido nucleico o residuos o enlaces modificados de la columna vertebral) .

Tal como se utiliza en la presente invención, el término "enlazado de manera operativa" se refiere a una relación funcional entre dos o más segmentos del ácido nucleico (por ejemplo, DNA) : Por ejemplo, un promotor o intensificador está enlazado de manera operativa a una secuencia de codificación si este estimula la transcripción de la secuencia en una célula huésped apropiada o cualquier otro sistema de expresión. Por lo general, las secuencias que están enlazadas de manera operativa son contiguas, y en el caso de una secuencia de señal ambas son contiguas y en fase de lectura. Sin embargo, los intensificadores no necesitan localizarse en una proximidad cercana a las secuencias de codificación cuya transcripción intensifican.

Tal como se utiliza en la presente invención, el término "polipéptido" se usa de manera intercambiable en la presente con el término "proteína", y se refiere a un polímero compuesto por residuos del aminoácido enlazados por enlaces de amida, incluyendo los análogos sintéticos, de ocurrencia natural y los que no tienen ocurrencia natural de los mismos (aminoácidos y enlaces) . Los péptidos son Ejemplos de polipéptidos.

Tal como se utiliza en la presente invención, una "sonda" se refiere a una molécula que enlaza específicamente a otra molécula. Un Ejemplo de una sonda es una "sonda de ácido nucleico" que se enlaza específicamente (es decir, se anodiza o se hibrida) a un ácido nucleico complementario sustancialmente. Otro Ejemplo de una sonda es una "sonda de anticuerpo" que se enlaza específicamente a un antígeno o epítopo correspondiente.

Tal como se utiliza en la presente invención, "recombinante" se refiere a un polinucleótido sintetizado o manipulado de alguna otra forma in vitro (por ejemplo, un "polinucleótido recombinante") , a los métodos de utilización de los polinucleótidos recombinantes para producir productos del gene en las células y otros sistemas biológicos, o a un polipéptido ("proteína recombinante") codificado por un polinucleótido recombinante.

Tal como se utiliza en la presente invención, un "sistema de selección" en el contexto de líneas celulares transformadas de manera estable, se refiere a un método para identificar y/o seleccionar las células que contienen un ácido nucleico recombinante de interés. Se conoce una gran variedad de sistemas de selección para la identificación de células transformadas y son adecuadas para utilizarse con la presente invención. Por ejemplo, las células transformadas por plásmidos u otros vectores pueden seleccionarse a través de la resistencia a los antibióticos conferida por genes contenidos en los plásmidos, como los genes bastante conocidos de amt, gpt, neo e hig u otros genes como por ejemplo la cinasa de quimidina del virus de herpes simplex (Wigler y colaboradores, Célula 11:223-32[1997]) y los genes de fosforibosiltransferasa de adenina (Lowy y colaboradores, Célula 22:817[1980]) que pueden emplearse en las células tk- o aprt-, respectivamente. También, puede utilizarse el antimetabolito, antibiótico o la resistencia a herbicidas como base para la selección; por ejemplo, la dhfr que ofrece resistencia al metotrexato y también es útil para la amplificación de genes (Wigler y colaboradores, Procedimiento Científico de la Academia Nacional, 77:3567 [1980]) ; npt, que confiere resistencia a la neomicina de aminoglucócidos y G-418 (Colbere-Garapin y colaboradores, Boletín de Biología Molecular, 150:1 [1981]) y als o pat, que confieren resistencia al clorsulfurón y la acetiltransferasa de fosfinotricina, respectivamente (Murr y , en el Anuario de Ciencia y Tecnología de McGraw Hill, McGraw Hill Nueva York, NY, pp 191-196, [1992]) . Se han descrito genes seleccionables adicionales, por ejemplo, los genes que confieren resistencia a la higromicina, trpB, que permite a las células utilizar índole en lugar de triptófano, o hisD, que permite a las células utilizar histinol en lugar de utilizar histidina (Hartman y Mulligan, Procedimientos Científicos de la Academia Nacional, 85:8047 [1998]) . Recientemente, el uso de marcadores visibles ha ganado la popularidad con los marcadores como las antocianinas, betaglucuronidasa y su substrato, GUS, y luciferasa y su substrato, luciferina, que se emplean ampliamente no solo para identificar transformantes, sino también para cuantificar la cantidad de expresión de la proteína transitoria o estable atribuible a un sistema de vector específico (Rhodes y colaboradores Metodología de Biología Molecular, 55:121 [1995]) .

Tal como se utiliza en la presente invención, la "secuencia" de un gene (a menos que se indique específicamente otra cosa) , ácido nucleico, proteína, o péptido se refiere al orden de los nucleótidos en cualquiera o ambos filamentos de una molécula de DNA de doble filamento, por ejemplo, la secuencia de tanto el filamento de codificación como su complemento, de una molécula de ácido nucleico de un solo filamento, o para el orden de los aminoácidos en un péptido o proteína.

Tal como se utiliza en la presente invención, "enlace específico" se refiere a la capacidad de una molécula, por lo general un anticuerpo o un polinucleótido de ponerse en contacto y asociarse con otra molécula específica, incluso en la presencia de muchas otras moléculas diversas. Por ejemplo, un polinucleótido de un solo filamento puede enlazarse específicamente a un polinucleótido de un solo filamento que sea complementario en la secuencia, y un anticuerpo se enlaza específicamente a (o "es específicamente inmunoreactivo con") su antígeno correspondiente.

Tal como se utiliza en la presente invención, "condiciones de hibridación severa" o "severidad" se refiere a las condiciones en un rango de aproximadamente 5ºC a aproximadamente 20ºC o 25ºC por debajo de la temperatura de fusión (Tm) de la secuencia objetivo y una sonda con una complementariedad exacta o casi exacta al objetivo. Tal como se utiliza en la presente invención, la temperatura de fusión es la temperatura a la cual una población de moléculas de ácido nucleico de doble filamento se disocian a la mitad en filamentos sencillos. Los métodos para calcular la Tm de los ácidos nucleicos son bastante conocidos en la técnica (consultar, por ejemplo, Berger y Kimmel (1987) MÉTODOS DE ENZIMOLOGÍA, VOLUMEN 152: GUÍA PARA LAS TÉCNICAS DE CLONACIÓN MOLECULAR, San Diego: Academic Press, Inc. y Sambrook y colaboradores (1989) CLONACIÓN MOLECULAR:UN MANUAL DE LABORATORIO, SEGUNDA EDICIÓN, VOLÚMENES 1-3, Laboratorio de Cold Spring Harbor en lo sucesivo, "Sambrook") , ambos incorporados en la presente por referencia) . Tal como se indica por las preferencias estándares, un cálculo sencillo del valor de la Tm puede calcularse por medio de la ecuación: Tm = 81.5 + 0.41 (G + C) , cuando un ácido nucleico se encuentra en solución acuosa a 1 M de NaCl (consultar, por ejemplo, Anderson y Young, Hibridación de Filtro Cuantitativa en HIBRIDACIÓN DEL ACIDO NUCLEICO (1985) ) . Otras referencias incluyen cálculos más sofisticados que toman en cuenta las características estructurales así como las características de la secuencia para el cálculo de la Tm. La temperatura de fusión de un híbrido (y por lo tanto las condiciones de la hibridación severa) es afectada por diferentes factores como por ejemplo la longitud y naturaleza (DNA, RNA, composición base) e la sonda y la naturaleza del objetivo (DNA, RNA, composición base, presente en la solución o inmovilizado, y similares) , y la concentración de sales y otros componentes (por ejemplo, la presencia o ausencia de fornamida, sulfato de dextrán, polietilenglicol) . Los efectos de estos factores son bastante conocidos y se discuten en referencias estándares en la técnica, por ejemplo, en Sambrook, mencionado anteriormente y Ausubel y colaboradores, mencionado anteriormente. Por lo general, las condiciones de hibridación severa son concentraciones de sal menores a aproximadamente 1.0 M de ion de sodio, por lo general aproximadamente de 0.01 a 1.0 M de ion de sodio a un pH de 7.0 a 8.3, y temperaturas de por lo menos aproximadamente 30ºC para sondas cortas (por ejemplo, de 10 a 50 nucleótidos) y por lo menos aproximadamente 60ºC para sondas largas (por ejemplo, mayores a 50 nucleótidos) . Tal como se indicó, las condiciones severas también pueden lograrse mediante la añadidura de agentes de desestabilización como la formamida, en cuyo caso pueden emplearse temperaturas menores.

Tal como se utiliza en la presente invención, el término "identidad sustancial", "identidad de secuencia sustancial" o "similaridad sustancial" en el contexto de los ácidos nucleicos, se refiere a una medida de similaridad de la secuencia entre dos polinucleótidos. La identidad de secuencia sustancial puede determinarse mediante hibridación bajo condiciones severas, mediante comparación directa, u otros medios. Por ejemplo, dos polinucleótidos pueden identificarse como poseedores de una identidad de secuencia sustancial si son capaces de generar híbridos específicamente entre sí bajo condiciones de hibridación severa. Otros grados de identidad de la secuencia (por ejemplo, menor a la "sustancial") pueden caracterizarse mediante hibridación bajo diferentes condiciones de severidad. De manera alternativa, la identidad de secuencia sustancial puede describirse como una identidad del porcentaje entre dos secuencias de nucleótidos (o polipéptido) . Dos secuencias se consideran sustancialmente idénticas cuando son por lo menos aproximadamente 60% idénticas, de preferencia por lo menos de aproximadamente 70% idénticas, o por lo menos aproximadamente 80% idénticas, o por lo menos aproximadamente 90% idénticas, o por lo menos aproximadamente 95% o 98% a 100% idénticas. La identidad de la secuencia de porcentaje (nucleótido o aminoácido) se calcula por lo general determinando la alineación óptima entre dos secuencias y comparando las dos secuencias. Por ejemplo, una transcripción exógena utilizada para la expresión de proteína puede describirse como poseedora de cierto porcentaje de identidad o similaridad en comparación con una secuencia de referencia (por ejemplo, la secuencia endógena correspondiente) . La alineación óptima de las secuencias puede llevarse a cabo utilizando el algoritmo de homología local de Smith y Waterman (1981) Matemáticas Aplicadas Avanzadas, 2:482, a través del algoritmo de alineación de homología de Needleman y Wunsch (1970) Boletín de Biología Molecular 48:443, mediante la investigación de un método similar de Pearson y Lipman (1988) Procedimiento Científico de la Academia Nacional, EUA 85:2444, mediante implementaciones computarizadas de estos algoritmos (GAP, BESTFIT, FASTA y TFASTA en el Paquete de Software de Genética de Wisconsin, Genetics Computer Group, 575 Science Dr., Madison, WI) , o mediante inspección. Se selecciona la mejor alineación (es decir, la que da como resultado el porcentaje más alto de identidad) generada por los diferentes métodos. Por lo general, estos algoritmos comparan las dos secuencias sobre una "ventana de comparación" (por lo general cuando menos 18 nucleótidos de longitud) para identificar y comparar regiones locales de la similaridad de secuencia, permitiendo de esta manera añadiduras o eliminaciones pequeñas, (es decir, abertura) . Las añadiduras y eliminaciones son por lo general el 20% o menos de la longitud de la secuencia en relación con la secuencia de referencia, que no incluye añadiduras ni eliminaciones. Algunas veces es deseable describir la identidad de la secuencia entre dos secuencias con referencia a una longitud o región en particular (por ejemplo, dos secuencias pueden describirse como poseedoras de por lo menos 95% de identidad sobre una longitud de por lo menos 500 pares de base) . Por lo general, la longitud será de por lo menos aproximadamente 50, 100, 200, 300, 400 ó 500 pares base, aminoácidos u otros residuos. El porcentaje de la identidad de secuencia se calcula comparando dos secuencias alineadas de manera óptima sobre la región de comparación, determinando el número de posiciones en las cuales se presenta la base del ácido nucleico idéntico (por ejemplo, A, T, C, G ó U) en ambas secuencias para producir el número de posiciones acopladas, y determinando el número (o porcentaje) de las posiciones acopladas en comparación con el número total de bases en la secuencia de referencia o la región de comparación. Un algoritmo adicional que es adecuado para determinar la similaridad de la secuencia es el algoritmo BLAST, que se describe en Altschul (1990) Boletín de Biología Molecular 215:403-410, y Shpaer (1996) Genómica 38:179-191. El software para llevar a cabo los análisis de BLAST está disponible públicamente en el Centro Nacional de Información Sobre Biotecnología (http://www.ncbi.nlm.nih.gov/) . Este algoritmo implica primero la identificación de pares de secuencia de una alta clasificación (HSPs) identificando palabras pequeñas de longitud W en la secuencia de consulta que ya sea se acoplen o satisfagan cierta puntuación T del umbral con valor positivo al alinearse con una palabra de la misma longitud en una secuencia de la base de datos. La T se refiere al umbral de clasificación de palabras de los alrededores (Altschul y colaboradores, mencionado anteriormente) . Estos golpes de palabras iniciales en los alrededores actúan como semillas para iniciar las investigaciones con el fin de encontrar HSPs mayores que las contengan. Los golpes de palabra se extienden en ambas direcciones a lo largo de cada secuencia hasta donde pueda incrementarse la calificación de la alineación acumulativa. La extensión de los golpes de palabra en cada dirección se detienen cuando: la calificación de la alineación acumulativa cae por debajo de la cantidad X a partir de su valor máximo logrado; la calificación acumulativa llega a cero o menos, debido a la acumulación de una

o más alineaciones de residuos con calificación negativa, o cuando se alcanza el final de cualquier secuencia. Los parámetros W, T y X del algoritmo BLAST determinan la sensibilidad y velocidad de la alineación. El programa BLAST utiliza como valores implícitos una longitud de palabra W de 11, la matriz de calificación BLOSUM62 (consultar Henikoff (1992) Procedimiento Científico de la Academia Nacional EUA 89: 1095-10919) alineaciones (B) de 50, expectativa (E) de 10, M=5, N=-4, y una comparación de ambos filamentos. El término BLAST se refiere al algoritmo BLAST que lleva a cabo un análisis estadístico de la similaridad entre dos secuencias; consultar por ejemplo, Karlin (1993) Procedimiento Científico de la Academia Nacional EUA 90:5873-5787. Una medida de similaridad proporcionada por el algoritmo BLAST es la probabilidad de suma más pequeña (P (N) ) , que ofrece una indicación de la probabilidad mediante la cual podría ocurrir un acoplamiento entre dos secuencias de un nucleótido

o un aminoácido por casualidad. Por ejemplo, un ácido nucleico puede ser considerado como similar a un ácido nucleico de TRT si la probabilidad de suma más pequeña en una comparación del ácido nucleico de prueba con un ácido nucleico de TRT es menor a aproximadamente 0.5, 0.2, 0.1, 0.01 ó 0.001. De manera alternativa, otro indicio de que las dos secuencias del ácido nucleico son similares es que el polipéptido que codifica el primer ácido nucleico es inmunológicamente reactivo de manera cruzada con el polipéptido codificado por el segundo ácido nucleico.

Tal como se indica en la presente invención, los términos "identidad substancial", "identidad de secuencia sustancial"

o "similaridad substancial" en el contexto de un polipéptido, se refiere a un grado de similaridad entre dos polipéptidos en donde un polipéptido incluye una secuencia con por lo menos 70% de identidad de la secuencia con una secuencia de referencia, u 80% u 85% o hasta un 100% de identidad de la secuencia con la secuencia de referencia, o de manera más preferente, 90% de identidad sobre una ventana de comparación de aproximadamente 10-20 residuos de aminoácidos. La similaridad de secuencia del aminoácido, o la identidad de la secuencia, se determina optimizando las concordancias de los residuos, si es necesario, mediante la introducción de aberturas según se requiera. Consultar Needleham y colaboradores (1970) Boletín de Biología Molecular, 48:443-453; y Sankoff y colaboradores, 1983, Desviaciones de Tiempo, Ediciones de Fibras y Macromoléculas, La Teoría y Práctica de la Comparación de Secuencias, Capítulo Uno, Addison-Wesley, Reading, MA; y los paquetes de software de IntelliGenetics, Mountain View, CA, y el Grupo de Computación Genética de la Universidad de Wisconsin, Madison, WI. Tal como se hará aparente para aquellas personas capacitadas en la técnica, los términos "identidad substancial", "similaridad substancial" y "identidad de secuencia substancial" pueden utilizarse de manera intercambiable con respecto a los polipéptido o polinucleótidos.

Tal como se utiliza en la presente invención, el término "substancialmente puro" o "substancialmente purificado", al referirse a una composición que incluye un reactivo específico, como por ejemplo un anticuerpo (por ejemplo, un anticuerpo anti-hTRT) , significa que el reactivo especificado es por lo menos aproximadamente de 75%, o por los menos de aproximadamente 90%, o por lo menos de aproximadamente 95%, o por lo menos de aproximadamente 99%, o más de la composición (sin incluir, por ejemplo, el solvente o amortiguador) . De esta manera, por ejemplo, se purifica substancialmente una preparación preferida de inmunoglobulina de la invención que enlaza específicamente un polipéptido de hTRT.

Tal como se utiliza en la presente invención, una célula de "telomerasa negativa" es aquella en donde no se expresa la telomerasa, es decir, no puede detectarse la actividad catalítica de la telomerasa utilizando un ensayo convencional o un ensayo TRAP para la actividad catalítica de la telomerasa. Tal como se utiliza en la presente invención, una célula con "telomerasa positiva" se una célula en la cual se expresa la telomerasa (es decir, donde puede detectarse la actividad de la telomerasa) .

Tal como se utiliza en la presente invención, una enfermedad o condición "relacionada con la telomerasa" es una enfermedad o condición en un sujeto que está correlacionado con un nivel anormalmente alto de actividad de la telomerasa en las células del individuo, que puede incluir cualquier actividad de la telomerasa para la mayoría de las células somáticas normales, o que se correlaciona con un nivel bajo de actividad de la telomerasa que da como resultado un deterioro en la función celular normal. Los ejemplos de condiciones relacionadas con la telomerasa incluyen, por ejemplo, el cáncer (actividad de telomerasa alta en las células malignas) y la infertilidad (actividad de la telomerasa baja en las células de la línea germinal) .

Tal como se utiliza en la presente invención, "compuesto de prueba" o "agente" se refiere a cualquier compuesto o composición sintética o natural. El término incluye todos los compuestos orgánicos e inorgánicos; incluyendo, por ejemplo, moléculas pequeñas, péptidos, proteínas, azúcares, ácidos nucleicos, ácidos grasos y similares.

XIII. EJEMPLOS

Los siguientes Ejemplos se proporcionan para ilustrar la presente invención, y no en forma de limitación.

En las siguientes secciones, se aplicarán las siguientes abreviaturas: eq (equivalentes) ; M (Molar) ; 1M (micromolar) ; N (Normal) ; mol (moles) ; mmol (milimoles) ; 1mol (micromoles) ; nmol (nanomoles) ; g (gramos) ; mg (miligramos) ; 1g (microgramos) ; ng (nanogramos) ; l ó L (litros) ; ml (mililitros) ; 1l (microlitros) ; cm (centímetros) ; mm (milímetros) ; 1m (micrómetros) ; nm (nanómetros) ; ºC (grados centígrados) ; RPN (ribonucleoproteína) ; mreN (2'-Ometilribonucleótidos) ; dNTP (desoxiribonucleótido) ; dH2O (agua destilada) ; DDT (ditiotreitol) ; PMSF (fluoro de metilfenilsulfonilo) ; TE (10 mM de Tris HCl, 1 mM de EDTA, aproximadamente con un pH de 7.2) ; KGlu (glutanato de potasio) ; SSC (amortiguador de citrato de sodio y sal) ; SDS (sulfato de dodecil sódico) ; PAGE (electrofóresis de gel de poliacrilamida) ; Novex (Novex, San Diego, CA) ; Bio Rad (Bio-Rad Laboratories, Hercules, CA) ; Pharmacia (Pharmacia Biotech, Piscataway, NJ) ; Boehringer-Mannheim (Boehringer-Mannheim Corp, Concord, CA) ; Amersham (Amersham, Inc., Chicago, IL) ; Stratagene (Stratagene Cloning Systems, La Jolla, CA) ; NEB (New England Biolabs, Beverly, MA) ; Pierce (Pierce Chemical Co., Rockford, IL) ; Beckman (Beckman Instruments, Fullerto, CA) ; Lab Industies (Lab Industries, Inc., Berkeley, CA) ; Eppendorf (Eppendorf Scientific, Madison, WI) ; y Molecular Dynamics (Molecular Dynamics, Sunnvale, CA) .

Ejemplo 1

AISLAMIENTO DE PROTEÍNAS Y CLONES DE TELOMERASA

El siguiente Ejemplo detalla el aislamiento de las proteínas y clones de telomerasa a partir de diversos organismos, incluyendo el euplotes p. 123, hTRT, TRT y los clones del cDNA de telomerasa de TRT de S. pombe.

A. Antecedentes i) Introducción Esta sección proporciona un panorama de la purificación y clonación de los genes de TRT, que se describe con más detalle en las secciones posteriores de este Ejemplo. A pesar de que las subunidades de ARN de la telomerasa han sido identificadas en los ciliados, la levadura y los mamíferos, las subunidades de proteína de la enzima no han sido identificadas como tales antes de la presente invención. La purificación de la telomerasa a partir del protozoario ciliado Euplotes aediculatus produjo dos proteínas, nombradas como 123 y p43 (consultar posteriormente; Lingner (1996) Procedimiento Científico de la Academia Nacional E.U.A. 93:10712) . El Euplotes aediculatus es un ciliado hipotricoide que posee un macronúcleo que contiene aproximadamente 8 x 107 telómeros y aproximadamente 3 x 105 moléculas de telomerasa. Después de la purificación, el complejo de la telomerasa activa tenía una masa molecular de aproximadamente 230 kD, correspondiente a una subunidad de ARN de 66 kD y dos proteínas de aproximadamente 123 kD y 43 kD (Lingner (1996) mencionado anteriormente) . Los experimentos de enlace fotocruzado indicaron que la proteína p123 más grande estaba implicada en el enlace específico del substrato del DNA telomérico (Lingner, (1996) mencionado anteriormente) .

Las proteínas p123 y p43 fueron secuenciadas y se aislaron los clones del cDNA que codificaban estas proteínas. Se descubrieron que estas secuencias de Euplotes no estaban relacionadas con las proteínas p80 y p95 asociadas con la telomerasa de Tetrahymena. El análisis de la secuencia del Euplotes p123 reveló motivos de trascriptasa inversa (RT) . Además, el análisis de secuencia del Euplotes p123 mediante la comparación con otras secuencias reveló un homólogo de la levadura, conocido como proteína Est2 (Lingner (1997) Ciencia 276:561) . La Est2 de la levadura había comprobado ser anteriormente esencial para el mantenimiento del telómero in vivo (Lendvay (1996) Genética 144:1399) pero no había sido identificada como una proteína catalítica de la telomerasa. La mutagénesis específica en el sitio demostró que los motivos de RT de la Est2 de la levadura son esenciales para la síntesis del DNA telomérico in vivo y in vitro (Lingner (1997) mencionado anteriormente) .

ii) Identificación y Caracterización de la Telomerasa de S. pombe Se llevó a cabo la amplificación mediante PCR del DNA del S. pombe con los iniciadores de secuencia degenerados diseñados a partir de los motivos de RT de la p123 de la Euplotes tal como se describe posteriormente. De los cuatro productos de la PCR prominentes generados, una banda del par base 120 codificó una secuencia del péptido homóloga con p123 y Est2. Este producto de la PCR fue utilizado como sonda en la hibridación de la colonia e identificó dos clones superpuestos a partir de una biblioteca genómica del S. pombe y tres de una biblioteca del cDNA del S. pombe. El análisis de la secuencia reveló que ninguno de los tres clones de cDNA del S. pombe es de longitud completa, de tal forma que se utilizó la RT-PCR para obtener estas secuencias que codifican el término N de la proteína.

La secuenciación completa de estos clones reveló un gene de la RT de telomerasa del S. pombe putativo, trt1. La secuencia del nucleótico completa de trt1 ha sido depositada en elk GenBank, número de acceso AF015783 (consultar Figura 15) .

Para probar el trt1 del S. pombe (como una subunidad catalítica) se crearon dos construcciones de eliminación. El análisis de la secuencia mostró que el trt1 codifica una proteína básica con una masa molecular prevista de 116 kD. Se descubrió que la homología con la p123 y Est2 era especialmente alta en siete motivos de transcriptasa inversa, subrayados y designados como motivos 1, 2, A, B, C, D y E (consultar Figura 63) . Un motivo específico de la telomerasa adicional, designado como motivo T, también fue descubierto. Quince intrones, que variaban en tamaño de 36 a 71 pares base, interrumpían la secuencia de codificación.

Para someter a prueba el trt1 del S. pombe como subunidad catalítica, se crearon dos construcciones de eliminación. Una eliminaba únicamente los motivos de B al D en los dominios de RT. El segundo eliminaba el 99% de la configuración de lectura abierta.

Las células haploides desarrolladas a partir de las esporas del S. pombe de ambos mutantes mostraron un acortamiento progresivo del telómero al punto en que la hibridación hacia las repeticiones teloméricas se hizo casi indetectable. Un diploide trt1*/trt1- fue esporulado y los tétrades resultantes fueron disecados y germinados sobre un medio de extracto de levadura suplementado con aminoácidos (una placa YES, Alfa (1993) Experimentos con Levadura de Fisión, Cold Spring Harbor Laborator y Press, Cold Spring Harbor, NY) . Las colonias derivadas a partir de cada espora se desarrollaron a 32°C durante tres días, y fueron marcadas sucesivamente hacia placas YES frescas cada tres días. Una colonia de cada ronda fue colocada en seis ml del cultivo del líquido YES a 32°C y se desarrollaron hasta la fase estacionaria. Se preparó el DNA genómico. Después de la digestión con ApaI, DNA fue sometido a electrofóresis sobre un gel de agarosa al 2.3%, fue teñido con bromuro de etilio para confirmar una carga aproximadamente equivalente en cada vía, posteriormente fue transferido a una membrana de nylon y fue hibridado a una sonda del DNA telomérico.

El envejecimiento fue indicado por el inicio retrasado del desarrollo o la falla en el desarrollo sobre ágar (por lo general en la cuarta marcación después de la germinación) y por colonias con bordes cada vez más gastados (la morfología de la colonia se muestra en la Figura 22C) y por fracciones cada vez más altas de células alargadas (como se muestra en la Figura 22D) . Las células fueron anodizadas en un Medio Mínimo (Alfa (1993) mencionado anteriormente) con ácido glutámico substituido por cloruro de amonio durante dos días a 32°C antes de la fotografía.

Cuando se separaron las células alargadas individuales sobre el microscopio de disección, se descubrió que la mayoría no llevó a cabo divisiones adicionales. La misma población celular de telomerasa negativa (trt1-) siempre contenía células de tamaño normal que continuaban dividiéndose, pero que con frecuencia producían progenies no dividida. Los supervivientes de telomerasa negativa pueden utilizar un modo de recombinación del mantenimiento del telómero tal como se ha documentado en los injertos de cepas de levadura que poseen diferentes genes de duplicación de telomero eliminados (Lendvay (1996) mencionado anteriormente, Lundblad (1993) Célula 73:347) .

iii) Identificación y Caracterización de la Telomerasa Humana Una EST (etiqueta de secuencia expresada) derivada del cDNA de la transcriptasa inversa tipo telomerasa humana (hTRT) fue identificada por medio de una investigación de BLAST de la base de datos del Genbank de la dbEST (etiqueta de secuencia expresada) utilizando el péptido de 123 kDa de Euplotes y las secuencias del ácido nucleico, así como la proteína de Schizosaccharomyces y las secuencias correspondientes del cDNA (tezl1) . La EST, designada por Genbank como AA28196, tiene 398 neucleótidos de largo y corresponde a las posiciones 1679 a la 2076 del clon 712562 (Figura 18) , y fue obtenida del I.M.A.G.E. Consortium (Human Genome Center, DOE, Lawrence Livermore National Laborator y , Livermore, CA) . Este clon fue obtenido a partir de una biblioteca del cDNA de las células B germinales derivadas mediante clasificación de flujo de las células de las amígdalas. La secuenciación completa de este clon del cDNA de la hTRT mostró los ocho motivos de la RT de telomerasa (TRT) . Sin embargo, este clon de la hTRT no codificó una porción contigua de una TRT porque los motivos de RT B', C, D y E estaban incluidos en una configuración de lectura abierta diferente a la mayoría de los motivos de RT de la terminal N. Además, la distancia entre los motivos A y B de la RT era sustancialmente menor que en las tres TRTs (no humana) conocidas anteriormente.

Para aislar un clon de cDNA de longitud completa, se clasificó una biblioteca del cDNA derivada de la línea celular 293 humana (descrita anteriormente) que expresa niveles altos de actividad de la telomerasa. Una biblioteca del cDNA lambda de la línea celular 293 fue dividida en 25 agrupaciones que contenían aproximadamente 200, 000 placas cada una. Cada agrupación fue clasificada mediante PCR con el par del iniciador 5'-CGGAAGAGTGTCTCTGGAGCAA-3' y 5'-GGATGAAGCGGAGTCTGGA-3'. Posteriormente se clasificaron seis subagrupaciones de una agrupación primaria positiva mediante PCR utilizando este mismo par del iniciador. Tanto para la clasificación primaria como secundaria de la subagrupación, la hTRT se amplificó para un total de 31 ciclos a: 94°C; 45 segundos; 60°C, 45 segundos; y 72°C, 90 segundos. Como control, el ARN de la enzima guardada internamente GAPDH fue amplificado utilizando el par del iniciador 5'-CTCAGACACCATGGGGAAGGTGA-3' y 5'-ATGATCTTGAGGCTGTTGTCATA-3' para un total de 16 ciclos a 94°C, 45 segundos; 55°C, 45 segundos; y 72°C, 90 segundos.

Posteriormente se clasificó una subagrupación positiva de la hTRT a partir de la clasificación secundaria, mediante la hibridación de placas con una sonda de la región de 5' del clon #712562. Se identificó positivamente un fago (designado como fago 25-1.1 Lambda, ATCC 209024, depositado el 12 de mayo de 1997) . Contenía un inserto de aproximadamente cuatro kilobases, que fue extirpado y subclonado dentro del sitio EcoRI del vector pBluescript II SK+ (Stratagene, San Diego, CA) como un fragmento del EcoRI. Este plásmido que contenía el clon del cDNA fue designado como pGRN121. El inserto del cDNA totaliza aproximadamente 4 pares de kilobase. La secuencia del neucleótido completa del cDNA de la hTRT humana (pGRN121) ha sido depositada en el Genbank (admisión AF015950) y el plásmido ha sido depositado ante la ATCC (ATCC 209016, depositado el 6 de mayo de 1997) .

B. Desarrollo del Euplotes aeduculatus En este Ejemplo, se obtuvieron cultivos de E. aediculatus del Dr. David Prescott, MCDB, Universidad de Colorado. El Dr. Prescott aisló originalmente este cultivo a partir de agua de estanque, a pesar de que este organismo también está disponible en la ATCC (ATCC #30859) . Los cultivos fueron desarrollados tal como se describe por Swanton y colaboradores, (Swanton y colaboradores, cromosomas 77:203 [1980]) , bajo condiciones no estériles, en recipientes de vidrio de 15 litros que contenían Chlorogonium como fuente de alimentación. Los organismos fueron cosechados a partir de cultivos cuando la densidad llegó a aproximadamente 104 células/ml.

C. Preparación de Extractos Nucleares En este Ejemplo, se prepararon extractos nucleares de E. aediculatus utilizando el método de Lingner y colaboradores, (Lingner y colaboradores, Desarrollo de Genes, 8:1984 [1994]) , con modificaciones menores, tal como se indica posteriormente. Brevemente, las células desarrolladas tal como se describió en la Parte B se concentraron con 15 1m de filtros Nytex y se enfriaron en hielo. La píldora de la célula se volvió a suspender en un volumen final de 110 ml de amortiguador de TMS/PMSF/fosfato de espermidina. El amortiguador de TMS/PMSF/ fosfato de espermidina en existencia fue preparado agregando 0.075 g de fosfato de espermidina (USB) y 0.75 ml de PMSF (a partir de una solución en existencia de 100 mM preparada en etanol) a 150 ml de TMS. El TMS incluía 10 mM de Tris-acetato, 10 mM de MGCl2, 85.5752 g de sacarosa/litro y 0.33297 g de CaCl2/litro, pH 7.5.

Después de la resuspensión en el amortiguador TMS/PMSF/fosfato de espermidina, se agregaron 8.8 ml de NP-40 al 10% y 94.1 g de sacarosa y la mezcla se colocó en un vaso de precipitados de vidrio siliconizado con una varilla de agitación de acero inoxidable unida a un motor elevado. La mezcla se agitó hasta que las células estuvieron completamente lisadas (aproximadamente 20 minutos) . La mezcla se centrifugó posteriormente durante 10 minutos a 7500 rpm (8950 x g) , a 4°C, utilizando un rotor de deslizamiento JS-13. El sobrenadante fue eliminado y la píldora del núcleo se suspendió nuevamente en amortiguador de TMS/PMSF/fosfato de espermidina, y se centrifugó otra vez, durante 5 minutos a 7500 rpm (8950 x g) , a 4°C, utilizando un rotor de deslizamiento JS-13 de Beckman.

El supernadante fue eliminado y la píldora del núcleo se volvió a suspender en un amortiguador que incluía 50 mM de Tris-acetato, 10 mM de MGCl2, 10% de glicerol, 0.1% de NP-40, 0.4 M de KGlu, 0.5 mM de PMSF, pH 7.5, a un volumen de 0.5 ml del amortiguador por 10 g de las células cosechadas. El núcleo resuspendido fue colocado posteriormente en un homogeneizador de vidrio con aproximadamente 50 carreras, y después se centrifugó durante 25 minutos a 14, 000 rpm a 4°C, en una centrífuga Eppendorf. Se recolectó el supernadante que contenía el extracto nuclear, se congeló en nitrógeno líquido y se almacenó a -80°C hasta su uso.

D. Purificación de la Telomerasa En este Ejemplo, se utilizaron extractos nucleares preparados como se describió en la Parte C para purificar la telomerasa del E. aediculatus. En este protocolo de purificación, primero se enriqueció la telomerasa mediante una cromatografía sobre una columna de Afi-Gel-heparina, y posteriormente se purificó de manera extensiva mediante purificación por afinidad con un oligoneucleótido. Como la región del molde del ARN de la telomerasa es accesible a la hibridación en la partícula de RNP de la telomerasa, se sintetizó un oligoneucleótido (es decir, el "oligoneucleótido de afinidad") que era complementario a esta región del molde como una cRNAada de afinidad para la telomerasa. Se incluyó un residuo de biotina en la terminación de 5' del oligoneucleótido para inmovilizarlo a una columna de adivina.

Después del enlace de la telomerasa al oligoneucleótido, y de un lavado extenso, la telomerasa se eluyó mediante el uso de un oligoneucleótido de desplazamiento. El oligoneucleótido de afinidad incluía bases del DNA que no eran complementarias para la 5' del ARN de la telomerasa en la secuencia específica de la telomerasa. Como el oligoneucleótido de desplazamiento era complementario al oligoneucleótido de afinidad en toda su longitud, éste era capaz de formar una duplicación más estable termodinámicamente que el enlace de la telomerasa al oligoneucleótido de afinidad. De esta manera, la añadidura del oligoneucleótido de desplazamiento dio como resultado la elución de la telomerasa a partir de la columna.

Los extractos nucleares preparados a partir de cultivos de 45 litros se congelaron hasta que se recolectó un total de 34 ml de extracto nuclear. Esto correspondía a 630 litros de cultivo (es decir, aproximadamente 4 x 109 células) . El extracto nuclear se diluyó con un amortiguador a 410 ml, para proporcionar concentraciones finales de 20 mM de Tris-acetato, 1 mM de MGCl2, 0.1 mM de EDTA, 33 mM de KGlu, 10% de glicerol (volumen/volumen) , 1 mM de ditiotreitol (DTT) , y 0.5 mM de fluoruro de fenilmetilsulfonilo (PMSF) a un pH de 7.5.

El extracto nuclear diluido se aplicó a una columna de gel de Afi-Gel-heparina (Bio-Rad) con un volumen de cama de 230 ml y 5 cm de diámetro, equilibrada con el mismo amortiguador y eluida con un gradiente de 2 litros de 33 a 450 mM de KGlu. La columna se operó a 4°C, a una velocidad de flujo de 1 columna volumen/hora. Se recolectaron y se sometieron a ensayo fracciones de 50 mls cada uno para la actividad de la telomerasa tal como se describe en la Parte E. La telomerasa se eluyó de la columna a aproximadamente 170 mM de KGlu. Las fracciones que contenían telomerasa (aproximadamente 440 ml) se agruparon y se ajustron a 20 mM de Tris-acetato, 10 mM de MGCl2, 1 mM de EDTA, 300 mM de KGlu, 10% de glicerol, 1 mM de DTT, y 1% de Nonidet P-40. Este amortiguador fue designado como "WB".

A esta preparación, se agregaron 1.5 nmol de cada uno de los dos oligoneucleótidos del DNA competidor (5'-TAGACCTGTT AGTGTACATTTGAATTGAAGC-3' (y (5'-TAGACCTGTTAGGTTGGATTTGTGGCATCA-3', 50 1g del ARN de la levadura (Sigma) , y 0.3 mmol del oligoneucleótido específico de telomerasa etiquetado con biotina (5'biotina-TAGACCTGTTA- (mreG) 2- (rmeU) 4- (rmeG) 4- (rmeU) 4-remG-3') , por ml de la agrupación. Los 2-Ometiriboneucleótidos de los oligoneucleótidos específicos de la telomerasa eran complementarios al ARN de la telomerasa; la región del molde; los desoxiriboneucleótidos no eran complementarios. La inclusión de oligoneucleótidos del DNA no específico competidos aumentaron la eficiencia de la purificación, ya que se redujeron los efectos de las proteínas de enlace del ácido nucleico y otros componentes en la mezcla que se habrían ya sea enlazado al oligoneucleótido de afinidad o habrían eliminado la telomerasa de la mezcla.

Posteriormente se agregó este material a la neutravidina inmovilizada con Ultralink más el material de la columna (Pierce) , a un volumen de 60 1l de suspensión por ml de la agrupación. El material de la columna se bloqueó previamente dos veces durante 15 minutos cada bloqueo, con una preparación de WB que contenía 0.01% de Nonidet P-40, 0.5 mg de BSA, 0.5 mg/ml de lisozima, 0.05 mg/ml de glucógeno, y 0.1 mg/ml de ARN de levadura. El bloqueo se llevó a cabo a 4°C, utilizando una rueda giratoria para bloquear el material de la columna perfectamente. Después del primer paso de bloqueo, y antes del segundo paso de bloqueo, el material de la columna se centrifugó a 200 x g durante 2 minutos para dar forma de píldora a la matriz.

La mezcla de la agrupación-columna se incubó durante 8 minutos a 30°C, y posteriormente durante 2 horas adicionales a 4°C, en una rueda giratoria (aproximadamente 10 rpm; Labindustries) para permitir el enlace. La mezcla de la agrupación-columna se centrifugó posteriormente 200 xg durante 2 minutos, y se eliminó el sobrenadante que contenía material no enlazado. Posteriormente, se lavó la mezcla de la agrupación -columna. Este proceso de lavado incluía los pasos de enjuagar la mezcla de la agrupación-columna con WB a 4°C, lavar la mezcla durante 15 minutos con WB a 4°C, enjuagar con WB, lavar durante 5 minutos a 30°C, con WB que contenía 0.6 M de KGlu, y sin Nonidet P-40, lavar durante 5 minutos a 25°C con WB, y por último, enjuagar otra vez con WB. El volumen restante después del lavado final se mantuvo en pequeña cantidad, con el fin de producir una relación del amortiguador con el material de la columna a aproximadamente 1:1.

La telomerasa se eluyó del material de la columna agregando 1 nmol del desoxioligoneucleótido de desplazamiento (5'-CA4C4A4C2TA2CAG2TCTA-3') , por ml del material de la columna e incubando a 25°C durante 30 minutos. El material se centrifugó durante 2 minutos a 14, 000 rpm en una microcentrífuga (Eppendorf) , y se recolectó el eluato. El procedimiento de elución se repitió dos veces más, utilizando un oligoneucleótido de desplazamiento fresco cada vez. Tal como se mencionó anteriormente, debido a que el oligoneucleótido de desplazamiento era complementario al oligoneucleótido de afinidad, éste formó un complejo más estable termodinámicamente con el oligoneucleótido de afinidad que el P-40. De esta manera, la añadidura del oligoneucleótido de desplazamiento a una telomerasa enlazada por afinidad dio como resultado una elución eficiente de la telomerasa bajo condiciones nativas. La telomerasa parecía ser aproximadamente el 50% pura en esta etapa, conforme a lo juzgado por el análisis en un gel de proteína. La purificación por afinidad de la telomerasa y la elución con un oligoneucleótido de desplazamiento se muestra en la Figura 26 (paneles A y B, respectivamente) . En esta Figura, los azúcares de 2'-O-metil del oligoneucleótido de afinidad se indican con la línea en negritas. Las formas negra y ovalada sombreada en esta Figura tienen el propósito de representar gráficamente las subunidades de la proteína.

Las concentraciones de la proteína del extrato y el material obtenido después de la cromatografía con la columna de Afi-Gel-heparina se determinaron utilizando el método de Bradford (Bradford, Bioquímica Analítica, 72:248 [1976]) , utilizando BSA como estándar. Únicamente una fracción de la preparación de la telomerasa se purificó posteriormente sobre un gradiente de glicerol.

El coeficiente de la sedimentación de la telomerasa se determinó mediante centrifugación del gradiente del glicerol, como se describe en la Parte I.

La Tabla 5 a continuación es una tabla de purificación para la telomerasa purificada de acuerdo con los métodos de este Ejemplo. La telomerasa se enriqueció 12 veces en extractos nucleares, conforme a lo comparado a los extractos celulares completos, con una recuperación de 80%; el 85% de la telomerasa fue solubilizado del núcleo después de la extracción.

Tabla 5. Purificación de la Telomerasa

Fracción Proteína (mg) Telomerasa (pmol de RNP) Telomerasa/ proteína /pol de RNP/mg Recuperación (%) Factor de Purificación Extracto Nuclear 2020 1720 0.9 100 1 Heparina 125 1040 8.3 60 10 Afinidad 0.3** 680 2270 40 2670 Gradiente de Glicerol NA* NA* NA* 25 NA*

*NA = No disponible ** Este valor fue calculado a partir de la cantidad medida de telomerasa (680 pmol) , asumiendo una pureza de 50% (basada en un gel de proteínas) .

E. Actividad de la Telomerasa En cada uno de los pasos en la purificación de la telomerasa, la preparación se analizó por medio de tres ensayos separados, uno de los cuales fue la actividad, tal como se describe en este ejemplo. En general, los ensayos de la telomerasa se llevaron a cabo en 40 1l que contenían 0.003-0.3 1l de extracto nuclear, 50 mM de Tris-Cl (pH 7.5) , 50

mM de KGlu, 10 mM de MGCl2, 1 mM de DTT, 125 1M de dTTP, 125 1M de dGTP, y aproximadamente 0.2 pmoles del substrato del oligoneucleótido etiquetado como 5'-32P (es decir, aproximadamente 400, 000 cpm) . Los iniciadores del oligoneucleótido fueron desnaturalizados térmicamente antes de agregarse a la mezcla de la reacción. Las reacciones se juntaron en hielo y se incubaron durante 30 minutos a 25°C. Estas reacciones fueron detenidas mediante la añadidura de 200 1l de 10 mM de Tris-Cl (pH 7.5) , 15 mM de EDTA, 0.6% de SDS, y 0.05 mg/ml de proteinasa K, y se incubaron durante por lo menos 30 minutos a 45°C. Después de la precipitación del etanol, los productos se analizaron sobre geles PAGE al 8% de desnaturalización, tal como se conocen en la técnica (Consultar por ejemplo, Sambrook y colaboradores, 1989) .

F. Cuantificación de la Actividad de la Telomerasa En este ejemplo, se describe la cuantificación de la actividad de la telomerasa a través del procedimiento de purificación. La cuantificación se logró sometiendo a ensayo el alargamiento de los iniciadores del oligoneucleótido en presencia de dGTP y [a-32P]dTTP. Brevemente, se extendió 1 1M del oligoneucleótido 5'- (G4T4) 2-3' en 20 1l de una mezcla de reacción en presencia de 2 1l de [a-32P]dTTP (10 mCi/ml, 400 Ci/mmol; 1 Ci=37 GBq) y 125 1M de dGTP tal como se describió (Lingner y colaboradores, Desarrollo de Genes, 8:1984 [1994]) y se cargó sobre un gel de secuenciación PAGE al 8% tal como se describió.

Los resultados de este estudio se muestran en la Figura 28. En la vía 1, no hay telomerasa presente (es decir, un control negativo) ; las vías 2, 5, 8 y 11 contenían 0.14 fmol de telomerasa; las vías 3, 6, 9 y 12 contenían 0.42 fmol de telomerasa; y las vías 4, 7, 10 y 13 contenían 1.3 fmol de telomerasa. La actividad fue cuantificada utilizando un PhosphorImager (Molecular Dynamics) utilizando las instrucciones del fabricante. Se determinó que bajo estas condiciones, 1 fmol de telomerasa purificada por afinidad incorporó 21 fmol de dTTP en 30 minutos.

Tal como se muestra en la Figura 28, la actividad específica de la telomerasa no cambió de manera significativa a lo largo del procedimiento de purificación. La telomerasa purificada por afinidad fue totalmente activa. Sin embargo, se determinó que a altas concentraciones, se detectó una actividad inhibitoria y la actividad de los extractos crudos no fue lineal. De esta manera, en el ensayo mostrado en la Figura 28, el extracto crudo se diluyó 700-7000 veces. Después de la purificación, esta actividad inhibitoria fue eliminada y no se detectó ningún efecto inhibitorio en las preparaciones de la telomerasa purificada, incluso a concentraciones altas de la enzima.

G. Electrofóresis con Gel y Manchados Northern Tal como se especificó en la Parte E, en cada paso en la purificación de la telomerasa, la preparación se analizó mediante tres ensayos separados. Este Ejemplo describe la electrofóresis con gel y los procedimientos de 50 manchado utilizados para cuantificar el ARN de la telomerasa presente en las fracciones y analizar la integridad de la partícula de ribonucleoproteína de la telomerasa.

i) Desnaturalización de Geles y Manchados Northern 55 En este Ejemplo, el ARN de la telomerasa transcrito T7 sintético de una concentración conocida sirvió como estándar. A lo largo de esta investigación, el componente del ARN se utilizó como medida de la telomerasa.

Se produjo una construcción para la transcripción de la polimerasa del ARN T7 del fago del ARN de la telomerasa del E. aediculatus, utilizando (PCR) . El gene del ARN de la telomerasa fue amplificado con iniciadores que fueron recocidos en cualquier extremo del gene. El iniciador que fue recocido en la terminación 5' también codificó una secuencia de la ribozima con cabeza de martillo para generar la terminación 5' natural después de la disociación del ARN transcrito, una secuencia del promotor T7, y un sitio EcoRI para la subclonación. La secuencia de este iniciador de 5' fue 5'-GCGGGAATTCTAATACGACTCA CTATAGGGAAGAAACTCTGATGAGGCCGAAAGGCCGAAACTCCACGAAAGTGGAGTAAGTTTCTCGATAATTGA TCTGTAG-3'. El iniciador de 3' incluía un sitio Ear1 para la terminación de la transcripción en la terminación de 3' natural, y un sitio BamHI para la clonación. La secuencia de este iniciador de 3' fue de 5'-CGGGGATCCTCTTCAAAAGATGAGA GGACAGCAAAC-3'. El producto de la amplificación de la PCR fue sometido a disociación con EcoRI y BamHI, y fue subclonado dentro de los sitios respectivos del pUC19 (NEB) , para producir "pEaT7". La precisión de este inserto fue confirmada mediante la secuenciación del DNA. La transcripción del T7 fue realizada conforme a lo descrito por Zaug y colaboradores, Bioquímica 33:14935 [1994], con el plásmido linealizado EarI. El ARN fue purificado con gel y se determinó la concentración (una A260 de 1 = 40 1g/ml) . Este ARN fue utilizado como estándar para determinar el ARN de la telomerasa presente en diferentes preparaciones de la telomerasa.

La señal de hibridación fue proporcional a la cantidad de ARN de la telomerasa, y las concentraciones del ARN derivado fueron consistentes con, pero ligeramente mayores a los obtenidos mediante la electrofóresis con gel nativa. La comparación de la cantidad de ARN de telomerasa completa en el ARN de la célula completa para las diluciones en serie de las concentraciones de transcripción del ARN T7 conocido indicaron que cada célula de E. aediculatus contenía aproximadamente 300, 000 moléculas de telomerasa.

La visualización de la telomerasa se logró mediante la hibridación del manchado Northern para su componente del RNA, utilizando los métodos descritos (Linger, y colaboradores, Desarrollo de Genes, 8:1984 [1994]) . Brevemente, el ARN (menor a o equivalente a 0.5 1g/vía) fue resuelto en una PAGE al 8% y fue electromanchado sobre una membrana Hybond-N (Amersham) , tal como se conoce en la técnica (consultar por ejemplo, Sambrook y colaboradores, 1989) . El manchado fue sometido a hibridación toda la noche en 10 ml de 4x SSC, 10x de solución de Denhardt, 0.1% de SDS, y 50 1g/ml del DNA de esperma de arenque desnaturalizado. Después de la hibridación previa durante 3 horas, se agregó 2 x 106 cpm sonda/ml de la solución de hibridación. La sonda etiquetada de manera aleatoria era un producto de la PCR que cubría todos el gene del ARN de la telomerasa. El manchado se lavó con varios cambios de amortiguador durante 30 minutos en 2x de SSC, 0.1% de SDS, y después se lavó durante 1 hora en 0.1x de SSC y 0.1% de SDS a 45°C.

ii) Geles Nativos y Manchados Northern En este experimento, la preparación de la telomerasa purificada se llevó a cabo en geles nativos (es decir, no desnaturalizado) de 3.5% de poliacrilamida y 0.33% de agarosa, tal como se conocen y son descritos en la técnica (Lamond y Sproat, [1994], mencionado anteriormente) . La telomerasa comigró aproximadamente con el tinte de cianol de xileno.

Los resultados del gel nativo indicaron que la telomerasa se mantenía como RNP a lo largo del protocolo de purificación. La Figura 27 es una fotografía de un manchado Northern que muestra la movilidad de la telomerasa en diferentes fracciones sobre un gel no desnaturalizado, así como en una telomerasa transcrita in vitro. En esta figura, la vía 1 contenía 1.5 fmol del ARN de la telomerasa, la vía 2 contenía 4.6 fmol del ARN de la telomerasa, la vía 3 contenía 14 fmol del ARN de la telomerasa, la vía 4 contenía 41 fmol del ARN de la telomerasa, la vía 5 contenía extracto nuclear (42 fmol de telomerasa) , la vía 6 contenía telomerasa purificada con Afi-Gel-heparina (47 fmol de telomerasa) , la vía 7 contenía telomerasa purificada por afinidad (68 fmol) y la vía 8 contenía telomerasa purificada con gradiente de glicerol (35 fmol) .

Tal como se muestra en la Figura 27, en los extractos nucleares, la telomerasa se ensambló dentro de una particular de RNP que migró de una manera más lenta que el ARN de la telomerasa no ensamblada. Por medio de este método se detectó menos de 1% de ARN libre. Sin embargo, también se detectó en los extractos algunas veces un complejo de RNP de telomerasa de migración más lenta. Después de la purificación en la columna de Afi-Gelheparina, la partícula de RNP de la telomerasa no cambió en su movilidad (Figura 27, vía 6) . Sin embargo, después de la purificación por afinidad, la movilidad de la partícula del ARN se incrementó ligeramente (Figura 27, vía 7) , indicando quizás que se había perdido una subunidad o fragmento de la proteína. En los gradientes de glicerol, la telomerasa purificada por afinidad no cambió de tamaño, pero se detectó aproximadamente 2% de ARN de telomerasa libre (Figura 27, vía 8) , sugiriendo que se había presentado una pequeña cantidad de desensamble de la partícula de RNP.

H. Composición de la Proteína de Telomerasa En este Ejemplo, se describe el análisis de la composición de la proteína de telomerasa purificada.

Las fracciones del gradiente de glicerol obtenidas tal como se describió en la Parte D, fueron separadas sobre un gel de poliacrilamida al 4-20% (Novex) . Después de la electrofóresis, el gel se tiñó con azul brillante tal Coomassie. La Figura 29 muestra una fotografía del gel. Las vías 1 y 2 contenían marcadores de la masa molecular (Pharmacia) conforme a lo indicado en el lado izquierdo del gel mostrado en la Figura 29. Las vías 3-5 contenían agrupaciones de la fracción del gradiente de glicerol conforme a lo indicado en la parte superior del gel (es decir, la vía 3 contenía las fracciones 9 a 14, la vía 4 contenía las fracciones 15 a 22, y la vía 5 contenía las fracciones 23 - 32) . La vía 4 contenía la agrupación con 1 pmol del ARN de la telomerasa. En las vías 6-9 se sometieron a prueba los estándares BSA a las concentraciones indicadas en la parte superior del gel en la Figura 29 (es decir, la vía 6 contenía 0.5 pmol de BSA, la vía 7 contenía 1.5 pmol de BSA, la vía 8 contenía 4.5 de BSA, y la vía 9 contenía 15 pmol de BSA) .

Tal como se muestra en la Figura 29, los polipéptidos con masas moleculares de 120 y 43 kDa se co-purificaron con la telomerasa. El polipéptido 43 kDa se observó como doblete. Se observó que el polipéptido de aproximadamente 43 kDa en la vía 3 migraba de manera diferente al doblete en la vía 4; puede tratarse de una proteína no relacionada. El 120 kDa y el doblete de 43 kDa se entintaron cada uno con azul brillante Coomassie en aproximadamente el nivel de 1 pmol, al compararse con los estándares de BSA. Debido a que esta fracción contenía un pmol de ARN de la telomerasa, donde todo esto estaba ensamblado dentro de una partícula de RNP (Consultar, Figura 27, vía 8) , parece que existen dos subunidades del polipéptido que son estequiométricas con el ARN de la telomerasa. Sin embargo, también es posible que las dos proteínas alrededor de 43 kDa sean subunidades separadas de la enzima.

La telomerasa purificada por afinidad que no estuvo sujeta a fraccionamiento en un gradiente de glicerol contenía polipéptidos adicionales con masas moleculares aparentes de 35 y 37 kDa, respectivamente. Se calculó que esta última fracción era por lo menos el 50% pura. Sin embargo, los polipéptidos de 35 kDa y 37 kDa que estuvieron presentes en el material purificado por afinidad no se separaron de manera reproducible mediante la centrifugación del gradiente de glicerol. Estos polipéptidos pueden ser contaminantes, ya que no fueron visibles en todas las preparaciones que contenían actividad.

I. Coeficiente de Sedimentación El coeficiente de sedimentación para la telomerasa fue determinado mediante la centrifugación del gradiente de glicerol. En este ejemplo, el extracto nuclear y la telomerasa purificada por afinidad se fraccionaron en gradientes de glicerol al 15-40% que contenían 20 mM de Tris-acetato, con 1 mM de MGCl2, 0.1 mM de EDTA, 300 mM de KGlu y 1 mM de DTT, a un pH de 7.5. Los gradientes de glicerol se vaciaron en tubos de 5 ml (13 x 51 mm) , y se centrifugaron utilizando un rotor SW55Ti (Beckman) a 55, 000 rpm durante 14 horas a 4°C.

Las proteínas del marcador se sometieron a prueba en un gradiente paralelo y tuvieron un coeficiente de sedimentación de 7.6 S para la deshidrogenasa de alcohol (ADH) , 113 S para catalasa, 17.3 S para apoferritina y 19.3 S para tiroglobulina. El pico de la telomerasa fue identificada mediante electrofóresis con gel nativo de las fracciones del gradiente seguida por una hibridación por manchado para su componente del RNA.

La Figura 30 es una gráfica que muestra el coeficiente de sedimentación para la telomerasa. Tal como se muestra en esta Figura, la telomerasa purificada por afinidad se co-sedimentó con catalasa a 11.5 S, mientras que la telomerasa en los extractos nucleares se sedimentó ligeramente más rápido, con un pico de alrededor 12.5 S. Por lo tanto, de manera compatible con la movilidad de la enzima de los geles nativos, la telomerasa purificada parece haber perdido un fragmento proteolítico o una subunidad asociada ligeramente.

La masa molecular calculada para la telomerasa, si se asume que consiste en una subunidad de la proteína 120 kDa, una subunidad de la 43 kDa, y una subunidad del ARN de 66 kDa, suma un total de 229 kDa. Esto está en concordancia estrecha con la masa molecular de 232 kDa de la catalsa. Sin embargo, el coeficiente de sedimentación es una función de la masa molecular, así como el volumen específico parcial y el coeficiente friccional de la molécula, los cuales ambos son desconocidos para la RPN de la telomerasa del Euplotes.

J. Utilización del Substrato En este Ejemplo, se investigaron los requerimientos del substrato de la telomerasa del Euplotes. Un modelo sencillo para la duplicación del extremo del DNA prevé que después de la duplicación del DNA semiconservador, la telomerasa extiende las moléculas del DNA con extremos desafilados, de doble filamento. En una variación de este modelo, se crea una terminación de 3' de un solo filamento por medio de una helicasa o nucleasa después de la duplicación. Esta terminación de 3' se utiliza posteriormente por la telomerasa para el enlace y la extensión.

Para determinar si la telomerasa es capaz de alargar las moléculas de extremos desafilados, se sintetizaron horquillas modelo con repeticiones teloméricas posicionadas en sus terminaciones 3'. Estos substratos del iniciador se purificaron con gel, se etiquetaron con terminación de 5' con cinasa del polinucleótido, se calentaron a 0.4 1M a 80°C durante 5 minutos y posteriormente se enfriaron poco a poco a temperatura ambiental en un bloque de calentamiento, para permitir la renaturalización y la formación de hélice de las horquillas. La movilidad del substrato en un gel sin desnaturalización indicó que estaba presente la formación eficiente de la horquilla, en comparación con la dimerización.

Los ensayos se llevaron a cabo con 125 1M de dGTP no etiquetado, 125 1M de dTTP, y 0.02 1M del iniciador etiquetado con terminación 5' (substrato del oligoneucleótido etiquetado como 5'-32P) en 10 1l de mezclas de reacción que contenían 20 mM de Tris-acetato, con 10 mM de MGCl2, 50 mM de KGlu y 1 mM de DTT, a un pH de 7.5. Estas mezclas se incubaron a 25°C durante 30 minutos. Las reacciones se detuvieron agregando un amortiguador de carga de formamida (es decir, TBE, formamida, azul de bromtimol y cianol, Sambrook, 1989, mencionado anteriormente) .

Los iniciadores se incubaron sin telomerasa ("-") con 5.9 fmol de telomerasa purificada por afinidad ("+") o con 17.6

fmol de telomerasa purificada por afinidad ("+++") . La telomerasa purificada por afinidad utilizada en este ensayo fue dializada con una membrana que posee un corte molecular de 100 kDa, con el fin de eliminar el oligoneucleótido de desplazamiento. Los productos de la reacción se separaron sobre un gel de PAGE/urea al 8% que contenía 36% de formamida, para desnaturalizar las horquillas. Las secuencias de los iniciadores utilizadas en este estudio, así como las asignaciones de sus vías se muestran en la Tabla 6.

TABLA 6. Frecuencias del Iniciador

Vía Frecuencia del Iniciador (5' a 3') 1-3 C4 (A4C4) 3CACA (G4T4) 3G4 4-6 C2 (A4C4) 3CACA (G4T4) 3G4 7-9 (A4C4) 3CACA (G4T4) 3G4 10-12 A2C4 (A4C4) 2CACA (G4T4) 3G4 13-15 C4 (A4C4) 2CACA (G4T4) 3 16-18 (A4C4) 3CACA (G4T4) 3 19-21 A2C4 (A4C4) 2CACA (G4T4) 3 22-24 C4 (A4C4) 2CACA (G4T4) 3 25-27 C2 (A4C4) 2CACA (G4T4) 3 28-30 (A4C4) 2CACA (G4T4) 3

Los resultados del gel se muestran en la Figura 31. Las vías 1-15 contenían substratos con repeticiones teloméricas que finalizaban con cuatro residuos G. Las vías 16-30 contenían substratos con repeticiones teloméricas que finalizaban con cuatro residuos T. La alineación putativa en el molde de ARN de telomerasa se indica en la Figura 32. Se asumió que el iniciador determina el recocido en dos posiciones muy diferentes en el molde mostrado en la Figura 32 (es decir, Panel A y Panel B respectivamente) . Esto puede haber afectado su velocidad de enlace y/o alargamiento.

La Figura 33 muestra una exposición con más luz de las vías 25-30 de la Figura 31. La exposición con más luz de la Figura 33 se tomó en consideración para permitir la visualización de los nucleótidos que se agregan y las posiciones de pausa en los productos alargados. El porcentaje de substrato alargado de la tercera vía en cada conjunto se cuantificó en un PhosphorImager, tal como se indica en la parte inferior de la Figura 31.

Las eficiencias del substrato para estas horquillas se compararon con los substratos similares a un telómetro con filamento doble, con salientes de diferentes longitudes. Un substrato modelo que finaliza con cuatro residuos G (consultar las vías 1-15 de la Figura 31) no se alargó cuando tenía extremos desafilados (consultar vías 1-3) . Sin embargo, se observó una extensión ligera con una longitud de la saliente de dos bases; el alargamiento se hizo eficiente cuando la saliente era de por lo menos cuatro bases de longitud. La telomerasa actuó de manera similar con un substrato de filamento doble que finalizaba con cuatro residuos T, con una saliente de seis bases requeridas para un alargamiento altamente eficiente. En la Figura 31, las bandas tenues abajo de los iniciadores en las vías 1015 que son independientes de la telomerasa representan oligonucleótidos más cortos en las preparaciones del iniciador.

La exposición con más luz de las vías 25-30 en la Figura 33 muestra una escalera de productos alargados, donde las bandas de color más obscuro se correlacionan con el límite putativo 5' del molde (conforme a lo descrito por Lingner y colaboradores, Desarrollo de Genes, 8:1984 [1994]) . La abundancia de productos que corresponde a otras posiciones en el molde sugirieron que la pausa y/o la disociación se presenta en sitios que no son el sitio de 45 translocación con la telomerasa purificada.

Tal como se muestra en la Figura 31, los oligonucleótidos con extremos desafilados, de doble filamento, no eran substratos para la telomerasa. Para determinar si estas moléculas se enlazarían con la telomerasa, se llevó a cabo un experimento de competencia. En este experimento, 2 nM del substrato etiquetado con terminación 5'con la 50 secuencia (G4T4) 2, o un substrato de horquilla con una saliente de seis bases se extendieron con 0.125 nM de telomerasa (Figura 31, vías 25-27) . A pesar se que los mismos substratos del oligonucleótido sin etiquetar compitieron de manera eficiente con el substrato etiquetado para la extensión, no se observó reducción de actividad cuando se utilizaron oligonucleótido de horquilla con extremos desafilados y de filamento doble como competidores, incluso en la presencia de horquillas de más de 100 pliegues.

Estos resultados indicaron que los oligonucleótidos de extremos desafilados, de doble filamento, no pueden enlazarse con la telomerasa a las concentraciones y condiciones probadas en este Ejemplo. Más bien, se requiere una terminación 3' de un solo filamento para el enlace. Es probable que esta terminación 3' se requiera para basar el par con el molde de ARN de telomerasa.

K. Clonación y Secuenciamiento del Polipéptido 123 kDa En este ejemplo, se describe la clonación del polipéptido 123 kDa de la telomerasa Euplotes (es decir, la subunidad de la proteína 123 kDa) . En este estudio, se amplificó un fragmento interno del gene de telomerasa mediante PCR, con iniciadores del oligonucleótido diseñados para hacer concordar las secuencias del péptido que se obtuvieron a partir del polipéptido purificado obtenido en la Parte D, anterior. La secuencia del polipéptido se determinó utilizando los métodos de espectroscopia de masa tandémica nanoES conocidos en la técnica y descritos por Calvio y colaboradores, ARN 1:724.733 [1995]. Los iniciadores del oligonucleótido utilizados en este ejemplo tenían las siguientes secuencias, composiciones que se degeneraron mostradas en los paréntesis --5'-TCT (G/A) AA (G/A) TA (G/A) TG (T/G/A) GT (G/A/T/C) A (T/G/A) (G/A) TT (G/A) TTCAT-3', y 5'-GCGGATCCATGAA (T/C) CC (A/T) GA (G/A) AA (T/C) CC (A/T) AA (T/C) GT-3'

Una reacción de 50 1l contenía 0.2 mM de dNTPs, 0-15 1g de DNA cromosómico E. aediculatus, 0.5 1l de Taq (Boehringer-Mannheim) , 0.8 1g de cada iniciador, y amortiguador de reacción 1x (Boehringer-Mannheim) . La reacción se incubó en un ciclador térmico (Perkin-Elmer) utilizando los siguientes --5 minutos a 95°C, seguidos por 30 ciclos de 1 minuto a 94°C, 1 minuto a 52°C, y 2 minutos a 72 °C. La reacción se completó con una incubación de 10 minutos a 72°C.

Se preparó una biblioteca del DNA genómico a partir del DNA E. aediculatus cromosómico mediante la clonación del DNA de extremo desafilado dentro del sitio SmaI del vector del plásmido pCR-Script Figura 14 (Stratagene) . Esta biblioteca fue clasificada mediante la hibridación, con el producto de PCR purificado con gel, radio etiquetado. El DNA del plásmido de los clones positivos fue preparado y secuenciado mediante el método de dideoxi (Sanger y colaboradores, Proc. Natl. Acad. Sci., 74:5463 [1977]) o manualmente, a través del uso de un secuenciador automatizado (ABI) . La secuencia del DNA del gene que codifica este polipétido se muestra en la Figura 13. El codón se inicio en esta secuencia inferida a partir de la secuencia del DNA se localiza en la posición del nucleótido 101, y la configuración de la lectura abierta termina en la posición 3193. El código genético de Euplotes difiere de otros organismos en que l codón "UGA" codifica un residuo de cisteína. La secuencia del aminoácido del polipéptido inferido a partir de la secuencia del DNA se muestra en la Figura 14, y asume que no se insertan aminoácidos inusuales durante la traducción, y no ocurre una modificación posterior a la traducción.

L. Clonación y Secuenciamiento del Polipéptido 43 kDa En este ejemplo, se describe la clonación del polipéptido 43 kDa de telomerasa (es decir, la subunidad de la proteína 43 kDa) . En este estudio, se amplificó un fragmento interno del gene de telomerasa correspondiente mediante PCR, con iniciadores del oligonucleótido diseñados para hacer concordar las secuencias del péptido que se obtuvieron a partir del polipéptido purificado obtenido en la Parte D, anterior. La secuencia del polipéptido fue determinada utilizando los métodos de espectroscopia de masa tandémica nanoES conocidos en la técnica y descritos por Calvio y colaboradores, supra. Los iniciadores del oligonucleótido utilizados en este ejemplo tenían las siguientes secuencias- 5'-NNNGTNAC (C/T/A) GG (C/T/A) AT (C/T/A) AA (C/T) AA-3', y 5'- (T/G/A) GC (T/G/A/GT (C/T) TC (T/C) TG (G/A) TC (G/A) TT (G/A) TA-3'. En esta secuencia, "N" indica la presencia de cualquiera de los cuatro nucleótidos (es decir, A, T, , G, o C) .

El PCR se llevó a cabo conforme a lo descrito en la Parte K.

Se preparó una biblioteca del DNA genómico y se clasificó tal como se describe en la Parte K. La secuencia del DNA del gene que codifica este polipéptido se muestra en la Figura 34. Tres configuraciones de lectura potenciales se muestran para esta secuencia, tal como aparece en la Figura 35. Para más claridad, la secuencia del aminoácido se indica abajo de la secuencia del nucleótido en las tres configuraciones de lectura. Estas configuraciones de lectura están designadas como "a", "b" y "c". Un posible codón de inicio se codifica en la posición de nucleótido 84 en la configuración de lectura "c". La región de la codificación podría terminar en la posición 1501 en la lectura de la configuración "b". Los codones de paro prematuros, indicados por asteriscos en esta Figura, se presentan en las tres configuraciones de lectura entre la posición del nucleótido 337-350.

El "Dominio La" está indicado en negritas. Mas hacia abajo, la secuencia de la proteína parece estar codificada por diferentes configuraciones de lectura, ya que ninguna de las tres configuraciones está ininterrumpida por codones de paro. Además, las secuencias del péptido, a partir de la proteína purificada están codificadas en las tres configuraciones. Por lo tanto, este gene parece contener secuencias de intervención, o como alternativa, el ARN está editado. Otras posibilidades incluyen el cambio en la configuración ribosómica o errores en la secuencia. Sin embargo, la homología con la secuencia de la proteína La siguen siendo de interés importante. Una vez más, en el Euclotes, el codón "UGA" codifica un residuo de cisteína.

M. Comparaciones del Aminoácido y el Ácido Nucleico En este ejemplo, se llevaron a cabo las comparaciones entre diferentes secuencias reportadas y las secuencias de los polipéptidos de la subunidad de telomerasa 123 kDa y 43kDa.

i) Comparaciones con la Subunidad de Telomerasa E. aediculatus 123 kDa La secuencia del aminoácido del polipéptido Euplotes aediculatus 123 kDa se comparó con la secuencia de la subunidad de la proteína de telomerasa 80 kDa de Tetrahymena thermophula (admisión al GenBank #U25641) para investigar su similaridad. La secuencia del nucleótido tal como fue obtenida a partir de la codificación del GenBank de esta proteína se muestra en la Figura 42. La secuencia del aminoácido de esta proteína tal como fue obtenida a partir del GenBank se muestra en la Figura 43. La comparación de la secuencia entre el E. aediculatus 123 kDa y el T. thermophila 80 kDa se muestra en la Figura 36. En esta Figura, la secuencia del E. aediculatus es la secuencia superior, mientras que la secuencia T. thermophila es la secuencia menor. La identidad observada fue determinada como de aproximadamente 19%, mientras que la similaridad del porcentaje fue de aproximadamente 45%, valores similares a lo que habría sido observado con cualquier secuencia de la proteína aleatoria. En las Figuras 36-39, las identidades están indicadas por barras verticales, mientras que los puntos sencillos entre las secuencias indican aminoácidos de cierta forma similares, y los puntos dobles entre las secuencias indican aminoácidos más similares.

La secuencia del aminoácido del polipéptido Euplotes aediculatus 123 kDa también se comparó con la secuencia de la subunidad de la proteína de telomerasa 95 kDa de Tetrahymena thermophila (admisión al GenBank #U25642) , para investigar su similaridad. La secuencia del nucleótido tal como fue obtenida a partir de la codificación de esta proteína del Gen Bank se muestra en la Figura 44. La secuencia del aminoácido de esta proteína conforme a lo obtenido a partir del GenBank se muestra en la Figura 45. Esta comparación de la secuencia aparece en la Figura 37. En esta Figura la secuencia E. aediculatus es la secuencia superior, mientras que la secuencia T. thermophila es la secuencia inferior. La identidad observada fue determinada como de aproximadamente 20%, mientras que la similaridad del porcentaje fue de aproximadamente 43%, valores similares a los que habrían sido observados con cualquier secuencia de la proteína aleatoria.

De manera significativa, la secuencia del aminoácido del polipéptido E. aediculatus 123 kDa contiene los cinco motivos característicos de las transcriptasas inversas. El polipéptido 123 kDa también se comparó con los dominios de la polimerasa de diferentes transcriptasas inversas. La Figura 40 muestra la alineación del polipéptido 123 kDa con el homólogo de levadura putativo (L8543.12 o ESTp) . La secuencia del aminoácido de L8543.12 obtenida del GenBank se muestra en la Figura 46.

En esta comparación se incluyeron cuatro motivos (A, B, C y D) . En esta Figura 40, los residuos altamente conservados están indicados por letras blancas sobre un fondo negro. Los residuos de las secuencias del E. aediculatus que se conservan en la otra secuencia están indicados en negritas; la "h" indica la presencia de un aminoácido hidrofóbico. Los números localizados entre los residuos del aminoácido de los motivos indican la longitud de las aberturas en las secuencias. Por ejemplo, el "número 100" mostrado entre los motivos A y B refleja una abertura del aminoácido 100 en la secuencia entre los motivos.

Tal como se observó anteriormente, las investigaciones del GenBank identifican una proteína de la levadura (admisión al GenBank #u20618) , y el gene L8543.12 (Est2) , que contiene o codifica una secuencia del aminoácido que muestra cierta homología con la subunidad de la telomerasa 123 kDa E. aediculatus. En base a las observaciones de que ambas proteínas contienen motivos de transcriptasa inversa en sus regiones terminales C, ambas proteínas comparten similaridad en las regiones fuera del motivo de la transcriptasa inversa; las proteínas son similarmente básicas (pI=10.1 para E. aediculatus y pI=10.0 para la levadura) ; y ambas proteínas son largas (123kDa para E. aediculatus y 103 kDa para la levadura) , estas secuencias incluyen el núcleo catalítico de sus telomerasas respectivas. Se contempló en base a esta observación de homología en dos organismos filogenéticamente distintos como el E. aediculatus y la levadura, que la telomerasa humana podría contener una proteína que tiene las mismas características (es decir, motivos de la transcriptasa inversa, es básica y larga [> 100 hDa]) .

ii) Comparaciones con la Subunidad de la Telomerasa E. aediculatus 43 kDa La secuencia del aminoácido del "Domio La" del polipéptido Euplotes aediculatus 43 kDa se comparó con la secuencia de la subunidad de la proteína de telomerasa 95 kDa de Tetrahymena thermophila (descrita anteriormente) para investigar su similaridad. Esta comparación de las secuencias se muestra en la Figura 38, mientas que la secuencia del T. thermophila es la secuencia menos. La identidad observada fue determinada como de aproximadamente 23%, mientras que la similaridad del porcentaje fue de aproximadamente 46%, valores similares a los que habrían sido observados con cualquier secuencia de la proteína aleatoria. La secuencia del aminoácido del "Dominio La" del polipéptido Euplotes aediculatus 43 kDa se comparó con la secuencia de la subunidad de la proteína de telomerasa 80 kDa del Tetrahymena thermophila (descrita anteriormente) para investigar su similaridad. Esta comparación de las secuencias se muestra en la Figura 39. En esta Figura, la secuencia del E. aediculatus es la secuencia superior, mientras que la secuencia del T. thermophila es la secuencia inferior. La identidad observada fue determinada como de aproximadamente 26%, mientras que la similaridad del porcentaje fue de aproximadamente 49%, valores similares a los que habrían sido observados con cualquier secuencia de la proteína aleatoria.

La secuencia del aminoácido de un dominio del polipéptido E. aediculatus 43 kDa también se comparó con las proteínas La de diversos organismos diferentes. Estas comparaciones se muestran en la Figura 41. En esta Figura, los residuos altamente conservados son indicados por letras blancas sobre un fondo negro. Los residuos de las secuencias del E. aediculatus que se conservan en la otra secuencia están indicados en negritas.

N. Identificación de las Subunidades de la Proteína de Telomerasa en otro Organismo En este ejemplo, las secuencias identificadas en los Ejemplos anteriores se utilizaron para identificar las subunidades de la proteína de Oxytricha trifallax, un siliado que está relacionado de manera muy distante con el E. aediculatus. Los iniciadores se seleccionaron en base a la región conservada del polipéptido 123 kDa del E. aediculatus que incluía los motivos del dominio de la transcriptasa inversa. Los iniciadores adecuados se sintetizaron y se utilizaron en una reacción PCR con el DNA total del Oxytricha. El DNA del Oxytricha fue preparado de acuerdo con los métodos conocidos en la técnica. Los productos del PCR fueron clonados posteriormente y secuenciados utilizando métodos conocidos en la técnica.

Las secuencias del oligonucleótido utilizadas como los iniciadores fueron las siguientes: 5'- (T/C) A (A/G) AC (T/A/C) AA (G/A) GG (T/A/C) AT (T/C) CC (C/T/A) (C/T) A (G/A) GG-3' y 5' (G/A/T) GT (G/A/T) ATNA (G/A) NA (G/A) (G/A) TA (G/A) TC (G/A) TC (G/A) TC-3') . Las posiciones que se degeneraron se muestran en paréntesis, con las bases alternativas mostradas dentro de los paréntesis. "N" representa cualquiera de los cuatro nucleótidos.

En la reacción del PCR, una reacción de 50 1l contenía 0.2 mM dNTPs, 0.3 1g del DNA cromosómico de Oxytricha trifallax, 1 1l de la polimerara de Taq (Boehringer-Manneheim) , dos micromolares de cada iniciador, amortiguador de reacción 1x (Boehringer-Manneheim) . La reacción se incubó en un ciclador térmico (Perkin-Elmer) bajo las siguientes condiciones: 5 minutos a 95°C, 30 ciclos formados por 1 minuto a 94°C, 1 minuto a 53°C y 1 minuto a 72°C, seguidos por una incubación de 10 minutos a 72°C. El producto del PCR era gel purificado y secuenciado mediante el método de dideoxi (por ejemplo, Sanger y colaboradores, Proc. Natl. Acad. Sci. 74, 5463.5467 (1977) .

La secuencia del aminoácido deducida del producto del PCR fue determinada y comparada con la secuencia del E. aediculatus. La Figura 47 muestra la alineación de estas secuencias, con la secuencia del O. trifallax mostrada en la hilera superior, y la secuencia del E. aediculatus mostrada en la hilera inferior. Tal como puede observarse a partir de esta Figura, existe una gran cantidad de homología entre la secuencia del polipéptido del O. trifallax identificada en este Ejemplo con la secuencia del polipéptido del E. aediculatus. De esta manera, es evidente que las secuencias identificadas en la presente memoria de patente son útiles para la identificación de las subunidades de la proteína de telomerasas homólogas en otros organismos eucarióticos. De hecho, el desarrollo de la presente invención ha identificado secuencias de la telomerasa homólogas en especies múltiples y diversas, tal como se describe en la presente.

O. Identificación de las Secuencias de la Telomerasa de Tetrahymena En este ejemplo, se produjo un clon de Tetrahymena que comparte homología con las secuencias del Euplotes, y EST2p.

Este experimento utilizó PCR con iniciadores del oligonucleótido degenerado dirigidos contra motivos conservados para identificar regiones de homología entre las secuencias del Tetrahymena, Euplotes, y EST2p. El método del PCR utilizado en este ejemplo es un método nuevo diseñado para amplificar las secuencias del DNA específicamente raras a partir de mezclas complejas. Este método evita el problema de la amplificación de productos del DNA con el mismo iniciador del PCR en ambos extremos (es decir, productos del iniciador único) que se encuentran comúnmente en los métodos de clonación del PCR. Estos productos del iniciador sencillo producen un fondo no deseado y con frecuencia pueden obscurecer la amplificación y detección del producto deseado de dos iniciadores. El método utilizado en este experimento selecciona de manera preferente los productos de dos iniciadores. En particular, un iniciador es biotinilado y el otro no. Después de varias rondas de amplificación del PCR, los productos se purifican utilizando cuentas magnéticas de estreptabidina y se eluyen específicamente dos productos del iniciador utilizando la desnaturalización térmica. Este método encuentra uso en medios que no sean los experimentos descritos en este Ejemplo. De hecho, este método encuentra su uso en la aplicación en la cual se desea amplificar específicamente las secuencias de DNA raras, incluyendo los pasos preliminares en los métodos de clonación como en 5' y 3; RACE, y cualquier método que utilice iniciadores de degeneración en el PCR.

Se llevó a cabo una primera prueba del PCR utilizando el DNA macronuclear del molde Tetrahymena, aislado utilizando métodos conocidos en la técnica, y el iniciador delantero 24-mero con la secuencia 5' biotina-GCCTATTT (TC) TT (TC) TA (TC) (GATC) (GATC) (GATC) AC (GATC) GA-3' designada como "K231", correspondiente a la región FFYXTE y el iniciador inverso 23-mero con la secuencia 5'-CCAGATAT (GATC) A (TGA) (GATC) A (AG) (AG) AA (AG) TC (AG) TC-3', designada como "K220", correspondiente a la región DDFL (FIL) I. Esta reacción del PCR contenía 2.5 1l del DNA (50 ng) , 4 1l de cada iniciador (20 1m) , 3 1l del amortiguador del PCR 10x, 31l del dNTPs 10x, 2 1l de Mg, 0.3 1l de Taq, y 11.2 1l de dH2O. La mezcla se sometió a ciclado durante 8 ciclos de 94°C por 45 segundos, 37°C durante 45 segundos y 72°C durante 1 minuto.

Esta reacción del PCR se enlazó con 200 1l de cuentas magnéticas de estreptabidina, lavadas con 200 1l TE, se volvió a suspender en 20 1l de dH2O y posteriormente se desnaturalizó térmicamente mediante ebullición a 100°C durante 2 minutos. Las cuentas se debilitaron y el eluato se extrajo. Posteriormente, 2.5 1l de este eluato se volvieron a amplificar subsecuentemente utilizando las condiciones anteriores, con la excepción de que se incluyeron 0.3 1l de a -32P del dATP, y se llevó a cabo el PCR durante 33 ciclos. Esta reacción se llevó a cabo en un 5% desnaturalizando el gel de poliacrilamida y se cortó la región apropiada del gel. Estos productos se volvieron a amplificar posteriormente durante 34 ciclos adicionales, bajo las condiciones indicadas anteriormente, con la excepción que se utilizó una temperatura de recocido de 42°C.

Se llevó a cabo una segunda prueba del PCR utilizando el molde del DNA macronuclear del Tetrahymena, aislado utilizando los métodos conocidos en la técnica, y el iniciador delantero 23-mero con la secuencia 5'ACAATG (CA) G (GATC) (TCA) T (GATC) (TCA) T (GATC) CC (GATC) AA (AG) AA-3', designada como "K228", correspondiente a la región R (LI) (LI) PKK, y un iniciador inverso con la secuencia 5'-ACGAATC (GT) (GATC) GG (TAG) AT (GATC) (GC) (TA) (AG) TA (AG) CA 3', designada como "K224", correspondiente a la región CYDSIPR. Esta reacción del PCR contenía 2.5 1l del DNA (50 ng) , 4 ul de cada iniciador (20 1M) , 3 1l del amortiguador del PCR 10x, 3 1l del dNTPs 10x, 2 ul de Mg, 0.3 1l de a-32P del dATP, 0.3 1l de Taq y 10.9 1l de dH2O. Esta reacción se llevó a cabo en un gel de poliacrilamida de desnaturalización al 5%, y la región adecuada se cortó del gel. Estos productos volvieron a amplificarse durante 34 ciclos adicionales, bajo las condiciones en listadas anteriormente, con la excepción que se utilizó una temperatura de recocido de 42°C.

Diez 1l del producto de la reacción de la prueba 1 se enlazaron a las cuentas magnéticas recubiertas con estreptabidina en 200 1l de TE. Las cuentas se lavaron con 200 1l de TE y posteriormente se volvieron a suspender en 20 1l de dH2O, se desnaturalizaron térmicamente y se extrajo el eluato. El producto de la reacción de la prueba 2 se agregó posteriormente a las cuentas y se diluyó con 30 1l de SSC 0.5x. La mezcla se calentó 94°C a 50°C. El eluato se extrajo y las cuentas se lavaron tres veces en SSC 0.5x a 55°C. Las cuentas se volvieron a suspender posteriormente en 20 1l de dH2O, se desnaturalizaron térmicamente, y el eluato se extrajo designado como "eluato ronda 1" y se guardó.

Para aislar la banda del Tetrahymena el eluato de la ronda 1 se volvió a amplificar con el iniciador delantero K228 y el iniciador inverso K227 con la secuencia 5'-CAATTCTC (AG) TA (AG) CA (GATC) (CG) (TA) (CT) TT (AGT) AT (GA) TC3', correspondiente a la región DIKSCYD. Las reacciones del PCR se llevaron a cabo tal como se describió anteriormente. Los productos de la reacción se sometieron a prueba en un gel de poliacrilamida al 5%; la banda correspondiente a aproximadamente 295 nucleótidos se cortó del gel y se secuenció.

Se secuenció el clon designado como 168-3. Se descubrió que la secuencia del DNA (incluyendo las secuencias del iniciador) era: GATTACTCCCGAAGAAAGGATCTTTCCGTCCAATCATGACTTTCTTAAGAAAGGACAAGCAAAAAAATATTAAGTT AAATCTAAATTAAATTCTAATGGATAGCCAACTTGTGTTTAGGAATTTAAAAGACATGCTGGGATAAAAGATAGGA TACTCAGTCTTTGATAATAAACAAATTTCAGAAAAATTTGCCTAATTCATAGAGAAATGGAAAAATAAAGGAAGAC CTCAGCTATATTATGTCACTCTAGACATAAAGACTTGCTAC.

La secuencia adicional de este gene fue obtenida mediante el PCR utilizando un iniciador único designado para hacer concordar la secuencia a partir del 168-3 ("K297" con la secuencia 5'-GAGTGACATAATATACGTGA-3'; y el iniciador K231 (FFYXTE) . La secuencia del fragmento obtenido a partir de esta reacción, junto con el 168-3 s la siguiente (sin las secuencias del iniciador) :

AAACACAAGGAAGGAAGTCAAATATTCTATTACCGTAAACCAATATGGAAATTAGTGATGAAATTAACTATTGTCA AAGTAAGAATTTAGTTTTCTGAAAAGAATAAATAAATGAAAAATAATTTTTATCAAAAAATTTAGCTTGAAGAGGAG AATTTGGAAAAAGTTGAAGAAAAATTGATACCAGAAGATTCATTTTAGAAATACCCTCAAGGAAAGCTAAGGATTA TACCTAAAAAAGGATCTTTCCGTCCAATCATGACTTTCTTAAGAAAGGACAAGCAAAAAAATATTAAGTTAAATCTA AATTAAATTCTAATGGATAGCCAACTTGTGTTTAGGAATTTAAAAGACATGCTGGGATAAAAGATAGGATACTCAG TCTTTGATAATAAACAAATTTCAGAAAAATTTGCCTAATTCATAGAGAAATGGAAAAATAAAGGAAGACCTCAGCT ATATTATGTCACTCTA.

Se descubrió que la secuencia del aminoácido correspondiente a este fragmento del DNA era:

KHKEGSQIFYYRKPIWKLVSKLTIVKVRIKFSEXNKQMKNNFYQKIQLEEENLEKVEEKLIPEDSFQKYPQGKLRIIPKKG SFRPIMTFLRKDKQKNIKLNLNQILMDSQLVFRNLQDMLGKKIGYSVFDNKQISEKFAQFIEKWKNKGRPQLYYVTL

Esta secuencia del aminoácido fue alineada posteriormente con otros genes de telomerasa (EST2p, y Euplotes) . La alineación se muestra en la Figura 53. En esta Figura también se muestra una secuencia del concenso.

P. Identificación de las Secuencias de la Telomerasa del Schizosaccharomyces pombe En este Ejemplo, se identificó la secuencia tezl del S. pombe como homóloga del E. aediculatus p123, y el S. cerevisiae Est2p.

La Figura 55 ofrece un resumen global de esos experimentos. En esta Figura, la porción superior (Panel A) muestra la relación de los dos clones genómicos superpuestos, y la porción del 5825 bp que fue secuenciada. La región designada en "tezl+" es la región de codificación de la proteína, con las secuencias flanqueantes indicadas de la misma forma, la caja debajo de la región 5825 bp es un fragmento del HindIII aproximadamente de 2 kb que fue utilizado para llevar a cabo la construcción de la disrupción tezl, tal como se describe posteriormente.

La mitad inferior de la Figura 55 (Panel B) es un esquema de "acercamiento" de esta misma región del DNA. La secuencia designada como "PCR original" es el fragmento del PCR degenerado original que fue generado con un para del iniciador del oligonucleótido degenerado designado en base al motivo 4 de la secuencia del Euplotes (B') y el motivo 5 (C) , tal como se describió.

i) PCR con Iniciadores Degenerados Se utilizó el PCR que emplean iniciadores degenerados para encontrar el homólogo del E. aediculatus p123 en el S. pombe. La Figura 56 muestra las secuencias de los iniciadores degenerados (designados como "poli 4" y "poli 1") utilizados en esta reacción. Las pruebas del PCR se llevaron a cabo utilizando el mismo amortiguador que se describió en los Ejemplos previos (Consultar por ejemplo, Parte K, anterior) , con un tiempo de rampa de 5 minutos a 94°C, seguido por 30 ciclos de 94°C durante 30 segundos, 50°C durante 45 segundos y 72°C durante 30 segundos, y 7 minutos a 72°C, seguidos por un almacenamiento a 4°C. Las pruebas del PCR se llevaron a cabo utilizando diversas condiciones (es decir, diferentes concentraciones del DNA del S. pombe y concentraciones de MGCl2) . Los productos del PCR se sometieron a prueba en un gel de agarosa y se tiñeron con bromuro de etidio tal como se describió anteriormente. Varias pruebas del PCR dieron como resultado la producción de tres bandas (designadas como "T", "M" y "B") . Estas bandas se volvieron a amplificar y se sometieron a prueba en geles utilizando las mismas condiciones que se describieron anteriormente. Se observaron cuatro bandas después de esta nueva amplificación ("T", "M1", "M2" y "B") , tal como se muestra en la Figura 57. Estas cuatro bandas se volvieron a amplificar posteriormente utilizando las mismas condiciones que se describieron antes. La tercera banda contando desde la parte superior de la vía en la Figura 57 fue identificada como la banda que contenía la secuencia correcta para una proteína de telomerasa. Se descubrió que el producto del PCR designado como M2 mostraba una concordancia razonable con otras proteínas de telomerasa, tal como se indica en la Figura 58. Además de la alineación mostrada, esta Figura también muestra la secuencia real del tezl. En esta Figura, los asteriscos indican los residuos compartidos con las cuatro secuencias (Oxytricha "Ot"; E. aediculatus "Ea_p123"; S. cerevisiae" Sc_p103; y M2) , mientras que los circulos (es decir, los puntos ) indican residuos del aminoácido similares.

ii) PCR de 3'RT

Para obtener la información adicional de la secuencia, se llevaron a cabo los PCR de 3' y 5' RT en el candidato de la telomerasa identificado en la Figura 58. La Figura 59 ofrece un esquema de la estrategia del PCr de 3'RT utilizada. En primer lugar, el cDNA se preparó a partir de mRNA utilizando el iniciador del oligonucleótido "QT, " (5'-CCA GTG AGC AGA GTG ACG AGG ACT CGA GCT CAA GCT TTT TTT TTT TTT TT-3') , y utilizando posteriormente este cDNA como molde para el PCR con "Qo" (5'-CCA GTG AGC AGA GTG ACG-3') , y un iniciador designado en base a la reacción del PCR degenerado original (es decir, "M2-T" con la secuencia 5'-G TGT CAT TTC TAT ATG GAA GAT TTG ATT GAT G-3') . La segunda reacción del PCR (es decir, el PCR inclusivo) con "Q1" (5'-GAG GAC TCG AGC TCA AGC-3') , y otro iniciador del PCR designado con la secuencia derivada a partir de la reacción del PCR degenerado original o "M2-T2" (5'-AC CTA TCG TTT ACG AAA AAG AAA GGA TCA GTG-3') . Los amortiguadores utilizados en este PCR fueron los mismos que los descritos anteriormente, donde la amplificación llevada a cabo iniciaba con una rampa de hasta 94°C durante 5 minutos, seguida por 30 ciclos de 94°C durante 30 segundos, 55°C durante 30 segundos, y 72°C durante 3 minutos, seguidos por 7 minutos a 72°C. Los productos de la reacción se almacenaron a 4°C hasta que se utilizaron.

iii) Clasificación de las Bibliotecas Genómicas y del cDNA

Después de obtener esta información adicional de la secuencia, se clasificaron diferentes bibliotecas genómicas y del cDNA para identificar cualquier biblioteca que incluyera este gene candidato de telomerasa. El enfoque utilizado, así como las bibliotecas y los resultados se muestran en la Figura 60. En esta Figura, el Panel A enlista las bibliotecas sometidas a prueba en este experimento; el Panel B muestra las regiones utilizadas; los Paneles C y D muestran los resultados de la hibridación con manchas de puntos obtenidos con estas bibliotecas. Las bibliotecas positivas se clasificaron posteriormente por hibridación de colonias para obtener la versión genómica y del cDNA del gene tezl. En este experimento, se clasificaron aproximadamente 3 x 104 colonias de la biblioteca genómica HindIII y se identificaron seis clones positivos (aproximadamente 0.01%) . Posteriormente se preparó el DNA a partir de dos clones independientes (A5 y B2) . La Figura 61 muestra los resultados obtenidos con los clones genómicos positivos A5 y B2 digeridos del HindIII.

Además se utilizaron las bibliotecas REP del cDNA. Se clasificaron aproximadamente 3 x 105 colonias, y se identificaron 5 clones positivos (0.002%) . El DNA se preparó a partir de tres clones independientes (2-3, 4-1 y 5-20) . En los últimos experimentos, se determinó que los clones 2-3 y 5-20 contenían insertos idénticos.

iv) PCR de 5'RT

Como la versión del cDNA del gene producido para este punto no estaba completa, se llevó a cabo un PCR de 5'RT para obtener un clon de longitud completa. La estrategia se muestra esquemáticamente en la Figura 62. En este experimento, se preparó cDNA utilizando el iniciador del oligonucleótido del DNA "M2-B2" (5'-CAC TGA TCC TTT CTT TTT CGT AAA CGA TAG GT-3') y "M2-B2" (5'-C ATC AAT CAA ATC TTC TTC CAT ATA GAA ATG ACA-3') , designado a partir de regiones conocidas del tezl identificado previamente. Un Adapt SfiI del PCR del enlazador del oligonucleótido con una terminación 5' fosforilada ("P") P-GGG CCG TGT TGG CCT AGT TCT CTG CTC-3'; se ligó posteriormente a la terminación 3' de éste cDNA, y esta construcción se utilizó como el molde para el PCR inclusivo. En la primera ronda del PCR, se utilizaron el Adapt SFI y el M-2B del PCR como los iniciadores; mientras que el Adapt SfiII del PCR (5-GAG GAG GAG AAG AGC AGA GAA CTA GGC CAA CAC GCC CC-3') , y el M2-B2 se utilizaron como iniciadores en la segunda ronda. El PCR inclusivo se utilizó para incrementar la especificidad de la reacción.

v) Alineaciones de la Secuencia Una vez que se identificó la secuencia del tezl, se comparó con las secuencias descritas previamente. La Figura 63 muestra la alineación de los dominio del RT a partir de las subunidades catalíticas de telomerasa del S. pombe ("S.p. Tezlp") , S. cerevisiae ("S.c. Est2p") , y E. aediculatus p123 ("E.a. p123") . En esta Figura, la "h" indica los residuos hidrofóbicos, mientras que "p" indica los residuos polares pequeños, y "c" indica los residuos cargados. Los residuos del aminoácido indicados arriba de la alineación muestran un motivo del RT del concenso conocido del Y. Xiong y T.H. Eickbush (Y. Xiong y T.H. Eickbush, EMBO J., 9:3353, 3362 [1990]) . Los asteriscos indican los residuos que se conservan para las tres proteínas. El "Motivo O" se identifica en la presente y en la Figura 63 como un motivo especifico para esta subunidad de telomerasa y no se encuentra en transcriptasas inversas en general. Por lo tanto es valioso para identificar otras secuencias del aminoácido como subunidades catalíticas de telomerasa.

La Figura 64 muestra la alineación de todas las secuencias a partir del Euplotes ("Ea_p123") , S. cerevisiae ("S.c. Est2p") , y S. pombe ("Sp_Tezlp") . En el Panel A, las áreas sombreadas indican los residuos compartidos entre dos secuencias. En el Panel, las áreas sombreadas indican los residuos compartidos entre las tres secuencias.

vi) Disrupción Genética del tezl En este Ejemplo, se investigaron los efectos de disrupción del tezl. A medida que la telomerasa se implica en el mantenimiento del telómero, se supuso que si el tezl fuera de hecho un componente de la telomerasa, la disrupción del tezl podría provocar un acortamiento gradual del telómero.

En estos experimentos, se utilizó la recombinación homóloga para llevar a cabo la disrupción del gene de tezl en el S. pombe específicamente. Este enfoque se ilustra esquemáticamente en la Figura 65. Tal como se indicó en la Figura 65, el tipo silvestre del tezl fue reemplazado por un fragmento que contenía el marcador ura4 o LEU2.

La disrupción del gene tezl fue confirmada por el PCR (Figura 66) , y se llevó a cabo un manchado Southern para revisar la longitud del telómero. La Figura 67 muestra los resultados del manchado Southern para este experimento. Debido a que está presente un sitio de la enzima de restricción ApaI inmediatamente adyacente a la secuencia telomérica en el S. pombe, la digestión de ApaI de las preparaciones del DNA genómico del S. pombe permite el análisis de la longitud del telómero. De esta manera, el DNA del S. pombe fue digerido con ApaI y los productos de la digestión fueron sometidos a prueba en un gel de agarosa y sondeados con una sonda específica para secuencias teloméricas, con el fin de determinar si los telómeros de las células del S. pombe desintegradas se acortaron. Los resultados se muestran en la Figura 67. A partir de estos resultados, fue obvio que la disrupción del gene del tezl provocó un acortamiento de los telómeros.

Q. Clonación y Caracterización de la Proteína de Telomerasa Humana y el cDNA

En este Ejemplo, se determinó la información de la secuencia del aminoácido y la información nucleica para la telomerasa humana. Primero se identificaron las secuencias homólogas parciales en una investigación BLAST llevada a cabo utilizando las secuencias del ácido nucleico y el péptido 123 kDa del Euplotes, así como las secuencias de la proteína del Schizosaccharomyces y el cDNA correspondiente (tezl) . Las secuencias humanas (también conocidas como "hTCP1.1") fueron identificadas a partir de un clon del cDNA parcial (clon 712562) . Las secuencias derivadas de este clon fueron alineadas con las secuencias determinadas tal como se describió en los ejemplos anteriores.

La Figura 1 muestra la alineación de la secuencia del Euplotes ("p123") , el Schizosaccharomyces ("tezl") , el Est2p (es decir, la proteína del S. cerevisiae codificada por la secuencia del ácido nucleico del Est2, y también referida en la presente como "L8543.12") , y el homólogo humano identificado en esta investigación de comparación. La Figura 51 muestra la secuencia del aminoácido del tezl, mientras que la Figura 52 muestra la secuencia del DNA del tezl. En la Figura 52, los intrones y otras regiones no codificadoras se muestran en el cuadro inferior, mientras que los exones (es decir, las regiones de codificación) se muestran en el cuadro superior.

Tal como se muestra en las Figuras, existen regiones que están altamente conservadas entre estas proteínas. Por ejemplo, tal como se muestra en la Figura 1, existen regiones de identidad en el "Motivo 0", "Motivo 1", "Motivo 2" y "Motivo 3". Los aminoácidos idénticos están indicados con un asterisco (*) , mientras que los residuos similares del aminoácido se indican con un círculo (.) . Esto indica que existen regiones dentro de los motivos de la telomerasa que están conservados entre una amplia variedad de eucariotes que van desde la levadura hasta los ciliados para los humanos. Se contempla que también existen organismos adicionales que contienen estas regiones conservadas de secuencia. La Figura 49 muestra la secuencia del aminoácido parcial de los motivos de la telomerasa humana, mientras que la Figura 50 muestra la secuencia del DNA correspondiente.

La secuenciación del dideoxi de Sanger y otros métodos también se utilizaron, conocidos en la técnica para obtener la información completa de la secuencia del clon 712562. Algunos de los iniciadores utilizados en la secuenciación se muestran en la Tabla 7. Estos iniciadores fueron diseñados para generar híbridos para el clon, en base a la complementariedad de la secuencia para ya sea la secuencia de la columna vertebral del plásmido o la secuencia del inserto del cDNA humano en el clon.

Tabla 7. Iniciadores 25

Iniciador Secuencia TCP1.1 GTGAAGGCACTGTTCAGCG TCP1.2 GTGGATGATTTCTTGTTGG TCP1.3 ATGCTCCTGCGTTTGGTGG TCP1.4 CTGGACACTCAGCCCTTGG TCP1.5 GGCAGGTGTGCTGGACACT TCP1.6 TTTGATGATGCTGGCGATG TCP1.7 GGGGCTCGTCTTCTACAGG TCP1.8 CAGCAGGAGGATCTTGTAC TCP1.9 TGACCCCAGGAGTGGCAGC TCP1.10 TCAAGCTGACTCGACACCG TCP1.11 CGGCGTGACAGGGCTGC TCP1.12 GCTGAAGGCTGAGTGTCC TCP1.13 TAGTCCATGTTCACAATCG

A partir de esos experimentos, se determinó que el inserto EcoRI-NotI del clon 712562 contiene únicamente una configuración del lectura abierta parcial para la proteína de telomerasa humana, a pesar de que puede codificar un fragmento activo de esta proteína. La configuración de lectura abierta en el clon codifica una proteína de 30 aproximadamente 63 kD. La secuencia de la configuración de lectura abierta más grande identificada se muestra en la Figura 68. La ORF inicia en el codón ATG con el "met" indicado en la Figura. La extremidad poli A en la terminación 3' de la secuencia también aparece mostrada. La Figura 69 muestra una alineación tentativa y preliminar de las proteínas de transcriptasa inversa tipo telomerasa a partir de la secuencia humana (Proteína del Núcleo de Telomerasa Humana 1, "Hs TCP1") , el E. aediculatus p123 ("Ep p123") , S. pombe tezl ("Sp Tezl") , el S. cerevisiae EST2 ("Sc Est2") , y la secuencia del concenso. En esta Figura se indican varios motivos.

Para obtener un clon de longitud completa, se utilizó el sondeo de una biblioteca del cDNA y 5'-RACE para obtener los clones que codifican las porciones de las regiones no clonadas previamente. En estos experimentos, la RACE (Amplificación Rápida de las Terminaciones del cDNa; consultar por ejemplo, M.A. Frohman, "RACE: Amplificación Rápida de las Terminaciones del cDNA", en Innis y colaboradores (eds) , Protocolos del PCR: Una Guía para los Métodos y Aplicaciones [1990], pp. 28-30; y Frohman y colaboradores, Proc. Natl. Acad. Sci., 85:8998-9002 [1988]) se utilizó para generar material para el análisis de la secuencia. Se generaron cuatro de estos clones y se utilizaron para ofrecer información adicional de las secuencias 5' (pFWRP5, 6, 19 y 20) .

45 Además, las bibliotecas del cDNA humano (insertadas en lambda) fueron sondeadas con el fragmento del EcoRI-NotI del clon. Un clon de lambda designado como "lambda 25-1.1" (admisión ATCC #209024) , fue identificado como un clon que contenía secuencias complementarias. La Figura 75 muestra un mapa de restricción de este clon de lambda. El inserto del cDNA humano a partir de este clon fue subclonado como un fragmento de restricción EcoRI dentro del sitio EcoRI del fagémido pBluescriptIISK+ (Stratagene) , para crear el plásmido "pGRN121", que fue 50 depositado ante la ATCC (admisión ATCC #209016) . Los resultados preliminares indicaron que el plásmido pGRN121 contiene la secuencia de la configuración de lectura abierta completa (ORF) que codifica la proteína de telomerasa humana.

El inserto del cDNA del plásmido pGRN121 fue secuenciado utilizando técnicas conocidas en el campo. La Figura 70 ofrece un sitio de restricción y un mapa de funciones del plásmido pGNR121 identificado en base a este trabajo preliminar. Los resultados de este análisis de secuencia preliminar se muestran en la Figura 71. A partir de este análisis, y tal como se demuestra en la Figura 70, se identificó un sitio de inicio putativo para la región de codificación en aproximadamente 50 nucleótidos a partir del sitio EcoRI (localizado en la posición 707) , y la ubicación de los motivos específicos de la telomerasa, "FFYVTE", "PKP", "AYD", "QG", y "DD", también se identificó, además de un sitio de paro putativo en el nucleótido #3571 (consultar, Figura 72 que muestra el DNa y las secuencias del aminoácido correspondientes para las configuraciones de lectura abierta en la secuencia ("a", "b" y "c") . Sin embargo, debido a la naturaleza preliminar del primer trabajo de secuenciación, se descubrió que las configuraciones de lectura para los diferentes motivos no estaban en alineación.

Los análisis adicionales llevados a cabo en el pGNR121 indicaron que el plásmido contenía porciones importantes de la terminación 5' de la secuencia de codificación no presente en el clon 712562. Además, se descubrió que el pGNR121 contenía una secuencia de codificación de variante que incluye un inserto de aproximadamente 182 nucleótidos. Se descubrió que este inserto estaba ausente del clon. Al igual que con las secuencias del E. aediculatus, estos variantes pueden someterse aprueba en ensayos funcionales, como por ejemplo los ensayos de la telomerasa para detectar la presencia de telomerasa funcional en una muestra.

El análisis adicional de la secuencia resolvió la secuencia del cDNA del pGRN121 para ofrecer una configuración de lectura abierta contigua que codifica una configuración de peso molecular de aproximadamente 127, 000 dalton, y 1132 aminoácidos tal como se muestra en la Figura 74. En la Figura 73 se suministra un mapa refinado del pGNR121 en base a este análisis. Los resultados del análisis adicional de la secuencia del cDNA de hTRT se presentan en la Figura 16 (Y DE LA SECUENCIA NO:1) .

Ejemplo 2

CORRELACIÓN DE LA ABUNANCIA DE LA hTRT Y LA INMORTALIDAD DE LA CÉLULA

La abundancia relativa del mRNA de la hTRT fue evaluada en seis especies de la célula mortal negativa tipo telomerasa y seis líneas de células inmortales positivas tipo telomerasa (Figura 5) . El nivel de estado constante del mNRA de la hTRT aumentó de manera significativa en las líneas de células inmortales que lo que se había mostrado anteriormente que poseía telomerasa activa. Se detectaron niveles más bajos del mNRA de la hTRT en algunas especias de la célula negativa tipo telomerasa.

El RT-PCR para la hTRT, hTR, TP1 (proteína asociada con la telomerasa relacionada con Tetrahymena p80 [Harrington y colaboradores, 1997, Science 275:973; Nakayama y colaboradores, 1997, Célula 88:875]) y el GAPDH (para normalizar las cantidades iguales del molde del RNA) se llevaron a cabo en el ARN derivado de las siguientes células: (1) GFL de fibroblastos de pulmón fetal humano, (2) GFS de fibroblastos de piel fetal humana, (3) 31YO de fibroblastos estrómicos de próstata adulta, (4) HSF de fibroblastos sinoviales de rodilla fetal humana, (5) BJ de fibroblastos de prepucio neonatal, (6) IMR90 de fibroblastos de pulmón fetal humano, líneas de células inmortalizadas: (7) LOX IMVI de melanoma, (8) U251 de leucemia, (9) carcinoma pulmonar NCI H23, (10) SW620 de adenocarcinoma de colon, (11) MCF7 de tumor de mama, (12) Línea celular de riñon embriónico humano transformado en E1 de adenovirus 293.

El ácido nucleico hTRT fue amplificado a partir del cDNA utilizando los iniciadores del oligonucleótido LT5 y LT6 (Tabla 2) para un total de 31 ciclos (94°C 45 segundos, 60°C 45 segundos, 72°C 90 segundos) . El GAPDH se amplificó utilizando los iniciadores KI36 (5'-CTCAGACACCATGGGGAAGGTGA) y K137 (5'-ATGATCTTGAGGCTGTTGTCATA) para un total de 16 ciclos (94°C 45 segundos, 55°C 45 segundos, 72°C 90 segundos) El hTR se amplificó utilizando los iniciadores F3b (5'-TCTAACCCTACTGAGAA GGGCGTAG) y R3C (5'-GTTTGCTCTAGAATGAACGGTGGAAG) para un total de 22 ciclos (94°C 45 segundos, 55°C 45 segundos, 72°C 90 segundos) . El mRNA de TP1 se amplificó utilizando los iniciadores TP1.1 y TP1.2 durante 28 ciclos (ciclos similares al hTRT) . Los productos de reacción se resolvieron en un gel de poliacrilamida al 8%, se tiñeron con SYBR verde (Sondas Moleculares) y se visualizaron mediante un rastreo en una Storm 860 (Dinámica Molecular) . Los resultados mostrados en la Figura 5, demuestran que los niveles del mRNA de la hTRT se correlacionan directamente con los niveles de actividad de la telomerasa en las células sometidas a prueba.

Ejemplo 3

CARACTERIZACIÓN DE UNA SECUENCIA INTRÓNICA DE LA hTRT

Un intrón putativo se identificó primero mediante la amplificación por PCR de DNA genómico humano, conforme a los descrito en este ejemplo, y posteriormente fue confirmado mediante la secuenciación del clon genómico AG<5 (consultar Ejemplo 4) . La amplificación del PCR se llevó a cabo el iniciador delantero TCP1.57 acoplado individualmente con los iniciadores inversos TCP1.46, TCP1.48, TCP1.50, TCP1.52, TCP1.54, TCP1.56 Y TCP1.58 (consultar Tabla 2) . Los productos del DNA genómicos de las amplificaciones TCP1.57/TCP1.46, TCP1.48, TCP1.50, TCP1.52, TCP1.54 o TCP1.56 fueron aproximadamente 100 pares base mayores que los productos de las amplificaciones pGRN121. La amplificación del TCP1.57/TCP1.58 fue al misma en el DNA genómico o pGRN121. Esto indicó que el DNA genómico contenía una inserción entre los sitios para TCP1.58 y TCP1.50. Los productos del PCR de TCP1.57/TCP1.50 y TCP1.57/TCP1.52 fueron secuenciados directamente, sin subclonación utilizando los iniciadores TCP1.39, TCP1.57 y TCP1.49.

Tal como se muestra a continuación, la secuencia intrónica base 104 (Y DE SECUENCIA NO: 7) se inserta en el mRNA de la hTRT (mostrado en negritas) en la unión correspondiente a las bases 274 y 275 de la Figura 16:

CCCCCCGCCGCCCCCTCCTTCCGCCAG/GTGGGCCTCCCCGGGGTCGGCGTCCGGCTGGGGTTGAGGGCGGC CGGGGGGAACCAGCGACATGCGGAGAGCAGCGCAGGCGACTCAGGGCGCTTCCCCCGCAG/GTGTCCTGCCT GAAGGAGCTGGTGGCCCGAGTGCTGCAG

El "/" indica las uniones emplamadas; la secuencia muestra buenas concordancias con las secuencias del sitio de ampalme 5' y 3' del concenso, típicas para intrones humanos.

Este intrón contiene motivos característicos de un sitio de disociación II de topoisomerasa y un sitio de enlace NFKB (consultar Figura 21) . Estos motivos son interesantes, en parte, debido a que la expresión de la topoisomerasa II está regulada en la mayoría de los tumores. Funciona para relajar el DNA cortando y enrollando el DNa, incrementando de esta manera la expresión de genes particulares. Se ha observado que los inhibidores de la topoisomerasa II trabajan como agentes antitumores. En el caso del NFKB, este factor de transcripción puede desempeñar una función importante en la regulación de la telomerasa durante la diferencianción terminal, como por ejemplo en la represión oportuna de la telomerasa durante el desarrollo y por lo tanto, es otro objetivo para la intervención terapéutica regular la actividad de la telomerasa en las células.

Ejemplo 4

CLONACIÓN DEL FAO LAMBDA G<5 Y CARACTERIZACIÓN DE LAS SECUENCIAS GENÓMICAS DE LA hTRT

A. Lambda G<5

Se clasificó una biblioteca del DNA genómico humano mediante PCR e hibridación para identificar un clon genómico que contenía las secuencias de codificación del ARN de la hTRT. La biblioteca era una biblioteca genómica de fibroblásto humano elaborada utilizando el DNA a partir de células del fibroblásto pulmonar W138 (Stratagene, Cat #946204) . En esta biblioteca, se ligaron fragmentos del Sau3AI parciales en el sitio XhoI del vector lambda FIX®II (Stratagene) , con un tamaño de inserto de 9-22 kb.

La biblioteca genómica se dividió en agrupaciones de 150, 000 fagos cada una y cada agrupación se clasificó mediante un PCR inclusivo (par del iniciador externo TCP1.52 y TCP1.57) ; par interno TCP1.49 y TCP1.50, cosultar Tabla 1) . Estos pares del iniciador se extienden sobre un intrón putativo (consultar Ejemplo 3, supra) en el DNA genómico de la hTRT y garantizaron que el producto del PCR fuera derivado de una fuente genómica y no de contaminación por parte del clon del cDNA de la hTRT. Posteriormente las agrupaciones positivas se subdividieron hasta obtener una agrupación de 2000 fagos. Esta agrupación se anodizó a baja densidad y se clasificó mediante hibridación con un fragmento del DNA que incluía pares base 1552-2108 de la Figura 16 (sitios de restricción SphI y EcoRV, respectivamente) .

Dos clones positivos se aislaron y se volvieron a clasificar por medio de un PCR inclusivo como se describió anteriormente. Ambos clones fueron positivos mediante PCR. Unos de los clones (AG<5) fue digerido con NotI, revelando un tamaño de inserto de aproximadamente 20 kb. El mapeo subsecuente (consultar abajo) indicó que el tamaño del inserto era de 15 kb y que el fago G<5 contiene aproximadamente 13 kb de DNa en sentido ascendente a partir del sitio de inicio de la secuencia del cDNA.

El fago G<5 se trazó mediante mapeo por medio de la digestión de la enzima de restricción y la secuenciación del DNa. El mapa resultante se muestra en la Figura 7. El DNa del fago fue digerido con NcoI y los fragmentos se clonaron en pBBS167. Los subclones resultantes fueron clasificados mediante PCR para identificar aquellos que contenían la secuencia correspondiente a la región 5' del cDNA de la hTRT. Un subclon (pGRN140) que contenía 9 kb del fragmento NcoI (con la secuencia del gene de la hTRT y 4-5 kb de la secuencia del vector lambda fue secuenciado parcialmente para determinar la orientación del inserto. El pGRN 140 fue digerido utilizando SalI para eliminar las secuencias del vector lambda, lo que dio como resultado pGRN144. Posteriormente se sometió a secuenciación el pGRN144. Los resultados de la secuenciación se suministran en la Figura 21. La terminación 5' del mRNA de la hTRT corresponde a la base 2441 de la Figura 21. Tal como se indica en la Figura 7, dos elementos de la secuencia Alu están localizados en los pares 1700 en sentido ascendente de la terminación 5' del cDNA de la hTRT y ofrece un límite probable en sentido ascendente haca la región del promotor de la hTRT. La secuencia también revela un intrón posicionado en las bases 4173 en la Figura 21, 3' al intrón descrito en el Ejemplo 3, supra.

B. Clones Genómicos Adicionales Además del clon genómico descrito anteriormente, se suministran dos clones del bacteriófago P1 y un clon BAC humano a título ilustrativo. Los insertos P1 por lo general son de 75-100 Kb y los insertos BAC por lo general son mayores a 100 Kb.

Los clones P1 (DMPC-HFF#1-477 (F6) -GS#15371 y DMPC-HEF#1-1103 (H) -GS#15372) fueron obtenidos mediante la clasificación por PCR de una biblioteca P1 humanda derivada de células de fibroblasto de prepucio humano (Shepherd y colaboradores, 1994, PNAS USA 91:2629) utilizando los iniciadores TCP1.12 y UTR2 que amplifican la terminación 3' de la hTRT. Estos clones fueron ambos negativos (no pudieron amplificarse) con los iniciadores que amplifican la terminación 5' de la hTRT.

El clon BAC humano (326 E 20) fue obtenido con una pantalla de hibridación de una biblioteca genómica humana BAC utilizando un fragmento de 1143 bp Sph1/Xmm1 de pGRN121 (Figura 16; bases 1552-2695) que incluye la región del motivo RT. Se cree que el clon incluye la terminación 5' del gene. Se cree que los clones genómicos de la hTRT en este ejemplo incluyen todo el gen de la hTRT.

Ejemplo 5

UBICACIÓN CORMOSÓMICA DEL GENE hTRT

El gene de hTRT fue localizado para el cromosoma 5p mediante un mapeo de híbridos de radiación (Boehnke y colaboradores, 1991, Am J Hum Genet 49:1174; Walter y colaboradores, 1994, NAturaleza Genética 7:22) utilizando el panel G3 Stanford de resolución de medios de los clones 83 RH del genoma humano completo (creado en el Centro del Genoma Humano de Stanford) . Se expuso una línea de células del linfoblastóide humano (donante rM) a 10, 000 tads de rayos x y posteriormente se fundió con células receptoras de hámster no irradiadas (A3) . Se aislaron ochenta y tres clones híbridos de la célula somática independiente, y cada uno represente un evento de fusión entre una célula del donante irradiado y una célula del hámster receptor. El panel del DNA G3 fue utilizado para ordenar los marcadores en la región de interés así como para establecer la distancia entre estos marcadores.

Los iniciadores utilizados para el mapeo RH fueron TCP1.12 y UTR2 con condiciones de amplificación de 94°C durante 45 segundos, 55°C durante 45 segundos, 72°C durante 45 segundos, por 45 ciclos utilizando el amortiguador Taq de Boehringer Mannheim y el Taq de Perkin-Elmer. Las 83 agrupaciones fueron amplificadas de manera independiente y 14 (17%) se clasificaron positivas para la hTRT (mediante la aparición de una banda de 346 bp) . Los resultados de la amplificación fueron enviados al servidor RH de Stanford, que posteriormente proporcionó la ubicación del mapa, 5p, y el marcador más cercano, STS D5S678.

Al consultar el sitio de la red de mapeo de genomas Geneton, la ubicación del mapa identificó un YAC que contiene el marcador del STS D5S678: CEPH YAC 780_C_3 tamaño: 390, 660 kb. Esta YAC también contenía marcadores del cromosoma 17. Este resultado indicó que el gene de hTRT se encuentra en el cromosoma 5, cerca del extremo telomérico. Existen números de copia creciente de 5p en un número de tumores. También se mapeo el síndrome de "Cri-du-chat" (llanto de gato) para eliminaciones en esta región.

Ejemplo 6

DISEÑO Y CONSTRUCCIÓN DE VECTORES PARA EXPRESIÓN DE LAS PROTEÍNAS DE hTRT Y

POLINUCLEÓTIDOS

Expresión de la hTRT en Bacterias La siguiente parte de este ejemplo detalla el diseño de los vectores de expresión de la célula eucariotica y bacterial que expresa la hTRT, para producir grandes cantidades de hTRT biológicamente activo, de longitud completa. La generación de proteína de hTRT biológicamente activa de esta forma, es útil para los ensayos de reconstitución de la telomerasa, el ensayo para los moduladores de actividad de la telomerasa, el análisis de la actividad de especies recién aisladas de hTRT, la identificación y aislamiento de compuestos que se asocian específicamente con la hTRT, el análisis de la actividad de una proteína variante de hTRT que ha sido mutada específicamente en el sitio, y como sustancia inmunógena, como unos cuantos ejemplos.

Vector de Expresión Bacterial pThioHis A/hTRT

Para producir grandes cantidades de hTRT de longitud completa, se seleccionó el vector de expresión bacterial pThioHis A (Invitrogen, San Diego, CA) como sistema de expresión. El inserto con codificación de hTRT incluye los nucleótidos 707 al 4776 del inserto de hTRT en el plásmido pGRN121. Esta secuencia del nucleótido incluye la secuencia de codificación completa para la proteína hTRT.

Este vector de expresión de la invención está diseñado para la expresión inducible en las bacterias. El vector puede ser inducido para expresar, en E. coli, niveles altos de una proteína de fusión compuesta de una mitad de tioredoxina etiquetada como HIS disociable, y la proteína de hTRT de longitud completa. El uso del sistema de expresión estuvo de acuerdo completamente con las instrucciones del fabricante. La secuencia del aminoácido de la proteína de fusión codificada por el vector resultante de la invención se muestra a continuación; (-*-) denota un sitio de disociación de enterocinasa:

MSDKIIHLTDDSFDTDVLKADGAILVDFWAHWCGPCKMIAPILDEIADEYQGKLTVAKRIDHNPGTAPKIGIRGITTLLLF KNGEVAATKVGALSKGQLKEFLDANLAGSGSGDDDDK-*-VPMHELEIFEFAAASTQRCVLLRTVEALATATPAMPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGD PAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRR LGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGF CVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFL LSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLERLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAA GVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRASLRRLVPPGLWGSRHNERRFLRNTKKFISLGK HAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFY RKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERL TSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIK PQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVLRF MCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENQLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGV PEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGR NMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILK ANAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVTLLGSLRTAQTQLSRQLPGTTLTALEAAANPALPSD FKTILD

pGEX-2TK con los Nucleótidos de hTRT 3272 al 4177 del pGRN121

Esta construcción de la invención se utiliza para producir la proteína de fusión para, por ejemplo, el propósito de elevar los anticuerpos policlonales y monoclonales para la proteína de hTRT. Los fragmentos de hTRT también pueden utilizarse para otros propósitos, como por ejemplo, para modular la actividad de la telomerasa, por ejemplo, como mutante negativo dominante o para prevenir la asociación de un componente de telomerasa con otras proteínas o ácidos nucleicos.

Para producir grandes cantidades de un fragmento de proteína de hTRT, se seleccionó el vector de expresión de E. coli pGEX-2TK (Pharmacia Biotech, Piscataway N.J) y se utilizó esencialmente de acuerdo con las instrucciones del fabricante para elaborar un vector de expresión de la invención. La construcción resultante contiene un inserto derivado de los nucleótidos 3272 al 4177 en el inserto de hTRT en el plásmido pGRN121. El vector dirige la expresión en E. coli de niveles altos de una proteína de fusión compuesta por la secuencia glutatión-S-transferasa (subrayada abajo) , la secuencia de disociación de trombina (con subrayado doble) , la secuencia de reconocimiento para la cinasa de la proteína del músculo cardíaco (con itálicas) , los residuos introducidos mediante la clonación ([GSVTK]) y el fragmento de la proteína hTRT (en negritas) tal como se muestra a continuación:

MSPILGYWKIKGLVOPTRLLLEYLEEKYEEHLYERDGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDA LDVVLYMDPMCDAFPKLVCFKKRIEAITQIDKYLKSSKYIAWPLOGWOATFGGGDHPPKSDLVPRGSRRASV[GSVTK] IPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVE DEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASVTFNRGFKAGRNMRRKLFGVLRLKCHSLFL VLQVNSLQTVCTNIYKILLLQAYRFHACBLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLP SEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD

Cuando se expresó esta proteína de fusión, formó agregados insolubles. Fue tratada en general tal como se describió anteriormente, en la sección titulada purificación de proteínas a partir de cuerpos de inclusión. Específicamente, las células inducidas fueron suspendidas en PBS (20 mM de fosfato sódico, pH 7.4, 150 mM de NaCl) y se desintegraron mediante sonicación. Se agregó NP-40 a 0.1%, y la mezcla se incubó durante 30 minutos a 4°C con un mezclado ligero. El material insoluble se recopiló mediante centrifugación a 25, 000 g durante 30 minutos a 4°C. El material insoluble se lavó una vez en 4M de urea en PBS, se recolectó mediante centrifugación y posteriormente se lavó otra vez en PBS. Se calculó que la píldora recolectaba contenía más del 75% de la proteína de fusión. Este material se secó en un vacío de velocidad, después se suspendió en adyuvante para inyectar a ratones y conejos para la generación de anticuerpos. La separación de la proteína recombinante de la mitad de glutatión-S-trasferasa se logra mediante una proteólisis específica en el sitio utilizando trombina de acuerdo con las instrucciones del fabricante.

pGEX-2TK con los Nucleótidos de hTRT 2426 al 3274 del pGRN121 con HIS-8 Tag Para producir grandes cantidades de un fragmento de hTRT, se preparó otra construcción del pGEX-2TK del vector de expresión de E. coli. Esta construcción contiene un inserto derivado de los nucleótidos 2426 al 3274 del inserto de hTRT en el plásmido pGRN121 y una secuencia que codifica ocho residuos de histidina consecutivos (HIS-8 Tag) . Para insertar el HIS-8 TAG, el vector pGEX-2TK con los nucleótidos de hTRT 2426 al 3274 del pGNR121 se linealizaron con BamH1. Esto abrió el plásmido en la unión entre la finasa de la proteína GST-trombina-músculo cardíaco y la secuencia de codificación de hTRT. Un oligonucleótido de doble filamento con extremos compatibles de BamH1 se ligó con el plásmido linealizado resultante en la introducción dentro de la configuración de ocho residuos de histidina en sentido ascendente de la secuencia de hTRT.

El vector dirige la expresión en E. coli de altos niveles de una proteína de fusión compuesta por la secuencia de glutatión-S-transferasa (subrayada) ; la secuencia de disociación de trombina (con subrayado doble) , la secuencia de reconocimiento para la cinasa de la proteína del músculo cardíaco (con itálicas) , un conjunto de tres y un conjunto de cinco residuos introducidos mediante clonación que se encuentran en ([GSV]) y ([GSVTK]) ; ocho histidinas consecutivas (también con subrayado doble) ; y el fragmento de la proteína de hTRT (en negritas) :

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKH NMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYD ALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAVPLQGWQATFGGGDHPPKSDLVPRGSRRASV[GSV] HHHHHHHH[GSVTK]MSVYVVELLRSFFYVTETTFQKNRLFFYRPSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHRE ARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRA WRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLT DLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGI

Cada uno de los vectores pGEX-2TK de la invención pueden utilizarse para producir la proteína de fusión con el propósito de elevar los anticuerpos policlonales y monoclonales para la proteína de hTRT. Adicionalmente, esta proteína de fusión puede utilizarse para purificar por afinidad los anticuerpos elevados a los péptidos de hTRT que están incluidos dentro de la proteína de fusión. La separación de la proteína recombinante de la mitad de glutatiónS-transferasa puede lograrse mediante la proteólisis específica del sitio utilizando trombinas de acuerdo con las instrucciones del fabricante.

pGEX-2TK con los Nucleótidos de hTRT del 2426 al 3274 de pGRN121, sin HIS-Tag

Para producir grandes cantidades de un fragmento de hTRT, se preparó la construcción del pGEX-2TK del vector de expresión de E. coli.

Esta construcción contiene un inserto derivado de los nucleótidos 2426 al 3274 del inserto de hTRT en el plásmido pGRN121, pero sin la HIS-8 Tag de la construcción descrita anteriormente. El vector dirige la expresión en E. coli de altos niveles de una proteína de fusión compuesta por glutatión-S-transferasa (subrayado) , secuencia de disociación de trombina (con subrayado doble) , la secuencia de reconocimiento para la cinasa de la proteína del músculo cardíaco (con itálicas) , residuos introducidos mediante la clonación en corchetes ([GSVTK]) y el fragmento de la proteína hTRT (en negritas) :

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTOSMAIIRYIADKH NMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYD ALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSRRASV[GSV TK]MSVYVVELLRSFFYVTETTFQKNRLFFYRPSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIP KPDGLRPIVNMDYVVGARTFRREKRAERLTSRKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPP PEYFVKVDVTGAYDTIPQDLTEVIASIIKPQNTYCVRRYAVVQKAAHGVRKAFKSHVVSTLTDLQPYMRQFVAHLQETS PLRDAVVIEQSSSLNEASGLFDVFLRFMCHHAVRIRGKSYVQCQGI

pGE-2TK con los Nucleótidos de hTRT del 1625 al 2458 de pGRN121

Para producir grandes cantidades de un fragmento de proteína de hTRT se preparó la construcción del pGEX-2TK de otro vector de expresión de E.coli.

Esta construcción contiene un inserto derivado de los nucleótidos 1625 al 2458 del inserto de hTRT en el plásmido pGRN121. El vector dirige la expresión en E. coli de altos niveles de una proteína de fusión compuesta por glutatiónS-transferasa (subrayado) secuencia de disociación de trombina (con subrayado doble) , la secuencia de reconocimiento para la cinasa de la proteína del músculo cardíaco (con itálicas) , los residuos introducidos mediante clonación en corchetes ([GSVTK]) y el fragmento de la proteína hTRT (en negritas) :

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTOSMAIIRYIADKH NMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYD ALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSRRASV[GSV TK]ATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPVVDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLT GARRLVETIFLGSRPWMPGTRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQ GSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKISLGKHAKLSLQELT WKMSVRDCAWLRRSPGVGCVAAEHRLREEILAKFLHWLMSVYVVELLRS

pGEX-2TK con los Nucleótidos de hTRT del 782 al 1636 del pGRN121

Para producir grandes cantidades de un fragmento de proteína de hTRT se preparó otra construcción del pGEX-2TK del vector de expresión de E.coli Esta construcción contiene un inserto derivado de los nucleótidos 782 al 1636 del inserto de hTRT en el plásmido pGRN121. El vector dirige la expresión en E. coli de altos niveles de una proteína de fusión compuesta de glutatiónS-transferasa (subrayado) , secuencia de disociación de trombina (con subrayado doble) , secuencia de reconocimiento para la cinasa de la proteína del músculo cardíaco (con itálicas) , residuos introducidos mediante la clonación en corchetes ([GSVTK]) y el fragmento de la proteína hTRT (en negritas) :

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTOSMAIIRYIADKH NMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYD ALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSRRASV[GSV TK]MPRAPRCRAVRSLLSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPAAPSFRQVS CLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEATTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLL ARCALFVLVAPCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSAS RSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSL

pT7FlhTRT con el cDNA de hTRT Carente de la Secuencia No Codificada de 5'

Tal como se describió anteriormente, en una forma de realización, la invención proporciona un hTRT que se modifica de una manera específica en el sitio para facilitar la clonación en vectores de expresión bacterial, mamífera de levadura y de insectos sin ninguna secuencia de hTRT traducida de 5'. En algunas circunstancias, al reducir la cantidad de la secuencia de codificación sin proteína, se permite la producción mejorada de la proteína (rendimiento) y una estabilidad creciente del mRNA. En esta forma de realización de la invención, la región de no codificación de 5' del gene de hTRT se retiró antes de la clonación en un vector de expresión bacterial.

Esto se llevó a cabo mediante la ingeniería de un sitio de endonucleasa de restricción adicional justo en sentido ascendente (5') al codón de inicio (ATG) de la secuencia de codificación de hTRT (Figura 16) . La creación de un sitio de restricción justo a 5' con la región de sodificación de la proteína permite la producción eficiente de una amplia variedad de vectores que codifican las proteínas de fusión, como por ejemplo las proteínas de fusión que incluyen las etiquetas y TAGs del péptido, para inmunodetección y purificación.

Específicamente, el oligonucleótido 5'-CCGGCCACCCCCCATATGCCGCGCGCTCCC-3' se utilizó como se describió anteriormente para modificar el cDNA de la hTRT, nucleótidos 779 al 781 del cDNA de la hTRT (Figura 16) desde el GCG al CAT. Estos 3 nucleótidos son los tres últimos nucleótidos antes del codón de inicio ATG, por lo tanto no modifican la secuencia de la proteína. El cambio en la secuencia da como resultado la creación de un sitio de restricción único NdeI en el cDNA de la hTRT. Se utilizó el DNA de hTRT de un solo filamento como fuente de DNA para la mutagénesis dirigida en el sitio. El plásmido resultante fue secuenciado para confirmar el éxito de la mutagénesis.

Esta modificación permitió la construcción del siguiente plásmido de la invención, designado como pT7FLhTRT. La secuencia hTRT modificada específicamente en el sitio (añadidura del sitio de restricción NdeI) fue digerida con NdeI y NotI para generar un hTRT que codifica un fragmento del ácido nucleico. El fragmento fue clonado posteriormente dentro de un plásmido de pSL 3418 digerido previamente por restricción con NdeI y SmaI (también un cortador de extremos desafilados) . El pSL3418 es un plásmido modificado de pAED4 dentro del cual se inserta una secuencia FLAG (Immunex Corp, Seattle WA) y una secuencia de enterocinasa justo en sentido ascendente desde el sitio NdeI antes mencionado. Este plásmido, designado como pT7FLhTR, permite la expresión de la hTRT de longitud completa (con una Bandera - Etiqueta en su terminación 5') en una especia de E. coli que expresa la polimerasa del ARN T7.

Plásmidos con cDNA de hTRT Carente de Código No codificado de 3'

Tal como se discutió anteriormente, la invención proporciona vectores de expresión que contienen ácidos nucleicos que codifican TRT en donde algunas o todas las secuencias que no tienen codificación han sido eliminadas. En algunas circunstancias, reducir la cantidad de la secuencia de codificación sin proteína permite una producción mejorada de la proteína (rendimiento) e incrementa la estabilidad del mRNA. En esta forma de realización de la invención, se elimina la región no traducida de 3' de la hTRT antes de la clonación dentro de un plásmido de expresión bacterial.

El plásmido pGRN121, que contiene el cDNA de hTRT de longitud completa tal como se explicó anteriormente, se borró primero de todos los sitios Apal. Esto fue seguido por la eliminación del fragmento de la enzima de digestión por restricción de hTRT MscI-HincII, que contiene el 3'UTR. El fragmento de digestión por restricción NcoI-XbaI contiene el codón de paro de hTRT se insertó posteriormente dentro del sitio NcoI-XbaI del pGRN121 para producir un plásmido equivalente al pGRN121, designado como pGNR124, con excepción de que carece del 3'UTR. Vectores de Expresión Bacterial que Utilizan Marcadores de Selección de Antibióticos.

La invención también proporciona vectores de expresión bacterial que pueden contener marcadores de selección para conferir un fenotipo seleccionable en las células transformadas y las secuencias que codifican el mantenimiento y la duplicación episómicas, de tal forma que no se requiere la integración dentro del genoma huésped. Por ejemplo, el marcador puede codificar la resistencia al antibiótico, en particular la resistencia al cloranfericol (consultar Harrod (1997) Res. Ácidos Nucleicos 25: 1720-1726) , kanamicina, G418, bleomicina e higromicina, para permitir la selección de aquellas células transformadas con las secuencias del DNA deseadas, consultar por ejemplo, Blondelet-Rouault (1997) Gene 190:315-317, y Mahan (1995) Proc Natl Acad Sci USA 92:669-673.

En otra forma de realización de la invención, la hTRT de longitud completa fue clonado dentro de un vector del plásmido BlueScript modificado (Stratagene, San Diego, CA) , designado como pBBS235, dentro del cual había sido insertado un gene de resistencia al antibiótico de cloranfenicol. El fragmento NotI del pGRN124 (explicado anteriormente) contenía la hTRT ORF dentro del sitio NotT del pBBS235 de tal forma que la TRT ORF se encuentra en orientación opuesta del promotor Lac del vector. Esto da como resultado un plásmido que es adecuado para la mutagénesis de los insertos del plásmido. Como por ejemplo los ácidos nucleicos de TRT de la invención. Esta construcción del plásmido, designada como pGRN125, puede utilizarse en los métodos de la invención que implican la mutagénesis de la enzima de telomerasa y las secuencias de codificación de a proteína TRT y para la transcripción in vitro de la hTRT utilizando el promotor T7 (y la transcripción in vitro de la hTRT antisensorio utilizando el promotor T3) .

En otra forma de realización de la invención, los fragmentos de la digestión por restricción NotI del pGRN124 que contiene la hTRT ORF, fueron subclonados dentro del sitio NotI del pBBS235 (descrito anteriormente) , de tal forma que la TRT ORF se encuentra en la misma orientación que el promotor Lac del vector. Esto da como resultado un plásmido, designado como pGRN126 que puede utilizarse para la expresión de la hTRT de longitud completa en E, coli. El producto expresado incluirá 29 aminoácidos codificados por el vector pBBS235, seguidos por 18 aminoácidos codificados por el 5'UTR de la hTRT seguidos por la proteína de hTRT de longitud completa.

En otra forma de realización más de la invención, se llevó a cabo la mutagénesis in vitro del pGRN125 para convertir el codón de ATG iniciador de hTRT dentro de un concenso Kozak y crear los sitios de digestión por restricción EcoRI y BgIII, para facilitar la clonación dentro de los vectores de expresión. El oligonucleótido 5'-TGCGCACGTGGGAAGCCCTGGC agatctgAattCcaCcAATGCCGCGCGCTCCCCGCTG-3' (nucleótidos alterados en el cuadro inferior) se utilizó en el procedimiento de mutagénesis. El vector de expresión resultante fue designado como pGNR127.

En otra forma de realización de la invención, el segundo Asp del "motivo DD" de TRT, fue convertido en una alanina para crear una enzima de telomerasa no funcional, creando de esta manera una proteína de TRT mutante para utilizarse como un mutante dominante/negativo. La secuencia de codificación de hTRT fue mutagenisada in vitro utilizando el oligonucleótido 5'-CGGGACGGGCTGCTCCTGCGTTTGGTGGAcGCgTTCTTGTT GGTGACACCTCACCTCACC-3' para convertir el codón de asparagina para el residuo 869 (Asp869) en un codón de alanina (Ala) . Esto también creó un sitio de la enzima de restricción MluI. El plásmido de expresión resultante fue designado como pGRN130, que también contiene la secuencia de concenso Kozak tal como se describió para el pGRN127.

La invención también proporciona un vector designado para expresar un fragmento de la secuencia antisensoria de la hTRT. El plásmido del pGRN126 fue cortado hasta completarlo con las enzimas de restricción MscI y SmaI, y se volvió a ligar para eliminar más del 95% de la hTRT ORF. Un fragmento de SalI-McsI fue reinsertado durante el proceso para crear la actividad CAT. Este plásmido no purificado volvió a digerirse posteriormente con SalI y EcoRI y el fragmento que contienen el codón de iniciación del hTRT ORF fue insertado dentro de los sitios SalI-EcoRI del pBBS212 para elaborar un plásmido de expresión antisensorio que expresa la secuencia antisensoria que se extiende sobre los residuos pares de 73 bases y 5'UTR de la hTRT ORF (en las células mamíferas) . Este plásmido fue designado como pGRN135.

Expresión de la Telomerasa de hTRT en la Levadura La presente invención también proporciona vectores de expresión de la levadura con la expresión de hTRT para producir grandes cantidades de hTRT biológicamente activa, de longitud completa.

Vector de expresión de Pichia pastoris pPICZ B y hTRT de longitud completa Para producir grandes cantidades de hTRT biológicamente activo, de longitud completa, se seleccionó el vector de expresión de Pichia pastoris pPICZ B (Invitrogen, San Diego, CA) . El inserto de la secuencia con codificación de hTRT se derivó a partir de los nucleótidos 659 al 4801 del inserto de hTRT en el plásmido pGRN121. Esta secuencia del nucleótido incluye la secuencia de longitud completa que codifica la hTRT. Este vector de expresión está diseñado para la expresión inducible en el P. pastoris de altos niveles de la proteína de hTRT no modificada, de longitud completa. La expresión es activada por un promotor de la levadura, pero la secuencia expresada utiliza los codones de iniciación y terminación de la hTRT. No se introdujeron codones exógenos mediante la clonación. El vector pPICA B/hTRT resultante se utilizó para transformar la levadura.

Vector de Expresión del Pichia pastoris hTRT/Hic6/pPICZ B

Un segundo vector de expresión del Picha pastoris de la invención derivado del pPICZ B también contiene la secuencia de longitud completa que codifica la hTRT derivado de los nucleótidos 659 al 4801 del inserto de la hTRT en el plásmido pGRN121. Este vector de expresión hTRT-His6/pPICZ B codifica la proteína de hTRT de longitud completa fusionada en su término C a las secuencias de la etiqueta del informador His6 y epítopo Myc. El codón de paro hTRT ha sido extraído y reemplazado por las secuencias del vector que codifican el epítopo Myc y la etiqueta del informador His6 así como un codón de paro. Este vector está designado para dirigir la expresión inducible de alto nivel en la levadura de la siguiente proteína de fusión, que está formada por la secuencia de la hTRT (subrayada) las secuencias del vector en corchetes ([NSAVD] y [L]) , el epítopo Myc (subrayado doble) , y la etiqueta His6 (en itálicas) :

MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVS CLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHL LARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGS ASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRO HHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRL PRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQH SSPWQVYGFVRACLRRLVEPGLWGSRHNRRFLRNTKKFISLGKHAKLSLQELTWKMSRDCAWLRRSPGVGCVPAA EHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHR EARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRA WRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPONTYCVRRYAVVQKAAHGHVRKAFKSHVSTLT DLQPYMERQFVAHLQETSPLRDAVVIEOSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSL CYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVNFPVEDEALGGTAFVQMP AHGLFTWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNI YKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFL LKLTRHRVTYVPLLGSLRTAQTQLSRQKLPGTTLTALEAAANPALPSDFKPILD[L]EQKLISEEDL[NSAVD]HHHHHH

Expresión de la hTRT en Células de Insectos La presente invención también proporciona vectores de expresión de células de insectos con expresión de la telomerasa de la hTRT, que producen grandes cantidades de hTRT biológicamente activo, de longitud completa.

Vector de Expresión del Baculovirus pVL1393 y hTRT de Longitud Completa La secuencia de codificación de la telomerasa de interés fue clonada dentro del vector de expresión del baculovirus pVL1393 (Invitrogen, San Diego, CA) . Esta construcción fue cotransfectada subsecuentemente dentro de células de Spodoptera fungupeida (sf-9) con el DNA linealizado a partir del virus de polihedrosis nuclear de Autograph california (Baculogold-AcMNPV) . Los baculovirus recombinantes obtenidos fueron purificados en placas posteriormente y se expandieron siguiendo los protocolos estándares.

Este vector de expresión ofrece la expresión en células de insectos de altos niveles de proteína de HTRT de longitud completa. La expresión es activada por un promotor del gene de polihedrina baculoviral. No se introdujeron codones exógenos por medio de la clonación.

Vector de Expresión del Baculovirus pBlueBacHis2 B y hTRT de Longitud Completa Para producir grandes cantidades de hTRT biológicamente activo, de longitud completa, se seleccionó el vector de expresión de baculovirus pBlueBacHis2 B (Invitrogen, San Diego, CA) como una fuente de elementos de control. El inserto con codificación de la hTRT estaba formado por los nucleótidos 707 al 4776 del inserto de hTRt en el plásmido pGRN121.

También se construyó un hTRT de longitud completa con las etiquetas His6 y Anti-Xpress (Invitrogen) . Este vector también contiene un inserto formado por los nucleótidos 707 al 4776 del inserto de hTRT a partir del plásmido pGRN121. El vector dirige la expresión en las células de insectos de altos niveles de la proteína de hTRT de longitud completa fusionada con las etiquetas de 6-histidina y Anti-Xpress disociables, y la secuencia del aminoácido de la proteína de fusión se muestra a continuación; (-*-) denota el sitio disociación de la enterocinasa:

MPRGSHHHHHHGMASMTGGQQMGRDLYDDDDL-*-DPSSRSAAGTMEFAAASTQRCVLLRTWEALAPATPAMPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQ RGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFT TSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGP RRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSD RGFCVVSPARPAEEATSLAGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRP SFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLERLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRASLRRLVPPGLWGSRHNERRFLRNTKKFIS LGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRL FFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRA ERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIA SIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDV LRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENQLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLV RGVPEYGCVVNLRKTVVFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKA GRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYS ILKANAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVTLLGSLRTAQTQLSRQLPGTTLTALEAAANPALP SDFKTILD

Vector de Expresión del Baculovirus pBlueBac4.5 y Proteína hTRT de Longitud Completa Para producir grandes cantidades de hTRT biológicamente activo, de longitud completa, se construyó un segundo vector de expresión del baculovirus pBlueBac4.5 (Invitrogen, San Diego, CA) . El inserto con codificación de hTRT también estaba formado por los nucleótidos 707 al 4776 de la hTRT a partir del plásmido pGRN121.

Vector de Expresión del Baculovirus pMelBacB y Proteína de hTRT de Longitud Completa Para producir grandes cantidades de hTRT biológicamente activo, de longitud completa, se construyó un tercer vector de expresión del baculovirus, pMelBacB (Invitrogen, San Diego, CA) . El inserto con codificación de hTRT también está formado por los nucleótidos 707 al 4776 del inserto de hTRT a partir del plásmido pGRN121.

El pMelBacB dirige la expresión de hTRT de longitud completa en células de insectos hasta el medio extracelular a través de la vía secretora utilizando la secuencia de la señal de la melitina. De esta manera, se secretan altos niveles de hTRT de longitud completa. La secuencia de la señal de la melitina se disocia después de la excreción, pero es parte del agrupamiento de la proteína que permanece intracelularmente. Por esta razón, se indica en paréntesis en la siguiente secuencia. La secuencia de la proteína de la fusión codificada por el vector se muestra a continuación:

(MKFLVNVALVFMVVYISYIYA) -*-DPSSRSAAGTMEFAAASTQRCVLLRTWEALAPATPAMPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQ RGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFT TSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGP RRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSD RGFCVVSPARPAEEATSLAGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRP SFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLERLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRASLRRLVPPGLWGSRHNERRFLRNTKKFIS LGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRL FFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRA ERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIA SIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDV LRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENQLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLV RGVPEYGCVVNLRKTVVFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKA GRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYS ILKANAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVTLLGSLRTAQTQLSRQLPGTTLTALEAAANPALP SDFKTILD

Expresión de hTRT en Células de Mamíferos La presente invención también proporciona vectores para producir hTRT en grandes cantidades como una proteína biológicamente activa de longitud completa, en una variedad de líneas celulares de mamíferos, que son útiles en varias formas de realización de la invención, tal como se indicó anteriormente.

Plásmidos de Expresión MPSV-hTRT

La invención también proporciona un sistema de expresión para utilizarse en las células de mamíferos que ofrece la mayor expresión posible de la proteína recombinante, como por ejemplo la telomerasa, sin modificar de hecho la secuencia de codificación (por ejemplo, perfeccionando el uso del codón) . En una forma de realización, la invención proporciona plásmidos de expresión en mamíferos MPSV (a partir del plásmido pBBS212, descrito como pMPSV-TM en Lin J-H (1994) Gene 47:287-292) capaces de expresar los TRTs de la invención. Los plásmidos MPSV pueden expresarse ya sea como clones estables o transitorios.

En este sistema de expresión, a pesar de que la secuencia de codificación de hTRT en sí permanece sin cambios, los elementos de control de transcripción exógenos se incorporan dentro del vector. El promotor del virus del sarcoma mieloproliferativo (MPVS) LTR (MPSV-LTR) , ha aumentado por el intensificador del citomelagovirus (CMV) , se incorpora para la iniciación por transcripción. Este promotor muestra de manera consistente niveles de expresión más altos en las líneas celulares (consultar Lin J-H (1994) supra) . Puede incorporarse una secuencia del concenso Kozak para la iniciación de la traducción (consultar Kozak (1996) Genoma de Mamíferos 7:563-574) . Todas las secuencias extrañas de hTRT no traducidas de 5' y 3' pueden eliminarse para garantizar que estas secuencias no interfieran con la expresión, tal como se mencionó anteriormente. El plásmido MPSV que contiene la secuencia de codificación de hTRT completa, con todas las secuencia extrañas incluidas, se designa como pGRN133. También se construyó un control, el plásmido "antisensorio" de hTRT. Este vector es idéntico al pGRN133 con excepción de que el inserto de TRT es la secuencia antisensoria de hTRT (el antisensorio, cuyo control puede utilizarse como vector, se designa como pGRN134) . El plásmido MPSV que contiene la secuencia de codificación de hTRT completa con todas las demás secuencias extrañas eliminadas y que contiene la secuencia del concenso Kozak se designa como pGRN145.

Dos marcadores de selección, PAC (Puromicin-N-acetil-transferasa = Resistencia a la Puromicina) y HygB (Higromicina B = Resistencia a la Higromicina) están presentes para la selección de los plásmidos después de la transfección (consultar la discución que se refiere a los marcadores seleccionables, anteriormente) . La selección doble utilizando marcadores en ambos lados del polienlazador del vector debería incrementar la estabilidad de la secuencia de codificación de hTRT. Una secuencia de codificación DHRF (reductasa de dihidrofolato) se incluye para permitir la amplificación del cassette de expresión después de que se elaboran los clones estables. Otros medios de amplificación de genes también puede utilizarse para incrementar los rendimientos de la proteína recombinante.

La invención también proporciona plásmidos de expresión en mamíferos de MPSV que contiene proteínas de fusión de hTRT. En una forma de realización, la secuencia hTRT, a pesar de que conserva su región no traducida de 5', está enlazada a una bandera del epítopo, como por ejemplo la IBI FLAG (International Biotechnologies Inc. (IBI) , Kodak, New Haven, CT) y se inserta dentro del plásmido de expresión MPSV (designado como pGRN147) . Esta construcción en particular contiene un sitio de iniciación de traducción Kozak. La proteína de fusión expresada puede purificarse utilizando el anticuerpo monoclonal del octapéptido M-1 anti-FLAG (IBI, Kodak, supra)

En otra forma de realización, la hTRT se altera específicamente en el sitio. Un codón del residuo del aminoácido se somete a mutagénesis, cambiando el ácido aspártico en la posición 869 por una alanina. Este mutante Asp869->Ala hTRT, que conserva su región no traducida de 5' y que incorpora una secuencia de Kozak, fue insertado dentro de un plásmido de expresión MPSV, y fue designado como pGRN146. El mutante Asp869->Ala hTRT fue diseñado posteriormente para incluir la secuencia FLAG, tal como se describió anteriormente, y el inserto se clonó dentro de un plásmido de expresión MPSV. Uno de estos plásmidos de expresión está designado como pGRN154-I. Específicamente, para el pGRN154-I, un fragmento de la digestión por restricción Eam1105I del pGRN146 que contiene la "terminación frontal" que contiene la secuencia Kozak (segmento de 5') de hTRT, se clona dentro de los sitios Eam1105I del pGRN147 (consultar arriba) para elaborar un plásmido de expresión MPSV capaz de expresar la hTRT con una secuencia de Kozak, la mutación antes descrita D869->A, y la bandera IBI.

Otra forma de realización de la invención es un plásmido de expresión derivado del pGRN146. El plásmido de expresión de mamíferos, designado como pGRN152, fue generado extirpando el fragmento EcoRI del plásmido pGRN146 (que contiene la hTRT ORF) y fue clonado dentro del sitio EcoRI del pBBS212 para eliminar el 5'UTR de hTRT. La hTRT está orientado de tal forma que su expresión está controlada por el promotor MPSV. Esto da como resultado un plásmido de expresión de mamíferos que expresa la hTRT con una secuencia de concenso de Kozak y la mutación D869->A, y utiliza el promotor MPSV.

La invención proporciona un vector de expresión de mamíferos en el cual la hTRT está orientado de tal forma que la secuencia de codificación de hTRT es activada por el promotor MPSV. Por ejemplo, un fragmento de la digestión por restricción EcoRI del pGRN137 que contiene la configuración de lectura abierta de hTRT (ORF) , fue clonado dentro del sitio EcoRI del pBBS212 (consultar abajo) , eliminando de esta forma la región no traducida de 5' (5'-UTR) de hTRT. El pGRN137 fue construido extirpando un fragmento de SalI-Sse8387I del pGRN130, descrito a continuación, que contiene la mutación Kozak de hTRT dentro de los sitios Sal 1-SSE 8387I del pGRN136, dando como resultado un plásmido de expresión de mamíferos que expresa la hTRT que contiene una secuencia de concenso Kozak fuera del promotor MPSV. El plásmido pGRN136 fue construido extirpando un fragmento HindIII SalI del pGRN126 que contiene la hTRT ORF y clonándolo dentro de los sitios HindIII SalI del plásmido, pBBS242, dando como resultado un plásmido de expresión de mamíferos que expresa la hTRT fuera del promotor MPSV. Esto da como resultado un plásmido de expresión de mamíferos, designado como pGRN145, que expresa la hTRT con una secuencia de concenso Kozak utilizando el promotor MPSV. Consultar también el vector de expresión de mamíferos activado por el promotor pGRN152 MPSV, que se describe a continuación.

hTRT Expresado en 293 Células Utilizando el Vector Episómico pEBVHis Un vector episómico, pEBVHis (Invitrogen, San Diego, CA) fue diseñado para expresar una proteína de fusión de hTRT que incluye hTRT fusionado a una etiqueta del epítopo con extensión terminal N, el epítopo Xpress (Invitrogen, San Diego, CA) (designado como pGRN122) . El fragmento NotI hTRT del pGRN121 que contiene la hTRT ORF fue clonado dentro del sitio NotI del pEBVHisA, de tal forma que la hTRT ORF se encuentre en la misma orientación que el promotor del Virus del Sarcoma Rous del vector (RSV) . En esta orientación, la bandera His6 estaba relativamente cerca del término N de hTRT.

También se construyó un vector que contenía como inserto la secuencia antisensoria de hTRT y la bandera del epítopo (el plásmido designado como pGRN123, que puede utilizarse como control) . El vector fue transfectado dentro de 293 células y la hTRT traducido fue identificado y aislado utilizando un anticuerpo específico para el epítopo Xpress. El pEBVHis es un vector episómico EBV resistente a la higromicina que expresa la proteína de interés fusionada con un péptido terminal N. Las células que portan el vector se seleccionan y se expanden, y posteriormente se preparan los extractos nucleares y citoplásmicos. Estos y los extractos de control se inmunoprecipitan con un anticuerpo anti-Xpress, y las cuentas inmunoprecipitadas se someten a prueba para conocer la actividad de la telomerasa mediante un ensayo convencional.

hTRT Recombinante de Expresión en Células Humanas Diplóides Normales, Mortales En una forma de realización de la invención, el hTRt recombinante y los componentes del complejo de la enzima de telomerasa necesarios pueden expresarse en células mortales diplóides, normales, para incrementar su capacidad proliferativa o para inmortalizarlas, o con el fin de facilitar su inmortalización. Esto nos permite obtener células inmortales diplóides con un fenotipo y cariotipo de otra forma normales. Tal como se discutió anteriormente, el uso de la telomerasa tiene una utilización comercial enorme.

La hTRT sensorio (Figura 16) y la hTRT antisensorio fueron clonados dentro de un vector CMV. Estos vectores fueron purificados y transfectados de manera transitoria dentro de dos clones de célula humana diplóide moratal, normal. Los clones humanos eran especies de la célula BJ e IMR90 humana diplóide de paso joven.

El análisis de la actividad de la telomerasa utilizando el ensayo TRAP (utilizando el paquete TRApeze™ (Oncor, Inc., Gaithersburg, MD) mostró que la transfección de la hTRT sensorio -pero no la hTRT antisensorio - generó actividad de telomerasa tanto en las especies de células BJ e IMR90.

Expresión de hTRT Recombinante en Células Humanas IMR90 Inmortalizadas Utilizando la misma construcción sensoria de hTRT, clonada dentro de los vectores CMV utilizados en los estudios de las especies de células BJ e IMR90 humanas diplóides descritos anteriormente, la línea celular de la vía SW13 ALT inmortalizada (una célula IMR90 inmortalizada con antígeno SV40) sue transfectada transitoriamente. Un ensayo TRAP (TRAPeze, Oncor, Inc., Gaithersburg, MD) demostró que la actividad de la telomerasa fue generada en las células transfectadas con construcción sensoria.

Vectores para la Expresión Regulada de hTRT en Células de Mamíferos: Expresión Inducible y Represible de hTRT

La invención proporciona vectores que pueden manipularse para inducir o reprimir la expresión de TRTs de la invención, como por ejemplo hTRT. Por ejemplo, la secuencia de codificación de hTRT puede clonarse dentro del Sistema de Expresión Inducible Ecdisona de Invitrogen (San Diego, CA) y los sistemas regulados de tetraciclina Tet-On y Tet-off de Clontech Laboratories, Inc. (Palo Alto, CA) . Estos sistemas de expresión inducibles se proporcionan para utilizarse en los métodos de la invención donde es importante controlar el nivel o el porcentaje de transcripción de TRT transfectado. Por ejemplo, la invención proporciona líneas celulares inmortalizadas a través de la expresión de hTRT; estas células pueden convertirse en "mortales" mediante la inhibición de la expresión de hTRT por el vector a través de controles de transcripción, como los proprocionados por el sistema Tet-Off. La invención también proporciona métodos para expresar la TRT únicamente de manera transitoria con el fin de evitar la expresión constitutiva de hTRT, que puede conducir a una "inmortalización" no deseada de las células transfectadas, tal como se discutió anteriormente.

El Sistema de Expresión de Mamíferos Inducible Ecdisona está diseñado para permitir la expresión regulada del gene de interés en las células mamíferas. El sistema se distingue por su mecanismo firmemente regulado que permite una expresión basal casi no detectable y una inducibilibas mayor a 200 veces en células mamíferas. El sistema de expresión se basa en el receptor de ecdisona heterodimérico de Drosophila. El Sistema de Expresión Inducible Ecdisona utiliza un análogo de ecdisona de la hormona esteróide, muristerona A, para activar la expresión de hTRT a través de un receptor local heterodimérico. Se ha reportado que los niveles de expresión exceden más de 200 veces los niveles basales sin efecto en la fisiología celular de los mamíferos "Expresión del Gene Inducible de Ecdisona en Células de Mamíferos y Ratones Transgénicos" ( (1996) Proc. Natl. Acad. Sci USA 93, 3346-3351) . Una vez que el receptor enlaza la ecdisona o la mulisterona, un análogo de la ecdisona, el receptor activa un promotor responsivo a la ecdisona para proporcionar la expresión controlada del gene de interés. En el Sistema de Expresión de Mamíferos Indicible de Ecdisona, ambos monómeros del receptor heterodimérico están expresados de manera constitutiva a partir del mismo vector, pVgRXR. El promotor responsivo de ecdisona, que finalmente activa la expresión del gene de interés, se localiza en un segundo vector, pIND, que activa la transcripción del gene de interés.

La secuencia de codificación de hTRT se clona en el vector pIND (Clontech Laboratories, Inc, Palo Alto, CA) , que contiene 5 elementos de respuesta de la ecdisona modificada (E/GREs) en sentido ascendente de un promotor de choques térmicos mínimos y el ciclo de clonación múltiple. La construcción se transfecta posteriormente en las líneas de células que han sido prediseñadas para expresar de manera estable el receptor de ecdisona. Después de la transfección, las células se tratan con muristerona para inducir la expresión intracelular a partir del pIND.

Los sistemas de expresión Tet-on y Tet-off (Clontech, Palo Alto, CA) dan acceso a los sistemas de expresión de genes de alto nivel, regulados, descritos por Gossen (1992) "Control firme de la expresión de genes en células de mamíferos mediante promotores responsivos a la tetraciclina" Proc. Natl. Acad. Sci USA 89:5547-5551, para el sistema de represión de transcipción Tet-Off; y Gossen (1995) "Activación mediante transcripción por medio de tetraciclina en células de mamíferos" Ciencia 268:1766-1769, para el sistema de transcripción inducible de Tet-On. En las líneas de células trasformadas "Tet-Off", la expresión del gene se activa cuando se retira la tetraciclina (Tc) o la doxiciclina ("Dox", un derivado de la Tc) del medio de cultivo. En contrate, la expresión se activa en las líneas de células Tet-On mediante la añadidura de Tc o Dox al medio. Ambos sistemas permiten que la expresión de genes clonados sea regulada estrechamente como respuesta a diferentes concentraciones de Tc o Dox.

Este sistema utiliza el "pTRE" como un plásmido de respuesta que puede utilizarse para expresar un gene de interés. El plásmido pTRE contiene un ciclo de clonación múltiple (MCS) inmediatamente en sentido descendente del promotor PhCMV*-1 responsibo de Tet. Los genes o cDNAs de interés insertados dentro de uno de los sitios en el MCS serán responsibos a las proteínas regulatorias tTA y rtTA en los sistemas Tet-Off y Tet-On, respectivamente. El PhCMV*-1 contiene el elemento responsivo de Tet (TRE) que está formado por siete copias de la secuencia del operador de prueba 42-bp (tetO) . El elemento TRE está justo en sentido ascendente del promotor CMV mínimo (PminCMV) , que carece del intensificador que es parte del promotor CMV completo en los plásmidos pTet. En consecuencia, el PhCMV*-1 es silencioso en ausencia del enlace de las proteínas regulatorias con las secuencias de TetO. El inserto clonado debe tener un codón de iniciación. En algunos casos, la añadidura de un sitio de enlace del ribosoma del concenso Kozak puede mejorar los niveles de expresión; sin embargo, se han expresado de manera eficiente varios cDNAs en los sistemas Tet sin la añadidura de una secuencia Kozak. Los plásmidos pTRE-Gene X son cotransfectados con pTK-Hyg para permitir la selección de transfectantes estables.

La configuración de un sistema de expresión Tet-Off o Tet-On por lo general requiere dos transfecciones estables para crear una línea de células "doblemente estable" que contenga copias integradas de genes que codifican la proteína regulatoria adecuada y TRT bajo el control de un TRE. En la primera transfección, la proteína regulatoria apropiada se introduce dentro de la línea de células de elección mediante la transfección de un "plásmido regular" como por ejemplo el vector de pTet-Off o pTet-On, que expresa las proteínas regulatorias apropiadas. La hTRT clonado en el "plásmido de respuesta" pTRE se introduce posteriormente en la segunda transfección para crear la línea de células Tet-Off o Tet-On doblemente estables. Ambos sistemas proporcionan un control de activación/desactivación muy firme de la expresión de genes, una inducción dependiente de una dosis regulada y niveles absolutos altos de la expresión de genes.

hTRT Recombinante de Expresión con DHRF y Secuencias de Adenovirus La construcción del plásmido pGRN155 fue diseñada para la expresión transitoria del cDNA de hTRT en células de mamíferos. Un concenso de Kozak se inserta en la terminación 5' de la secuencia de hTRT. El inserto de hTRT no contiene UTR de 3' o 5'. El cDNA de hTRT se inserta dentro del sitio EcoRI de p91023 (B) (Wong (1985) Ciencia 228:810-815) . El inserto hTRT se encuentra en la misma orientación que el DHRF ORF. Esto da como resultado un vector de expresión particularmente útil para la expresión transitoria.

El plásmido pGRN155 contiene el origen SV40 y el intensificador justo en sentido ascendente de un promotor de adenovirus, un gene se resistencia de tetraciclina, un origen de E. coli y una región del gene VAI y VAII del adenovirus. Esta caja de expresión contiene, en el siguiente orden: el promotor final principal del adenovirus; el líder tripartira del adenovirus; un intrón híbrido formado por un sitio de emplame de 5' desde el primer exon del líder tripartita y un sitio de emplame de 3' desde el gene de inmunoglobulina de ratón; el cDNA de hTRT; la secuencia de codificación de DHRF del ratón; y la señal de poliadenilación SV40.

Se ha reportado que el líder tripartia del adenovirus y los RNAs VA han incrementado la eficiencia con la cual se trasladan los mRNAs policistrónicos. Se ha reportado que las secuencias DHFR aumentan la estabilidad del mRNA híbrido. Las secuencias DHFR también proporcionan un marcador para la selección y amplificación de las secuencias del vector. Consultar Logan (1984) Proc. Natl. Acad. Sci. USA 81:3655) ; Kaufman (1985) Proc. Natl. Acad. Sci. USA 82:689; y Kaufman (1988) Enfoque (Life Technologies, Inc.) , Vol.10, no.3) .

Otros plásmidos de expresión de la invención se describen para propósitos ilustrativos.

pGRN121

El fragmento de EcoRI del clon de lambda 25-1.1.6 que contiene el cDNA completo que codifica la proteína de hTRT fue insertado dentro del sitio EcoRI de pBluescriptIISK + de tal forma que la terminación 5´del cDNA quede cerca del promotor T7 en el vector. El marcador seleccionable que se utiliza dentro de este vector es la ampicilina.

pGRN122

El fragmento NotI del pGRN121 que contiene la hTRT ORF fue insertado dentro del sitio NotI del pEVBHisA de tal forma que la secuencia de codificación se enlaza de manera operable con el promotor RSV. Este plásmido expresa una proteína de fusión compuesta por una bandera His6 fusionada a la terminal N de la proteína de hTRT. El marcador seleccionable que se utiliza con este vector es ampicilina o higromicina.

pGRN123

El fragmento NotI del pGRN121 que contiene la hTRT ORF fue insertado dentro del sitio NotI del pEBVHisA de tal forma que la secuencia de codificación se encuentra en la orientación opuesta al promotor RSV, expresando de esta manera la hTRT aniséntido.

pGRN124

El plásmido pGRN121 fue eliminado de todos los sitios ApaI seguido por la eliminación del fragmento MscI-HincII que contiene la 3´UTR. El fragmento Nco-XbaI que contiene el codón de paro de la secuencia de codificación de hTRT se insertó posteriormente dentro de los sitios Nco-XbaI del pGRN121 para elaborar un plásmido equivalente al pGRN121, con la única excepción de que carece de la 3´UTR, que puede preferirse para niveles de expresión aumentados en algunas células.

pGRN125

El fragmento NotI del pGRN124 que contiene la secuencia de codificación de hTRT fue insertado dentro del sitio NotI del pBBS235 de tal forma que la configuración de lectura abierta se encuentra en la orientación opuesta del promotor Lac. El marcador seleccionable que se utiliza con este vector es el cloranfenicol.

pGRN126

El fragmento NotI del pGRN124 que contiene la secuencia de codificación de hTRT fue insertado dentro del sitio NotI del pBBS235 de tal forma que la secuencia de codificación de hTRT insertada se encuentra en la misma orientación que el promotor Lac.

pGRN127

El oligonucleótido 5'-TGCGCACGTGGGAAGCCCTGGCCagatctg AattCCaCcATGCCGCGCGCTCCCCGCTG-3' se utilizó en una mutagénesis in vitro del pGRN125 para convertir el codón ATG de iniciación de la secuencia de codificación de hTRT dentro de una secuencia de consenso Kozak y crear los sitios EcoRI y Bg1II para la clonación. También se utilizó el oligonucleótido COD2866 para convertir AmpS a AmpR (resistente a la ampicilina) y el oligonucleótido COD1941 se utilizó para convertir CatR (resistente al cloranfenicol) en CatS (sensible al cloramfenicol) .

pGRN128

El oligonucleótido 5´-TGCGCACGTGGGAAGCCCTGGCCagatctg AattCCaCcATGCCGCGCGCTCCCCGCTG3´ se utilizó en la mutagénesis in vitro para convertir el codón ATG de iniciación de la hTRT dentro de un consenso Kozak y crear los sitios EcoRI y Bg1II para la clonación. También, se utilizó el oligo 5´-CTGCCCTCAGA CTTCAAGACCATCCTGGACTACAAGGACGACGATGACAAATGAATTCAGATCTGCGGCCGCCACCGCGGTGGA GCTCCAGC-3´ para insertar la Bandera IBI (International Biotechnologies Inc. (IBI) , Kodak, New Haven, CT) en el término C y crear los sitios EcoRI y Bg1II para la clonación. También, se utilizó el COD2866 para convertir AmpS en AmpR y se utilizó el COD1941 para convertir CatR en CatS.

pGRN129

El oligonucleótido 5´-CGGGACGGGCTGCTCCTGCGTTTGGTGG AcGCgTTCTTGTTGGTGACACCTCACCTCACC3´ se utilizó mediante una mutagénesis in vitro para convertir Asp869 en un codón Ala (es decir, el segundo Asp del motivo DD fue convertido en una Alanina para crear un mutante de hTRT dominante/negativo) . Esto también creo un sitio MluI. De la misma forma, se utilizó el oligonucleótido 5´-CTGCCCTCAGACTTCAAGACCATCCTGGACTACAAGGACGACGATGACAAATGAATTCAGATCTGCGGCCGCCA CCGCGGTGGAGCTCCAGC-3´ para insertar la Bandera IBI en al término C y crear los sitios EcoRI y Bg1II para la clonación. También, se utilizó el COD2866 para convertir AmpS en AmpR y se utilizó el COD1941 para convertir CatR en CatS.

pGRN130

El oligonucleótido 5´-CGGGACGGGCTGCTCCTGCGTTTGGTGGAcGCgTTCTT GTTGGTGACACCTCACCTCACC3´ se utilizó en la mutagénesis in vitro para convertir el codón Asp869 en un codón Ala (es decir, el segundo Asp del motivo DD se convirtió en una Alanina para elaborar una proteína variante dominante/ negativa) . Esto también creó un sitio MluI. También, se utilizó el oligonucleótido 5´-TGCGCACGTGGGAAGCCCTGGCCaCcATGCCGCGCGCT CCCCGCTG-3´en la mutagénesis in vitro para convertir el codón ATG de inicialización de la secuencia de codificación de hTRT en una secuencia de consenso Kozak y crear los sitios EcoRI y Bg1II para la clonación. También, se utilizó el COD2866 para convertir AmpS en AmpR y se utilizó el COD1941 para convertir CatR.

pGRN131

El fragmento EcoRI del pGRN128 que contiene la hTRT ORF con la secuencia Kozak y las mutaciones de la Bandera IBI se inserta dentro del sitio EcoRI del pBBS212 de tal forma que la hTRT ORF se expresa fuera del promotor MPSV. El plásmido pBSS212 contiene un promotor MPSV, el intensificador CMV y el sitio de poliadenilación SV40.

pGRN132

El fragmento EcoRI del pGRN128 que contiene la EcoRI ORF con la secuencia Kozak y las mutaciones de la Bandera IBI se inserta dentro del sitio EcoRI del pBBS212 de tal forma que el antisentido de la hTRT ORF se expresa fuera del promotor MPSV.

pGRN133

El fragmento EcoRI del pGRN121 que contiene la secuencia de codificación de hTRT se insertó dentro del sitio EcoRI del pBBS212 de tal forma que la proteína de hTRT se expresa bajo el control del promotor MPSV.

pGRN134

El fragmento EcoRI del pGRN121 que contiene la secuencia de codificación de hTRT se insertó dentro del sitio EcoRI del pBBS212 de tal forma que el antisentido de la secuencia de codificación de hTRT se expresa bajo el control del promotor MPSV. Los marcadores seleccionables utilizados con este vector son Clor/HigB/PAC.

pGRN135

El plásmido pGRN126 se fue digerido hasta su terminación con MscI y SmaI y fue ligado nuevamente para eliminar más del 95% de la secuencia de codificación de hTRT insertada. Un fragmento de SmaI-MscI fue insertado nuevamente durante el proceso para volver a crear la actividad Cat para la selección. Este plásmido no purificado fue digerido nuevamente después con SalI y EcoRI y el fragmento que contiene el codón de iniciación de la secuencia de codificación de hTRT fue insertado dentro de los sitios SaII-EcoRI del pBBS212. Esto da como resultado un plásmido de expresión de antisentido que expresa el antisentido de 5´UTR y las 73 bases de la secuencia de codificación. Los marcadores seleccionables utilizados con este vector son Clor/HigB/PAC.

pGRN136

El fragmento HindIII-SalI del pGRN126 que contiene la secuencia de codificación de hTRT fue insertado dentro de los sitios HindIII-SaII del pBBS242.

pGRN137

El fragmento SaII-Sse8387I del pGRN130 que contiene la secuencia Kozak fue insertado dentro de los sitios SaII-Sse8387I del pGRN136.

pGRN138

El fragmento EcoRI del pGRN124 que contiene la hTRT menos la 3´UTR fue insertado dentro del sitio EcoRI del pEGFP-C2 de tal forma que la orientación de la hTRT es la misma que el dominio EGFP.

pGRN139

El oligonucleótido 5´-CTGCCCTCAGACTTCAAGACCATCCTGGAC TACAAGGACGACGATGACAAATGAATTCA GATCTGCGGCCGCCACCGCGGTGGAGCTCCAGC-3' se utilizó para insertar la Bandera IBI en el término C de hTRT en pGRN125 y crear los sitios EcoRI y BgIII para la clonación. También, se utilizó el COD2866 para convertir AmpS en AmpR y se utilizó el COD1941 para convertir CatR en CatS.

pGRN140

El fragmento NcoI que contiene las secuencias ascendentes de la hTRT genómica y el primer intrón de hTRT de lambdaG55 fue insertado dentro del sitio NcoI del pBBS167. El fragmento está orientado de tal forma que la hTRT se encuentra en la misma dirección que el promotor Lac.

pGRN141

El fragmento NcoI que contiene las secuencias ascendentes de la hTRT genómica y el primer intrón de hTRT de lambdaG55 fue insertado dentro del sitio NcoI del pBBS167. El fragmento está orientado de tal forma que la hTRT se encuentra en la dirección opuesta al promotor Lac.

pGRN142

El fragmento NotI de lambdaGphi5 que contiene el inserto genómico º15 kbp completo que incluye la región del promotor del gene de hTRT fue insertado en el sitio NotI del plásmido pBBS185. El fragmento está orientado de tal forma que la hTRT ORF se encuentra en la dirección opuesta al promotor Lac.

pGRN143

El fragmento NotI de lambdaGphi5 que contiene el inserto genómico º15 kbp completo que incluye la región del promotor del gene de hTRT fue insertado en el sitio NotI del plásmido pBBS185. El fragmento está orientado de tal forma que la hTRT ORF se encuentra en la misma orientación que el promotor Lac.

pGRN144

Eliminación de SAL1 del pGRN140 para eliminar las secuencias lambda.

pGRN145

Este vector es un vector intermedio para la construcción de un vector de expresión de la proteína de fusión de hTRT. El fragmento EcoRI del pGRN137 que contiene la secuencia de codificación de hTRT fue insertado dentro del sitio EcoRI del pBBS212 para eliminar la porción de la secuencia que corresponde a la 5´UTR del mRNA de hTRT. La secuencia de codificación de hTRT está orientada de tal forma que se expresa bajo el control del promotor MPSV. Los marcadores seleccionables utilizados con este vector son Clor/HigB/PAC.

pGRN146

Este vector fue construido para la expresión de las secuencias de hTRT en células mamíferas. El fragmento Sse8387I-NotI del pGRN130 que contiene la mutación D869A de la hTRT fue insertado dentro de los sitios Sse8387I-NotI del pGRN137. Los marcadores seleccionables utilizados con este vector son la Ampicilina-HigB/PAC.

pGRN147

El fragmento Sse8387I-NotI del pGRN139 que contiene la Bandera IBI fue insertado dentro de los sitios Sse8387I-NotI del pGRN137.

pGRN148

El fragmento BgIII-Eco47III del pGRN144 que contiene la región del promotor de la hTRT fue insertado dentro de los sitios Bg1II-NruI del pSEAP2 para elaborar una construcción del promotor/informador de la hTRT.

pGRN149

Se construyó este vector para la expresión y mutagénesis de secuencias TRT en E. Coli. El oligo 5´-CTTCAAGACCATCCTGGACTTTCGAAACGCGGCCGCCACCG CGGTGGAGCTCC-3´ mutagénico fue utilizado para agregar un sitio de CSP451 en el termino C del la hTRT mediante una mutegénesis in vitro del pGRN125. El codón de "paro" de la hTRT fue eliminado y reemplazado por un sitio CSP5I. El marcador seleccionable que se utiliza con este vector es la ampicilina.

pGRN150

El fragmento BgIII-FspI del pGRN144 que contiene la región del promotor de la hTRT fue insertado dentro de los sitios BgIII-NruI del pSEAP2 para elaborar una construcción del promotor/informador de hTRT.

pGRN151

Este vector fue construido para la expresión de las secuencias de hTRT en células mamíferas. El fragmento EcoRI del pGRN147 que contiene la secuencia de codificación de EcoRI fue insertado dentro del sitio EcoRI del pBBS212 para eliminar la porción de la secuencia que corresponde a la 5´UTR del mRNA de hTRT. La secuencia de codificación de hTRT está orientada de tal forma que se expresa bajo el control del promotor MPSV. Los marcadores seleccionables utilizados con este vector son Clor/HigB/PAC.

pGRN152

El fragmento EcoRI del pGRN146 que contiene la secuencia de codificación de hTRT fue insertado dentro del sitio EcoRI del pBBS212 para eliminar la porción de la secuencia correspondiente a la 5´UTR de la hTRT. La secuencia de codificación de hTRT está orientada de tal forma que se expresa bajo el control del promotor MPSV.

pGRN153

El fragmento StyI del pGRN130 que contiene la mutación D869-->A de hTRT (secuencia de codificación de la variante de hTRT) fue insertado dentro de los sitios StyI del pGRN158 para elaborar un plásmido que contiene la secuencia de codificación de hTRT con una secuencia de consenso Kozak en su terminación 5´, una secuencia de BANDERA IBI en su terminación 3´ (la región que codifica el término C) y la mutación D869-->A.

pGRN154

El fragmento EcoRI del pGRN153 que contiene el gene de hTRT fue insertado dentro del sitio EcoRI del plásmido pBS212 en una orientación tal que la hTRT ORF está orientada en la misma dirección que el promotor MPSV. Esto da como resultado un plásmido de expresión dirigido por MPSV que expresa la proteína de hTRT con una secuencia de consenso Kozak en su extremo terminal de amino, una BANDERA IBI en su extremo terminal de carboxi, y la mutación de 869-->A.

pGRN155

Este vector fue construido para la expresión de las secuencias de hTRT en células mamíferas. El inserto incluía el cDNA de longitud completa de hTRT menos la UTR de 5´y 3´, y las secuencias Kozak. El fragmento EcoRI del pGRN145 que contiene el cDNA de hTRT con el consenso Kozak y no incluye UTR de 3´o 5´fue insertado dentro del sitio EcoRI del p91023 (B) de tal forma que la hTRT se encuentra en la misma orientación que la DHFR ORF. Esto da como resultado un vector de expresión transitoria para la hTRT. El marcador seleccionable utilizado con este vector es la tetraciclina.

pGRN156

Este vector fue construido para la expresión de las secuencias de hTRT en células mamíferas. El fragmento EcoRI del pGRN146 que contiene la mutación D869A del cDNA de hTRT con el consenso Kozak y sin UTR de 3´o 5´fue insertado dentro del sitio EcoRI del p91023 (B) de tal forma que la hTRT se encuentra en la misma orientación que la DHFR ORF. Esto da como resultado un vector de expresión transitoria para la hTRT. El inserto incluía el cDNA de longitud completa de hTRT menos la UTR de 5´y 3´, D869A y las secuencias Kozak. El marcador seleccionable utilizado con este vector es la tetraciclina.

pGRN157

Este vector fue construido para la expresión de las secuencias de hTRT en células mamíferas. El fragmento EcoRI del pGRN147 que contiene el cDNA de hTRT con la BANDERA IBI en el término C; el consenso Kozak y sin la UTR de 3´o 5´fue insertado dentro del sitio EcoRI del p91023 (B) de tal forma que el hTRT se encuentra en la misma orientación que la DHFR ORF. Esto da como resultado un vector de expresión transitoria para la hTRT. El inserto incluía el cDNA de longitud completa de la hTRT menos la UTR de 5´y 3´, la secuencia de BANDERA IBI, y las secuencias Kozak. El marcador seleccionable utilizado con este vector es la tetraciclina.

pGRN158

Este vector fue construido para la expresión y mutagénesis de las secuencias de TRT en E. coli. El fragmento EcoRI del pGRN151 que contenía la hTRT ORF fue insertado dentro del sitio EcoRI del pBSS183 de tal forma que la hTRT ORF está orientada en la dirección opuesta al promotor Lac. El inserto incluía el cDNA de longitud completa de hTRT menos la UTR de 5´y 3´, la secuencia de BANDERA IBI y las secuencias Kozak. La secuencia de codificación de hTRT es activada por un promotor T7. El marcador seleccionable utilizado con este vector es la ampicilina.

pGRN159

Este vector fue construido para la expresión y mutagénesis de las secuencias de TRT en E. coli. El fragmento NheI-KpnI del pGRN138 que contiene el EGFP para la fusión de hTRT fue insertado dentro de los sitios Xbal-XpnI del pBluescriptIIKS +. Esto da como resultado un vector de expresión T7 para la proteína de fusión (la secuencia de codificación es activada por un promotor T7) . El inserto incluía el cDNA de longitud completa de la hTRT menos la UTR de 3´como proteína de fusión con EGFP. El marcador seleccionable utilizado con este vector es la ampicilina.

pGRN160

Este vector fue construido para la expresión de la secuencias de hTR antisentido en las células mamíferas. La secuencia de codificación está enlazada de manera operativa con un promotor MPSV. El fragmento XhoI-NsiI del pGRN90 que contiene la hTR ORF de longitud completa fue insertado dentro de los sitios Sa1I-Sse8387I del pBBS295. Esto da como resultado un vector transitorio/estable que expresa el ARN antisentido de la hTR. Se incorporo un marcador GPT dentro del vector. Los marcadores seleccionables utilizados con este vector son Clor/gpt/PAC.

pGRN161

Este vector fue construido para la expresión de las secuencias de hTR de sentido en células mamíferas. El fragmento XhoI-NniI del pGRN89 que contiene la hTR ORF de longitud completa fue insertado dentro de los sitios Sa1I-Sse8387I del pBSS295. Esto da como resultado un vector transitorio/estable que expresa la hTR en la orientación del sentido. La secuencia de codificación es activada por un promotor MPSV. Un marcador GPT fue incorporado dentro del vector. Los marcadores seleccionables utilizados con este vector son Clor/gpt/PAC.

pGRN162

El fragmento XhoI-NsiI del pGRN87 que contiene la hTR ORF de longitud completa fue insertado dentro de los sitios Sa1I-Sse8387I del pBSS295. Esto da como resultado un vector transitorio/estable que expresa la hTR truncada (de la posición + 108 a la + 435) en la orientación del sentido.

pGRN163

Este vector fue construido para la expresión y mutagénesis de las secuencias de TRT E. coli. La secuencia de codificación es activada por un promotor T7. El oligonucleótido RA45 (5´GCCACCCCCGCGCTGCCTCGAGCTCCCCGCTGC-3´) se utiliza en la mutagénesis in vitro para cambiar el met de iniciación en la hTRT a Leu e introducir un sitio XhoI en los siguientes dos codones después del Leu. También, se utilizó el COD 1941 para cambiar CatR en CatS, e introduce un sitio BSPH1, y se utilizó el COD 2866 para cambiar AmpS a AmpR, introduciendo un sitio FSP1. El marcador seleccionable utilizado con este vector es la ampicilina.

pGRN164

Este vector fue construido para la expresión de las secuencias de hTR en E. coli. Los iniciadores hTR + 1 5´-GGGGAAGCTTTAATACGACTCACTATAGGGTTGCGGAGGGTGGGCCTG-3´y hTR + 445 5´-CCCCGGATCCTGCGCATGTGTGAGCCGAGTCCTGGG-3´ se utilizaron para amplificar mediante PCR un fragmento de pGRN33 que contenía la hTR de longitud completa con el promotor T7 en la terminación 5´ (igual que en la hTR + 1) . La digestión BamHI-HindIII del producto de PCR fue colocada dentro de los sitios BamHI-HindIII del pUC119. La secuencia de codificación se enlazo de manera operativa con un promotor T7. El marcador seleccionable utilizado con este vector es la ampicilina.

pGRN165

Este vector fue construido para la expresión y mutagénesis de las secuencias de hTRT en E. coli. La secuencia de codificación está enlazada de manera operativa con un promotor T7. El fragmento EcoRI del pGRN145 que contenía la hTRT ORF con un extremo frontal Kozak fue insertado dentro del sitio EcoRI de pBluescriptIISK + de tal forma que la hTRT está orientada en la misma dirección que el promotor T7. El marcador seleccionable utilizado con este vector es la ampicilina.

pGRN166

Este vector fue construido para la expresión y mutagénesis de las secuencias de TRT en las células mamíferas. La secuencia de codificación está enlazada de manera operativa con un promotor T7. El fragmento EcoRI del pGRN151 que contenía la hTRT ORF con un extremo frontal Kozak y la Bandera IBI en el extremo posterior fue insertado dentro del sitio EcoRI del pBluescriptIISK + de tal forma que la hTRT ORF está orientada en la misma dirección que el promotor T7. El inserto incluía el cDNA de longitud completa de la hTRT menos la UTR de 5´y 3´, la secuencia BANDERA (Immunex Corp, Seattle WA) , y las secuencias Kozak. El marcador seleccionable utilizado con este vector es la ampicilina.

pGRN167

El fragmento AvRII-StuI del pGRN144 que contenía la terminación 5´ de la hTRT ORF fue insertado dentro de los sitios XbaI-StuI del pBBS161.

pGRN168

El fragmento EcoRI del pGRN145 que contenía el cassette de expresión de hTRT optimizada fue insertado dentro del sitio EcoRI del pIND de tal forma que la secuencia de codificación de hTRT se encuentra en la misma orientación que el promotor miniCMV.

pGRN169

El fragmento EcoRI del pGRN145 que contenía el cassette de expresión de hTRT optimizada fue insertado dentro del sitio EcoRI del pIND de tal forma que la secuencia de codificación de hTRT se encuentra en la orientación inversa al promotor miniCMV.

pGRN170

El fragmento EcoRI del pGRN145 que contenía el cassette de expresión de hTRT optimizada fue insertado dentro del sitio EcoRI del pIND (sp1) de tal forma que la secuencia de codificación de hTRT se encuentra en la orientación opuesta al promotor miniCMV. Ampicilina / neomicina / kanamicina.

pGRN171

El fragmento Eco47III-NarI del pGRN163 fue insertado dentro de los sitios Eco47III-NarI del pGRN167, colocando la mutación M1L dentro de un fragmento del DNA genómico de hTRT.

pGRN172

El fragmento BamHi-StuI del pGRN171 que contenía la mutación de Met a Leu en la hTRT ORF fue insertado dentro de los sitios Bg1II-NruI del pSEAP2-Básico.

pGRN173

El fragmento EcoRV-ECO47III del pGRN144 que contenía la terminación 5´ de la región del promotor hTRT fue insertado dentro de los sitios SrfI-Eco47III del pGRN172. Esto da como resultado un plásmido del informador del promotor que contiene la región promotora del hTRT a partir de aproximadamente 2.3 kb en sentido ascendente al inicio de la hTRT ORF hasta justo después del primer intrón en la región de codificación, con la mutación Met1->Leu.

pGRN174

El fragmento de EcoRI del pGRN145 que contiene el cassette de expresión de hTRT "optimizada" fue insertado dentro del sitio EcoRI de pIND (sp1) de tal forma que la hTRT se encuentra en la misma orientación que el promotor miniCMV.

Ejemplo 7

RECONSTITUCIÓN DE LA ACTIVIDAD DE LA TELOMERASA

A. Co-expresión de la hTRT y la hTR in vitro.

En este Ejemplo, se describe la co-expresión de la hTRT y la hTR utilizando un sistema de expresión libre de células in vitro. Estos resultados demuestran que el polipéptido de la hTRT codificado mediante pGRN121 codifica una proteína de telomerasa catalíticamente activa y que la reconstitución in vitro (IVR) de la telomerasa RNP puede lograrse utilizando la hTRT y la hTR expresadas de manera recombinante.

La actividad de la telomerasa fue reconstituida agregando plásmidos linealizados de la hTRT (pGRN121; 1 !g de DNA digerido win Xba I) y la hTR (phTR+1; 1 !g digerido con FspI) a un sistema de lisado del reticulocito de transcripción-traducción acoplado (Promega TNTF) . El phTR+1 es un plásmido que, al linealizarse con FspI y después transcribirse mediante la polimerasa del ARN T7, genera una transcripción del nucleótido 445 que inicia con el nucleótido +1 y se extiende hasta el nucleótido 446 de la hTR (Autexier y colaboradores, 1996, EMBO J 15:5928) . Para una reacción de 50 !l se agregaron los siguientes componentes: 2 !l de amortiguador TNTF, 1 !l de polimerasa del ARN T7 TNTF, 1 !l de mezcla de aminoácido 1 mM, 40 unidades del inhibidor Rnase RnasinF, 1 !g del DNA de cada molde linealizado, y 25 !l de lisado del reticulosito TNTF. Los componentes se agregaron en la relación recomendada por el fabricante y fueron incubados durante 90 minutos a 30ºC. La transcripción se realizo bajo la dirección del promotor T7 y también podía llevarse a cabo antes de la añadidura del lisado del reticulocito con resultados similares. Después de la incubación, se sometieron a ensayo 5 y 10 !l de la reacción de transcripcióntraducción programada para la actividad de la telomerasa mediante TRAP como se describió anteriormente (Autexier y colaboradores, supra) utilizando 20 ciclos de PCR para amplificar la señal.

Los resultados de la reconstitución se muestran en la Figura 10. Para cada reacción de transcripción-traducción sometida a ensayo existen 3 vías. Las primeras dos líneas son ensayos duplicados y la tercera vía es una muestra duplicada desnaturalizada térmicamente (95ºC, 5 minutos) antes de la fase de TRAP para regular los artefactos generados por la PCR.

Tal como se muestra en la Figura 10, el lisado del reticulocito por sí solo no tiene actividad de telomerasa detectable (vía 6) . De manera similar, no se observa actividad detectable cuando se agrega ya sean la hTR sola (vía 1) o el gene de hTRT de longitud completa (vía 4) al lisado. Cuando se agregan ambos componentes (vía 2) , se genera la actividad de la telomerasa tal como se demuestra por el patrón de escalera repetida característico. Cuando la región terminal del carboxil del gene hTRT es eliminada por al digestión del vector con NcoI ("hTRT truncada") se anula la actividad de la telomerasa (vía 3) . La vía 5 muestra que la traducción de la hTRT truncada por si sola no genera actividad de la telomerasa. La vía "R8" muestra un control positivo para una escalera del producto de la telomerasa generada por TRAP de TSR8, un producto de telomerasa sintética que posee una secuencia del nucleótido de 5´-ATTCCGTCGAGCAGAGTTAG[GGTTAG]7-3´.

B. Mezcla de la hTRT y la hTR in vitro La reconstitución in vitro de la actividad de la telomerasa también se logró a través del mezclado. La hTRT se transcribió y se tradujo tal como se describió anteriormente, pero sin la añadidura del plásmido de la hTR. Posteriormente, se logro la reconstitución de la telomerasa RNT mediante el mezclado de la mezcla de la traducción de la hTRT con la hTRT (generada previamente por la transcripción de la polimerasa del ARN T7 a partir del phTR + 1-Fsp) en una relación de 2 !l de la mezcla de la traducción de la hTRT con 2 !l de la hTR (1 ug) , y posteriormente se incubó durante 90 minutos a 30ºC. Este método de la reconstitución de la hTRT/hTR se refiere como "reconstitución enlazada" o "IVR enlazada". La actividad de la telomerasa está presente (es decir, puede detectarse) en esta mezcla. Se observó una señal mejorada después de la purificación parcial de la actividad mediante la cromatografía DEAE. En este caso, se utilizaron Dispositivos del Filtro Centrífugo DEAE Ultrafee-MC de Millipore, de acuerdo con las instrucciones del fabricante. Los amortiguadores utilizados fueron hypo0.1, hypo0.2 y hypopo1.0, donde hypo es 20 mM de Hepes-KOH, ph 7.9, 2 mM de MGCl2, 1 mM de EGTA, 10% de glicerol, 0.1% de NP-40, 1 mM de DTT, 1 mM de Na-metabisulfito, 1 mM de benzamidina y 0.2 mM de fenilmetilsulfonilfluoruro (PMSF) , y donde 0.1, 0.2 y 1.0 se refieren a 0.1, 0.2 ó 1.0 de M KCL. Los filtros fueron preacondicionados con hypo1.0, lavado con hypo0.1, la telomerasa reconstituida fue cargada, la columna se lavó con hypo0.1, posteriormente con hypo0.2, y la telomerasa reconstituida fue eluida con hypo1.0 a la mitad del volumen a la que fue cargada. Esta formula puede almacenarse congelada a - 70ºC y conserva su actividad.

La actividad de la telomerasa fue sometida a ensayo en un procedimiento de dos pasos. En el paso uno, se llevó a cabo el ensayo convencional de la telomerasa tal como se describe en Morin, 1989, Célula 59:521, con la excepción de que no se utilizó una radioetiqueta. En el paso dos, se sometió a ensayo una alícuota mediante el procedimiento TRAP durante 20-30 ciclos tal como se describió anteriormente. El ensayo convencional fue realizado sometiendo a ensayo 1-10 !l de la telomerasa reconstituida en 40-50 !l de volumen final de 25 mM de Tris-HCl, pH 8.3, 50 mM de K-acetato, 1 mM EGTA, 1 mM MGCl2, 2 mM de dATP, 2 mM de TTP, 10 uM de dGTP y 1 uM de iniciador (por lo general M2, 5´-AATCCGTCGAGCAGAGTT) a 30º durante 60-180 minutos. La reacción fue detenida calentando a 95ºC durante 5 minutos y se transportó 1-10 !l de la mezcla del primer paso hacia la reacción TRAP del paso dos (50 1l) .

En experimentos adicionales, las síntesis de la hTRT y la hTR durante la reconstitución in vitro fue monitoreada mediante la incorporación de 35S-metionina y el manchado Northern, respectivamente. Se sintetizaron proteínas de aproximadamente el tamaño previsto para la hTRT (127 kD) , la hTRT-Nco (85kD) , y la pro90hTRT (90kD) en cantidades molares aproximadamente equivalentes en relación una con otra. El análisis Northern indico que la síntesis de la hTR era el tamaño correcto (445 nucleótidos) y estuvo predominantemente intacta.

Las variaciones de los protocolos de reconstitución, mencionado anteriormente, serán aparentes para las personas capacitadas en la técnica. Por ejemplo, pueden emplearse el tiempo y la temperatura de reconstitución, y la presencia o concentración de los componentes como por ejemplo la sal monovalente (por ejemplo, NacL, KCl, acetato de potasio, glutamato de potasio, y similares) , sal divalente (MGCl2´, MgSOl4´, y similares) , desnaturalizadores (urea, formamida y similares) , detergentes (NP-40, Tween, CHAPS, y similares) y procedimientos de purificación mejorada alternativos (como por ejemplo la inmunoprecipitación, cromatografía por afinidad o estándar) . Estos y otros parámetros pueden variarse de manera sistemática para perfeccionar las condiciones de los ensayos en particular o cualquier otro protocolo de reconstitución.

C. Reconstitución utilizando las variantes de la hTRT y las proteínas de fusión.

La reconstitución de la actividad catalítica de la telomerasa se presentó cuando la EGFP-hTRT, una fusión de la proteína fluorescente verde perfeccionada con la hTRT (consultar los Ejemplos 6 y 15) , o las hTRT etiquetada como epítopo (BANDERA IBI, consultar Ejemplo 6) reconstituyeron ambas una actividad de la telomerasa en niveles aproximadamente de tipo silvestre cuando se coexpresaron con la hTR.

En contraste, la actividad de la telomerasa no se reconstituyó cuando se utilizó una hTRT variante, la pro90hTRT (carente de los motivos RT B´, C, D y E) . Esto demuestra que la pro90hTRT no posee una actividad catalítica de la telomerasa completa, a pesar de que puede poseer otras actividades parciales (por ejemplo, la capacidad de enlace del ARN [es decir, hTR] y al función como regulador negativo dominante de la telomerasa in vivo tal como se describió anteriormente) .

D. Ensayo de la actividad de la telomerasa reconstituida in vitro utilizando el manchado de gel y el ensayo de la telomerasa convencional El siguiente Ejemplo demuestra que la telomerasa reconstituida in vitro (IVR) puede someterse a ensayo utilizando ensayos convencionales para la telomerasa, además de los ensayos basados en la amplificación (es decir, TRAP) . La telomerasa IVR tal como se describió en la parte (B) , anteriormente (el "método de reconstitución enlazado") seguida por la purificación DEAE, tal como se describió anteriormente, fue sometida a ensayo utilizando el ensayo de manchado de gel utilizando las siguientes condiciones de la reacción; 1-10 !l de telomerasa IVR enlazada en 40 !l del volumen final de 25 mM de Tris-HCl, pH 8.3, 50 mM de K-acetato, 1 mM de EGTA, 1 mM de MGCl2, 0.8 mM de dATP, 0.8 mM de TTP, 1.0 mM de dGTP y 1 uM de iniciador (M2-tal como se indico anteriormente; ó H3.03, 5´-TTAGGGTTAGGGTTAGGG) a 30ºC durante 180 minutos. El DNA telomérico sintetizado fue aislado mediante procedimientos estándares, separado por una poliacrilamida al 8%, 8 M de gel de urea, fue transferido a una membrana de nylon y sondeado utilizando la ribosonda 32P- (CCCTAA) n utilizada en el ensayo de manchado de puntos. La sonda identificó una escalera de 6 nucleótidos en la vía que representa 10 !l de la telomerasa IVR que fue equivalente a la escalera observada para 5 !l de la telomerasa nuclear nativa purificada mediante la cromatografía de heparina y mono Q. Los resultados muestran que la telomerasa IVR posee una actividad catalítica de la telomerasa en proceso equivalente a la telomerasa nativa.

La telomerasa IVR enlazada también fue sometida a ensayo mediante el ensayo de la telomerasa de incorporación convencional 32P-dGTP. La telomerasa IVR preparada por medio del método de reconstitución enlazado seguido por la purificación DEAE, tal como se describió anteriormente, fue sometida a ensayo bajo las condiciones de reacción tanto en proceso como no en proceso. Las condiciones del ensayo fueron de 5-10 !l de la telomerasa IVR enlazada en 40 !l del volumen final de 25 mM de Tris-HCl, pH 8.3, 50 mM de K-acetato, 1 mM de EGTA, 1 mM MGCl2, 2 mM de dATP, 2 mM de TTP, con 10 uM de 32P-dGTP (72 Ci/mmol) [para el ensayo de las condiciones en proceso] o 1 uM de 32P-dGTP (720 Ci/mmol) [para no en proceso] y 1 uM del iniciador (es decir, H3.03, tal como se indicó anteriormente) a 30ºC [para la reacción en proceso] o 37ºC [para la reacción no en proceso] durante 180 minutos. El DNA telomérico sintetizado fue aislado mediante procedimientos estándares y fue separado en una poliacrilamida al 8%, 8 M de gel de secuenciación del gel de urea. La reacción en proceso mostró una escalera de seis nucleótidos débiles consistente con una reacción de la telomerasa en proceso, y la reacción no en proceso agrega una repetición, un patrón equivalente a una reacción de control con una preparación de la telomerasa nativa. Los ensayos convencionales utilizando telomerasa IVR son útiles en las clasificaciones para los moduladores de la telomerasa, tal como se describe en la presente, así como otros usos como la elucidación de las propiedades estructurales y funcionales de la telomerasa.

E. La Telomerasa Reconstituida in vitro Reconoce el Iniciador con Término 3´.

Este experimento demuestra que la telomerasa IVR reconoce el termino de 3´del iniciador equivalente a la telomerasa nativa (purificada) . La telomerasa forma un dúplex de pareja base entre la terminación 3´del iniciador y la región del molde de la hTR y agrega el siguiente nucleótido especificado (Morin, 1989, tal como se indicó anteriormente) . Para verificar que la telomerasa IVR (recombinante) tiene la misma propiedad, se compararon las reacciones de los iniciadores con las terminaciones ---GGG o ---TAG 3´ (AATCCGT CGAGCAGAGGG y AATCCGTCGAGCAGATAG) con un iniciador que posee una terminación ---GTT 3´ (M2 arriba) utilizando la telomerasa IVR inactiva sometida a prueba mediante el ensayo convencional de dos pasos/TRAP que se especifico anteriormente. Las escaleras del producto de los iniciadores ---GGG y ---TAG fueron cambiadas a +4 y +2, respectivamente, al compararse con el iniciador estándar (terminación ---GTT 3´) , el mismo efecto que el que se observo con la telomerasa nativa. Este experimento demuestra que las telomerasas IVR inactiva reconocen la primera terminación de manera similar.

Estos resultados (junto con los resultados mostrados anteriormente que indican que la telomerasa IVR poseen una actividad catalítica tanto en proceso como no en proceso) indican que la telomerasa IVR tiene estructura y propiedades similares en comparación con una telomerasa nativa o purificada.

Ejemplo 8

PRODUCCIÓN DE ANTICUERPOS ANTI-hTRT

A.Producción de anticuerpos anti-hTRT contra Péptidos de hTRT.

Para producir anticuerpos anti-hTRT, se sometieron a síntesis los siguientes péptidos a partir de la hTRT con la añadidura de C (cisteína) como el residuo terminal del amino (consultar Figura 54) .

S-1: FFY VTE TTF QKN RLF FYR KSV WSK S-2: RQH LKR VQL RDV SEA EVR QHR EA S-3: ART FRR EKR AER LTS RVK ALF SVL NYE A-3: PAL LTS RLR FIP KPD GLR PIV NMD YVV

La mitad de la cisteína fue utilizada para inmovilizar (es decir, enlazar de manera covalente) los péptidos con las proteínas portadoras BSA y KLH [hemocianina de lapa en forma de bocallave]. Los péptidos de KLH fueron utilizados como antígeno. Los conjugados del péptido de BSA sirvieron como material para las pruebas de ELISAs para probar la especificidad de los sueros inmunes.

Los conjugados del péptido de KLH fueron inyectados a conejos blancos de Nueva Zelanda. Las inyecciones iniciales se llevan a cabo colocando al inyectante próximo a los nodos linfáticos auxiliares e inguinales. Las inyecciones posteriores se realizaron intramuscularmente. Para las inyecciones iniciales, el antígeno se emulsificó con adyuvante completo de Freund; para las inyecciones subsecuentes, se utilizó el adyuvante incompleto de Freund. Los conejos siguieron un sitio de sobrealimentación de tres semanas, en el cual se toman 50 ml de sangre produciendo 20-25 ml de suero 10 días después de cada sobrealimentación. El antisuero contra cada uno de los cuatro péptidos reconoció la mitad de la hTRT de la proteína de fusión de hTRT recombinante (fragmento GST-HIS8hTRT 2426 al 3274) ; (consultar Ejemplo 6) en los manchados Western.

Utilizando una fracción de telomerasa purificada parcialmente a partir de 293 células humanas (aproximadamente una purificación de 1, 000 veces en comparación con un extracto nuclear crudo) que fue producida tal como se describió en la solicitud PCT No. 97/06012 y anticuerpos anti-S-2 purificados por afinidad, pudo detectarse una duplicación de la proteína 130 kd en un manchado Western. Se empleo un método de detección por quimioluminiscencia (substratos de quimioluminiscencia SuperSignal, Pierce) pero la señal en el manchado fue débil, lo que sugirió que la hTRT está presente en una abundancia baja o muy baja en estas células inmortales. La observación de un doblete es consistente con una modificación posterior a la traducción de la hTRT, es decir la fosforilación o glucosilación.

Para la purificación por afinidad, el péptido S-2 se inmovilizó con SulfoLink (Pierce, Rockford IL) a través de su residuo de Cisteína con terminal N, de acuerdo con el protocolo del fabricante. El primer suero de la sangre de un conejo inmunizado con el antígeno del péptido KLH-S-2 fue cargado sobre el S-2-SulfoLink y los anticuerpos enlazados específicamente con el péptido S-2 fueron sometidos a elusión.

B. Producción de Anticuerpos Anti-hTRT Contra las Proteínas de Fusión de la hTRT

Las proteínas de fusión GST-hTRT fueron expresadas en E. coli como las proteínas del fragmento #4 GST-hTRT (nucleótidos 3272-4177) y fragmento #3 GST-HIS8-hTRT (nucleótidos 2426 al 3274) descritas en el Ejemplo 6. Las proteínas de fusión fueron purificadas como proteína insoluble, y la pureza de los antígenos fue sometida a ensayo mediante geles de poliacrilamida SDS y se calculó como de aproximadamente 75% de pureza para la proteína recombinante del fragmento # 4 de la GST-hTRT y más del 75% de pureza para la proteína recombinante del fragmento # 3 de la GST-HIS8-hTRT. Pueden utilizarse métodos de rutina para obtener éstas y otras proteínas de fusión a una pureza de más del 90%. Estas proteínas recombinantes fueron utilizadas para inmunizar tanto conejos como ratones, como se describió antes.

El primero y el segundo sangrado tanto de los ratones como de los conejos fueron sometidos a prueba para evaluar la presencia de los anticuerpos anti-hTRT después de la eliminación de los anticuerpos anti-GST utilizando una matriz que contiene la GST inmovilizada. Los antisueros fueron sometidos a prueba para evaluar los anticuerpos anti-hTRT mediante un manchado Western utilizando la proteína de fusión GST-hTRT recombinante inmovilizada, y mediante inmunoprecipitación utilizando la enzima de telomerasa nativa parcialmente purificada. A pesar de que no se observaron señales en estos primeros sangrados, las valoraciones de los anticuerpos anti-hTRT, tal como se espero, se incrementaron en sangrados posteriores.

Ejemplo 9

DETECCIÓN DE UN mRNA DE hTRT CORRESPONDIENTE A LA VARIANTE DEL ARN º 182

El ARN poli A+ de testículo humano y la línea celular 293 fueron analizados para evaluar el mRNA del hTRT utilizando RT-PCR e iniciadores inclusivos. El primer conjunto de iniciadores fue TCP1.1 y TCP1.15; el segundo grupo de iniciadores fue TCP1.14 y BTCP6. La amplificación de cada uno de estos dio como resultado dos productos que difieren en 182 bp; los productos más grande y más pequeño del ARN del testículo fueron secuenciados y se descubrió que corresponden exactamente al clon pGRN121 (Figura 16) y el clon 712562 (Figura 18) , respectivamente. El producto del ARN de hTRT variante ha sido observado en el mRNA de SW39i, OVCAR4, 293 y en testículos.

Se llevaron a cabo experimentos adicionales para demostrar que el cDNA L 182 no era un artefacto de transcripción inversa. De manera breve, se produjo un ARN de hTRT de longitud completa (es decir, sin la eliminación) mediante una transcripción in vitro del pGRN121 para utilizarse como molde para RT-PCR. Se llevaron a cabo reacciones de síntesis del cDNA por separado utilizando transcriptasa inversa Superscript® (Bethesda Research Laboratories, Bethesda MD) a 42ºC o 50ºC, y con iniciadores aleatorios o un iniciador especifico. Después de 15 ciclos de la PCR, el producto más grande pudo ser detectado; sin embargo, el producto más pequeño (es decir, el correspondiente a la eliminación) no pudo detectarse incluso después de 30 ciclos o más. Esto indica que el producto de la RT-PCR no es un artefacto.

Ejemplo 10

SECUENCIACIÓN DEL mRNA DE hTRT DE TESTÍCULO

La secuencia de la forma del ARN de hTRT del testículo fue determinada mediante una secuenciación manual directa de los fragmentos del DNA generados mediante PCR a partir de cDNA del testículo (cDNA del testículo Marathon, Clontech, San Diego CA) utilizando un paquete de secuenciación del ciclo del terminador radioetiquetado ThermoSequenase (Amersham Life Science) . El paso de la PCR fue realizado a través de una PCR inclusiva, tal como se muestra en la tabla 8. En todos los casos se llevo a cabo una reacción de control negativo con iniciadores pero sin cDNA. La ausencia de producto en la reacción de control demostró que los productos derivados de la reacción con cDNA presente no fueron resultado de la contaminación de la hTRT a partir del pGRN121 u otras fuentes celulares (por ejemplo, células 293) . Los fragmentos del DNA fueron extirpados de geles de agarosa para purificar el DNA antes de la secuenciación.

Se obtuvo la secuencia del mRNA del testículo correspondiente a las bases 27 a 3553 de la secuencia del inserto pGRN121, y que contenía toda la hTRT ORF (bases 56 a 3451) . No se encontraron diferencias entre las secuencias del testículo y el pGRN121 en esta región.

CUADRO 8

Fragmento Grupo 1 del Iniciador Grupo 2 del Iniciador Tamaño Final Iniciadores para secuenciación OA na K320/K322 208 K320, K 322A K320/TCP1.43 TCP1.40/TCP1.34 556 TCP1.52, TCP1.39, K322, TCP1.40, TCP1.41, TCP1.30, TCP1.34, TCP1.49 B TCP1.42/TCP1.32B TCP1.35/TCP1.21 492 TCP1.35, TCP1.28, TCP1.38, TCP1.21, TCP1.46, TCP1.33, TCP1.48C TCP1.65/TCP1.66 TCP1.67/TCP1.68 818 TCP1.67, TCP1.32, TCP1.69, TCP1.68, TCP1.24, TCP1.44, K303D2 K304/billTCP6 LT1/TCP1.6 546 LT2, LT1, TCP1.6, bTCP4, TCP1.13, TCP1.77, TCP1.1 D3 TCP1.12/TCP1.7 TCP1.14/TCP1.15 604 TCP1.6, TCP1.14, TCP1.73, TCP1.78, TCP1.25, TCP1.15, TCP1.76 EF na TCP1.74/TCP1.7 201 TCP1.74, TCP1.7, TCP1.75, TCP1.15, TCP1.3 E TCP1.3/TCP1.4 TCP1.2/TCP1.9 687 TCP1.2, TCP1.8, TCP1.9, TCP1.26 F TCP1.26/UTR2 TCP1.10/TCP1.4 377 TCP1.4, TCP1.10, TCP1.11

Ejemplo 11

DETECCIÓN DEL mRNA DE hTRT MEDIANTE PROTECCIÓN DEL RNASA

Los ensayos de protección de la RNasa pueden utilizarse para detectar, monitorear o diagnosticar la presencia de un mRNA de hTRT o un mRNA variante. Una sonda de protección de la RNasa ilustrativa es un ARN sintetizado in vitro que incluye las secuencias complementarias para las secuencias del mRNA de hTRT y secuencias adicionales, no complementarias. Las últimas secuencias se incluyen para distinguir la sonda de longitud completa a partir del fragmento de la sonda que resulta de un resultado positivo en el ensayo: En un ensayo positivo, las secuencias complementarias de la sonda son protegidas de la digestión de la RNasa, debido a que son sometidas a hibridación por el mRNA de hTRT. Las secuencias no complementarias son digeridas lejos de la sonda en presencia de la RNasa y el ácido nucleico complementario objetivo.

Dos sondas de protección de RNasa son describas para propósitos ilustrativos; cualquiera de ellas puede utilizarse en el ensayo. Las sondas difieren en sus secuencias complementarias a la hTRT, pero contienen secuencias no complementarias idénticas, en esta forma de realización, derivadas de la secuencia líder del mRNA último SV40. Desde 5´-3´, una sonda consta de 33 nucleótidos de secuencia no complementaria y 194 nucleótidos de secuencia complementaria de los nucleótidos de la hTRT 2513-2707 para un tamaño de sonda de longitud completa de 227 nucleótidos. Desde 5´-3´ la segunda sonda consta de 33 nucleótidos de secuencia no complementaria y 198 nucleótidos de secuencia complementaria a los nucleótidos de la hTRT 2837-3035 para un tamaño de sonda de longitud completa de 231 nucleótidos. Para llevar a cabo el ensayo, cualquiera de las sondas puede someterse a hibridación con el RNA, es decir, polyA+RNA, a partir de una muestra de la prueba, y posteriormente se agregan la ribonucleasa T1 y la Rnasa A. Después de la digestión, el ARN de la sonda se purifica y se analiza mediante electrofóresis de gel. La detección de un fragmento del nucleótido 194 de la sonda del nucleótido 227 o un fragmentos del nucleótido 198 de la sonda del nucleótido 231 indica el mRNA de hTRT en la muestra.

Las sondas de protección de la RNAsa ilustrativas descritas en este Ejemplo pueden generarse mediante una transcripción in vitro utilizando la polimerasa del ARN T7. Pueden incluirse los ribonucleótidos radioactivos o etiquetados de alguna otra forma para la síntesis de las sondas etiquetadas. Los moldes para la reacción de la transcripción in vitro para producir las sondas del ARN son productos de la PCR. Estas sondas ilustrativas pueden sintetizarse utilizando la polimerasa T7 seguida por una amplificación de la PCR del DNA del pGRN121 utilizando iniciadores que expandan la región complementaria correspondiente del gene de la hTRT o el mRNA. Además, el iniciador en sentido descendiente contiene las secuencias del promotor de polimerasa de ARN T7 y las secuencias no complementarias.

Para la generación de la primera sonda de protección de la RNAsa, se utiliza el producto de la PCR a partir del siguiente par del iniciador (T701 y 01 inverso) :

T701 5´-GGGAGATCTTAATACGACTCACTATAGATTCAGGCCATGGTGCTGCGC CGGC TGTCAGGCTCCCACGACGTAGTCCATGTTCAC-3´; y 01 5´GGGTCTAGATCCGGAA GAGTGT CTGGAGCAAG-3´ inverso.

Para la generación de la segunda sonda de protección de la RNAsa, se utilizó el producto de la PCR a partir del siguiente par del iniciador (T702 y 02 inverso) :

T702 5´-GGGAGATCTTAATACGACTCACTATAGATTCAGGCCATGGTGCTGC GCCGGCT GTCAGGGCGGCCTTCTGGACCACGGCATACC-3´; y 02 5´-G GTCTAGACGATATCC ACAGGGCCTGGCGC-3´ inverso.

Ejemplo 12

CONSTRUCCIÓN DE UN ARBOL FILOGENÉTICO QUE COMPARA LA hTRT Y OTRAS TRANSCRIPTASAS INVERSAS

Se construyó un árbol filogenético (Figura 6) mediante la comparación de los 7 dominios RT definidos por Xiong y Eickbush (1990, EMBO J. 9:3353) . Después de la alineación por secuencias de los motivos 1, 2 y A-E a partir de las polimerasas 4TRTs, 67RT y 3RNA, el árbol se construyó utilizando el método NJ (Neighbor Joining) (Unión de Vecinos) (Saitou y Nei, 1987, Mol. Biol. Evol. 4:406) . Los elementos de la misma clase que se ubican en la misma rama del árbol se simplifican como cuadro. La longitud de cada cuadro corresponde al elemento más divergente dentro de este cuadro.

Las TRTs parecen estar relacionadas más estrechamente con las Rts asociadas con el msDNA, intrones del grupo II y retrotransposones sin LTR (repetición de terminal larga) que con el retrotransposón del LTR y las Rts virales. La relación de las RTs de la telomerasa con la rama sin LTR de retroelementos es intrigante, dado que estos últimos elementos tienen la telomerasa reemplazada para el mantenimiento del telómero en Drosophila. Sin embargo, el descubrimiento más sorprendente es que las TRTs forman un subgrupo discreto, relacionado de una manera casi igual de estrecha con las polimerasas del ARN dependiente del ARN de los virus del ARN con filamentos de más, como por ejemplo el poliovirus que cualquiera de las Rts previamente conocidas. Considerando que los cuatro genes de telomerasa provienen de organismos distantes con respecto a su evolución --protozoarios, hongos y mamíferos-- esta agrupación separada no puede explicarse por la falta de diversidad filogenética en el conjunto de datos. En lugar de esto, esta bifurcación profunda sugiere que las Rts de la telomerasa son un grupo antiguo, quizás originado con el primer eucariote.

La identificación de la proteína del GenBank o los números de admisión utilizados en el análisis filogenético fueron: msDNAs (94535, 134069, 134074, 134075, 134078) , intrones del grupo II (483039, 101880, 1332208, 1334433, 1334435, 133345, 1353081) , plásmido del mitocrondrio/RTL (903835, 134084, retrotransposones sin LTR (140023, 84806, 103221, 103353, 134083, 435415, 103015, 1335673, 85020, 141475, 106903, 130402, U0551, 903695, 940390, 2055276, L08889) , retrotransposones de LTR (74599, 85105, 130582, 99712, 83589, 84126, 479443, 224319, 130398, 130583, 1335652, 173088, 226407, 101042, 1078824) , hepDNAavirus (I 18876, 1706510, 118894) , caulimovirus (331554, 130600, 130593, 93553) , retrovirus (130601, 325465, 74601, 130587, 130671, 130607, 130629, 130589, 130631, 1346746, 130651, 130635, 1780973, 130646) . La alineación se analizó utilizando ClustalW 1.5 [J.D. Thompson, D.G. Higgins, T.J. Gibson, Investigación de Acidos Nucleicos 22, 4673 (1994) y PHYLIP 3.5 [J. Felsenstein, Cladisfics 5, 164 (1989) ].

Ejemplo 13

TRANSFECCIÓN DE FIBROBLASTOS HUMANOS CULTIVADOS (BJ) CON EL PLÁSMIDO DE CONTROL Y EL PLÁSMIDO QUE CODIFICA LA hTRT

Este Ejemplo demuestra que la expresión de la proteína de hTRT recombinante en una célula mamífera da como resultado la generación de una telomerasa activa.

Los fibroblastos BJ subconfluentes fueron tripsinizados y resuspendidos en un medio fresco (DMEM/199 que contenía 10% de suero de becerro fetal) en una concentración de 4 X 106 células/ml. Las células fueron transfectadas utilizando electroporación con el electroporador BioRad Gene Pulser™. Opcionalmente, también se pueden transfectar las células utilizando el reactivo Superfect™ (Qiagen) de acuerdo con las instrucciones del fabricante. Para la electroporación, se colocaron 500 !l de la suspensión celular en una cubeta de electroporación (BioRad, 0.4 cm de abertura del electrodo) . Se agregó DNA del plásmido (2!g) a las cubetas y la suspensión se mezcló suavemente y se incubó durante 5 minutos. El plásmido de control (pBBS212) no contenía inserto detrás del promotor MPSV y el plásmido experimental (pGRN133) expresó la hTRT a partir del promotor MPSV. Las células se electroporaron a 300 voltios y 960 !FD. Después de entregar el impulso, las cubetas se colocaron en hielo durante aproximadamente 5 minutos antes de la galvanoplastia sobre placas de cultivo de tejido de 100 mm en el medio. Después de 6 horas, el medio fue reemplazado por un medio fresco. 72 horas después de la transfección, las células se tripsinizaron, se lavaron una vez con PBS, se formaron en cápsulas y se almacenaron congeladas a 80°C. Los extractos celulares se prepararon a una concentración de 25, 000 células/!l por medio de un método de lisis de detergente modificado (consultar Bodnar y colaboradores, 1996, Exp. Cell Res. 228:58; Kim y colaboradores, 1194, Ciencia 266:2011, y tal como se describe en las patentes y las publicaciones relacionadas con el ensayo TRAP, tal como se indicó anteriormente) y la actividad de la telomerasa en los extractos celulares fue determinada utilizando un ensayo TRAP basado en la PCR modificada (Kim y colaboradores, 1994, Bodnar y colaboradores, 1996) . De manera breve, se utilizaron equivalentes celulares 5 X 104 en la porción de extensión del iniciador de la telomerasa de la reacción. A pesar de que el extracto se toma por lo general directamente por la reacción de extensión de la telomerasa para la amplificación de la PCR, también se puede extraer una vez con fenol/cloroformo y otra vez con cloroformo antes de la amplificación de la PCR. Se utilizó una quinta parte del material en la porción de amplificación de la PCR de la reacción TRAP (aproximadamente 10, 000 equivalentes celulares) . Una mitad de la reacción TRAP fue cargada en el gel para su análisis, de tal forma que cada vía en la Figura 25 representa los productos de la reacción de 5, 000 equivalentes celulares. Los extractos de las células transfectadas con pGRN133 fueron positivos para la actividad de la telomerasa mientras que los extractos de las células no transfectadas (no mostradas) o transfectadas con el plásmido de control, no mostraron actividad de la telomerasa. Experimentos similares utilizando células RPE dieron el mismo resultado.

La reconstitución en las células BJ también se llevó a cabo utilizando otras construcciones de la hTRT (es decir, pGRN145, pGRN155 y pGRN138) . La reconstitución utilizando estas construcciones pareció dar como resultado una actividad mayor de la telomerasa que en las células transfectadas con pGRN133.

El nivel más alto de actividad de la telomerasa se logró utilizando pGRN155. Como se discutió anteriormente, el pGRN155 es un vector que contiene el promotor final importante del adenovirus como elemento de control para la expresión de la hTRT y se mostró para reconstituir la actividad de la telomerasa cuando se transfectó en las células BJ.

De manera notable, cuando se llevó a cabo la reconstitución utilizando el pGRN138 de la proteína de fusión de la hTRT-GFP (que se localiza en el núcleo, consultar Ejemplo 15, mencionado posteriormente) ya sea in vitro (consultar Ejemplo 7) o in vivo (transfección dentro de las células BJ) se produjo como resultado una actividad en la telomerasa. Por ejemplo, mediante la transfección en las células BJ, tal como se describió anteriormente, la actividad de la telomerasa fue comparable a la resultante de la reconstitución in vitro utilizando el pGRN133 o pGRN145.

Se obtuvieron resultados similares después de la transfección de epitelio pigmentado retinal humano normal (RPE) con los vectores de expresión de la hTRT de la invención. Se cree que el envejecimiento de las células de RPE contribuye a o provoca la enfermedad de degeneración macular relacionada con la edad. Las células de RPE tratadas de acuerdo con los métodos de la invención utilizando los vectores de expresión de hTRT de la invención, deben mostrar un envejecimiento retrasado, en comparación con las células no tratadas, por lo tanto deben ser útiles en las terapias de trasplantes para tratar o prevenir la degeneración macular relacionada con la edad.

Ejemplo 14

CONSTRUCCIÓN DEL INFORMADOR DEL PROMOTOR

Este Ejemplo describe la construcción de plásmidos en los cuales los genes informadores están enlazados de manera operativa con las secuencias ascendentes de la hTRT que contienen elementos promotores. Los vectores tienen varios usos, incluyendo la identificación de los factores regulatorios de transcripción cis y trans in vivo y para la clasificación de agentes capaces de modular (por ejemplo, activando o inhibiendo) la expresión de la hTRT (por ejemplo, clasificación de medicamento) . A pesar de que puede utilizarse cierto número de informadores (por ejemplo, luciferasa de luciérnaga, º-glucuronidasa, º-galactosidasa, trasferasa de acetil de cloranfenicol, y GFP y similares) , se utilizó la fosfatasa alcalina secretada por humano (SEAP; CloneTech) para los experimentos iniciales. El gene informador SEAP codifica una forma truncada de la enzima de la placenta que carece del dominio de anclaje de la membrana, permitiendo de esta forma que la proteína sea secretada de manera eficiente desde las células transfectadas. Se ha mostrado que los niveles de actividad de SEAP detectados en el medio de cultivo son directamente proporcionales a los cambios en las concentraciones intracelulares del mRNA de SEAP y la proteína (Berger y colaboradores, 1988, Gene 66:1; Cullen y colaboradores, 1992, Meth. Enzymol. 216:362) .

Se transfectaron cuatro construcciones (pGRN148, pGRN150, "pSEAP2 básico" (sin secuencias promotoras = control negativo) y "control pSEAP2" (contiene el promotor e intensificador SV40) por triplicado en células mortales e inmortales.

El plásmido pGRN148 se construyó tal como se ilustra en la Figura 9. De manera breve, un fragmento de Bg12-Eco47III del pGRN144 se digirió y clonó dentro del sitio Bg1II-NruI de pSeap2Básico (Clonthec, San diego, CA) . Un segundo informador-promotor, el plásmido pGRN150, incluye las frecuencias derivadas del intrón de la hTRT descrito en el ejemplo 3, para emplear secuencias regulatorias que pueden estar presentes en el intrón. El Met de iniciación se somete a mutación para Leu, de tal forma que el segundo ATG después de la región del promotor será el ATG de iniciación o el SEAP ORF.

Las construcciones del pGRN148 y pGRN150 (que incluyen el promotor de la hTRT) fueron transfectadas en células mortales (células BJ) e inmortales (293) . Todas las transfecciones se utilizaron en paralelo con dos plásmidos de control. Un plásmido de control negativo (pSEAP básico) y un plásmido de control positivo (control pSEAP) que contiene el promotor de inicio SV40 y el intensificador SV40) .

En las células inmortales, las construcciones del pGRN148 y el pGRN150 parecen activar la expresión SEAP de una manera igual de eficiente que el control positivo de pSEAP2 que (contiene el promotor de inicio e intensificador SV40) . En contraste, en las células mortales solo el control pSEAP2 proporciono una actividad detectable. Estos resultados indican que, tal como se esperaba, las secuencias del promotor de la hTRT son activas en las células tumorales pero no en células mortales.

Se obtuvieron resultados similares utilizando otra línea de células normales (RPE, o células de epitelio pigmental retinal) . En las células de RPE transfectadas con el pGRN150 (que contiene 2.2 KB de la secuencia genómica ascendente) , la región del promotor del promotor de hTRT estuvo inactiva a pesar de que el plásmido de control pSEAP2 estuvo activo.

Tal como se indico anteriormente, los plásmidos en los cuales los genes informadores están enlazados de manera operativa con las secuencias ascendentes de hTRT que contienen elementos promotores, son extremadamente útiles para la identificación y clasificación de agentes moduladores de la actividad de la telomerasa, utilizando técnicas de transfección tanto transitorias como estables. Por ejemplo, en un enfoque, los transformantes estables del pGRN148 se producen en células negativas de telomerasa y positivas de telomerasa mediante la cotrasnfección con un marcador seleccionable eucariótico (como por ejemplo el neo) de acuerdo con Ausubel y colaboradores, 1997, tal como se mencionó anteriormente. Las líneas celulares resultantes se utilizan para la clasificación de agentes moduladores de la telomerasa putativa, por ejemplo, mediante la comparación de la expresión activada por el promotor de hTRT en la presencia y ausencia de un compuesto de prueba.

Los vectores promotores-informadores (y otros) de la invención también se utilizan para identificar elementos regulatorios de transcripción y traducción con actuación trans y cis. Los elementos regulatorios de transcripción de actuación cis incluyen los promotores e intensificadores del gene de telomerasa. La identificación y aislamiento de los agentes regulatorios de actuación cis y trans ofrecen métodos adicionales y reactivos para identificar agentes que modulan la transcripción y traducción de la telomerasa.

Ejemplo 15

LOCALIZACIÓN SUBCELULAR DE LA hTRT

Se construyó una proteína de fusión que posee regiones de hTRT y de proteína fluorescente verde mejorada (EGFP; Cormack y colaboradores, 1996, Gene 173:33) tal como se describe posteriormente. La mitad de EGFP ofrece una etiqueta o señal detectable de tal forma que puede determinarse fácilmente la presencia o ubicación de la proteína de fusión. Debido a que las proteínas de fusión-EGFP se localizan en los compartimientos celulares correctos, esta construcción puede utilizarse para determinar la ubicación subcelular de la proteína de hTRT.

A. Construcción del pGRN138

Se construyó un vector para la expresión de una proteína de fusión de hTRT-EGFP en células mamíferas colocando el inserto EcoRI del pGRN124 (consultar ejemplo 6) dentro del sitio EcoRI del pEGFP-C2 (Clontech, San Diego, CA) . La secuencia del aminoácido de la proteína de fusión se proporciona abajo. Los residuos de EGFP están en negritas, los residuos codificados por la región no traducida de 5´ del mRNA de la hTRT están subrayados, y la secuencia de la proteína del hTRT está en letra normal.

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDH MKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEDGTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMAD KQKNGIKVNFKIRHNIEDGSVOLADHYUQNTPIGDGPVLLPDNHYLSTUSALSQKDTNEKRDHMVLLEFVTAAGITLG MDELYKSGRTQISSSSFEFAAASTORCVLLRTWEALAPATPAMTRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQG WRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGP PEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPP HASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPQRPRRGAPEPERTPVGQGSWAHPGRTR GPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRUHHAGPPSTSRPPPPWDTPCPPVYAETKHFLYSSGDKE QLRPSFLLSSLRPSLTGARRLVETYFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLR AAVTPAAGVCAREQPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGRGSRHNERRFLR NTKKFISLGKHAKLSLQELTWKMSVRVCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETT FQKNRLFFYRPSVWSKLQSIGIRQHLKRVQLRELSEAEVROHREARPALLTSRLRFIPKPDGLRPIVNMVIVVGARTFR REKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDR LTEVIASIIKPQNTICVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASS GLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKT FLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDISSIARTSIRASVTF NRGFKAGRNMRRKLFGVLRLRKCHSLFLDLQVNSLQTVCTNIYKILLLQAIRFHACVLQLPFHQQVWKNPTFFLRVISD TASLCYSILKAKNAGSLGAKGAAGPLPSEAEQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEA AANPALPSDFKTILD

Pueden elaborarse otras construcciones de la fusión EGFP utilizando la secuencia de codificación de hTRT (por ejemplo, truncada) parcial y se utiliza, tal como se describe posteriormente, para identificar actividades de regiones particulares del polipéptido del hTRT.

B. Localización nuclear y usos del pGRN138

La transfección de las células NIH 293 y BJ con el pGRN138 confirmó la localización nuclear de la hTRT expresada de manera recombinante. Las células fueron transfectadas con pGRN138 (EGFP-hTRT) con una construcción de control (expresando únicamente la EGFP) . La localización nuclear de la EGFP-hTRT es aparente en ambos tipos de células mediante microscopía de fluorescencia. Tal como se indico anteriormente, la proteína de fusión de hTRT-GFP del pGRN138 apoya la reconstitución de la actividad de la telomerasa en el sistema de traducción y transcripción tanto in vitro como in vivo cuando se transfectan en las células B.J.

Las proteínas de la fusión de hTRT-EGFP (o proteínas de fusión detectables similares) pueden utilizarse en una variedad de aplicaciones. Por ejemplo, la construcción de fusión descrita en este ejemplo, o una construcción de EGFP y una forma truncada de la hTRT, puede utilizarse para evaluar la capacidad de la hTRT y los variantes para entrar a un núcleo celular y/o localizar los extremos del cromosoma. Además, las células transfectadas de manera estable o transitoria con el pGRN138 se utilizan para clasificar compuestos con el fin de identificar medicamentos o compuestos moduladores de la telomerasa. Los agentes que interfieren con la localización nuclear o la localización del telómero pueden identificarse como inhibidores de telomerasa. Las líneas celulares tumorales que expresan de manera estable la EGFP-hTRT pueden ser útiles para este propósito. Los moduladores potenciales de la telomerasa serán administrados a estas células transfectadas y se evaluara la localización de la EGFP-hTRT. Además, puede utilizarse el método FACS u otro método basado en la fluorescencia para seleccionar las células que expresan la hTRT para proveer poblaciones homogéneas para la clasificación de medicamentos, en particular cuando se emplea la transacción transitoria de células.

En otras aplicaciones, las regiones de la hTRT pueden someterse a mutagénesis para identificar regiones (por ejemplo, los residuos 193-196 (PRRR) y 235-240 (PKRRR) ) requeridas para la localización nuclear, que son los objetivos para los medicamentos anti-telomerasa (moduladores de la actividad de la telomerasa) . Otras aplicaciones incluyen:

uso de la proteína de fusión como marcador fluorescente de la transfección celular eficiente para ambos experimentos de transfección transitorios y al establecer líneas celulares estables que expresen la EGFP-hTRT;

expresión de una fusión de hTRT-EGFP con señales de localización nucleares mutadas (deficiente para la localización nuclear) en células inmortales, con el fin de que la EGPF mutante de hTRT limpie toda la hTR de las células inmortales, reteniéndola en el citoplasma y evitando el mantenimiento del telómero; y uso como proteína etiquetada para la inmunoprecipitación.

Ejemplo 16

EFECTO DE LA MUTACIÓN EN LA ACTIVIDAD CATALÍTICA DE LA TELOMERASA

Este ejemplo describe las proteínas variantes de hTRT que poseen aminoácidos alterados y una actividad catalítica de la telomerasa alterada. Las substituciones del aminoácido seguidas por el análisis funcional es un medio estándar de evaluar la importancia y función de una secuencia del polipéptido. Este ejemplo demuestra que los cambios en los motivos de la transcriptasa inversa (RT) y la telomerasa (T) afectan la actividad catalítica de la telomerasa.

Se utiliza la nomenclatura convencional para describir los mutantes: el residuo objetivo en la molécula nativa (hTRT) se identifica por un código y posición de una letra, y el residuo correspondiente en la proteína mutante se indica con un código de una letra. De esta manera, por ejemplo, "K626A" especifica un mutante en el cual la lisina en la posición 626 (es decir, en el motivo 1) de la hTRT es cambiada por una alanina.

A. Mutación del motivo FFYxTE de hTRT

En experimentos iniciales, se produjo un vector que codifica una proteína mutante de hTRT, "F560A", en la cual se cambio el aminoácido 560 de la hTRT de fenilalanina (F) a alanina (A) mediante una mutagénesis dirigida en el sitio del pGRN121 utilizando técnicas estándares. Esta mutación desintegra el motivo FFYxTE de TRT. Se mostró que el polinucleótido mutante F560A resultante dirige la síntesis de una proteína de hTRT de longitud completa tal como se evaluó utilizando un sistema de transcripción/traducción del lisado del reticulocito libre de células en presencia de35S-metionina.

Cuando el polipéptido mutante fue cotraducido con hTR, tal como se describe en el ejemplo 7, no se detectó actividad de la telomerasa tal como se observó mediante la TRAP utilizando 20 ciclos de la PCR, a pesar de que la cotraducción de la hTRT/hTR de control reconstituyo la actividad. Con 30 ciclos de la PCR en el ensayo TRAP, la actividad de la telomerasa pudo observarse con la hTRT mutante, pero fue considerablemente menor que la hTRT de control (tipo silvestre) .

B. Mutagénesis Dirigida en el Sitio Adicional de los Residuos del Aminoácido de hTRT

Los aminoácidos conservados en seis motivos RT fueron cambiados por alanina utilizando las técnicas de mutagénesis dirigida en sitio estándar (consultar, por ejemplo, Ausubel, mencionado anteriormente) para evaluar su contribución a la actividad catalítica. Los mutantes fueron sometidos a ensayo utilizando la telomerasa IVR y empleando el ensayo TRAP/convencional de dos pasos detallado en el ejemplo 7.

Los mutantes de K626A (motivo 1) , R631A (motivo 2) , D712A (motivo A) , Y717A (motivo A) , D868A (motivo C) habían reducido en gran medida la actividad de la telomerasa no detectable, mientras que los mutantes Q833A (motivo B) y G932A (motivo E) exhibieron niveles intermedios de actividad. Dos mutaciones fuera de los motivos RT, R688A y D897A, tuvieron una actividad equivalente a la hTRT tipo silvestre. Estos resultados fueron consistentes con las mutaciones análogas en las transcriptasas inversas (Joyce y colaboradores, 1994, Ann. Rev. Biochem. 63:777) y son similares a los resultados obtenidos con Est2p (consultar Lingner, 1997 Ciencia 276:561) . Los experimentos identifican residuos en los motivos RT críticos y no críticos para la actividad enzimática y demuestran que la hTRT es la proteína catalítica de la telomerasa humana. Las mutaciones proporcionan polipéptidos de hTRT variantes que tienen utilidad, por ejemplo, como reguladores dominantes/negativos de la actividad de la telomerasa.

La alineación del aminoácido de las TRTs conocidas identificó un motivo especifico de la telomerasa, motivo T (consultar arriba) . Para determinar la función catalítica de este motivo de hTRT, se construyo una eliminación de seis aminoácidos en este motivo (L 560-565;FFYxTE) , utilizando las técnicas de mutagénesis dirigida en sitio estándar (Ausubel, mencionado anteriormente) . La eliminación fue sometida a ensayo utilizando la telomerasa IVR y empleando el ensayo TRAP/convencional de dos pasos detallado en el ejemplo 7. El mutante L560-565 no presentó una actividad de telomerasa observable después de 25 ciclos de la PCR mientras que la telomerasa IVR de hTRT 5 tipo silvestre produjo una señal fuerte. Cada aminoácido en cada residuo del motivo T se examino de manera independiente y de forma similar; los mutantes F560A, Y562A, T564 y E565A conservaron niveles intermedios de actividad de la telomerasa, mientras que un mutante de control, el F487A, tuvo un efecto mínimo en la actividad. De manera notable, el mutante F561A presento una actividad ampliamente reducida o no detectable de la telomerasa, a pesar de que la actividad fue rehabilitada completamente en su "inversor", el F561A561F. El F561AF561F cambia la

posición mutada otra vez a su fenilalanina original. Éste es un control que demuestra que no ocurrieron otros cambios en el aminoácido al plásmido que pudieran representar la actividad disminuida observada. De esta manera, el motivo T es el primer motivo sin RT que se comprueba que es absolutamente requerido para la actividad de la telomerasa.

El motivo T puede utilizarse para la identificación de TRTs a partir de otros organismos, y las proteínas de hTRT que incluyen variantes de este motivo pueden utilizarse como un regulador dominante/negativo de la actividad de la telomerasa. A diferencia de la mayoría de otras RTs, la telomerasa se asocia de manera estable con y copia a través de un proceso una pequeña porción de un ARN sencillo (es decir, hTR) , por lo tanto, el motivo T puede implicarse en la mediación de enlace de la hTR, la capacidad de proceso de la reacción, u otras funciones únicas para la RT de la telomerasa.

Ejemplo 17

CLASIFICACIÓN PARA LOS MODULADORES DE ACTIVIDAD DE LA TELOMERASA UTILIZANDO

COMPONENTES DE LA TELOMERASA EXPRESADOS DE MANERA RECOMBINANTE

Este ejemplo describe el uso de la telomerasa reconstituida in vitro para la clasificación e identificación de moduladores con actividad de telomerasa. El ensayo descrito se adapta fácilmente a los métodos de alto rendimiento (por ejemplo, que utilizan placas múltiples y/o sistemas robóticos) . Diversas variaciones a los pasos del ensayo serán aparentes para las personas capacitadas en la técnica después de la revisión de esta presentación.

Los clones recombinantes para los componentes de la telomerasa (por ejemplo, la hTRT y la hTR) son transcritos y traducidos (únicamente la hTRT) en una reacción in vitro tal como se indica a continuación y como se describe en el ejemplo 7 anterior, utilizando el sistema del lisado del reticulocito acoplado TNT®T7 (Promega) , que se describe en la patente de los Estados Unidos Núm. 5, 324, 637, siguiendo las instrucciones del fabricante:

Reactivo Cantidad por reacción (!L) Lisado del recticulocito de conejo de TNT 25 Amortiguador de reacción TNT 2 Pol. de ARN T7 de TNT 1 Mezcla AA (completa) 1 Inhibidor de RNasa del iniciador 1 Agua libre de nucleasa 16 Corte XBA1 pGRN121 [hTRT] (0.5 !g) 2 Corte Fsp1 pGRN164 [hTR] (0.5!g) 2

La reacción se incubó a 30ºC durante dos horas. El producto se purifica posteriormente en un filtro de DEAE ultrafree-MC (Millipore) .

El producto de telomerasa recombinante (IVRP) se somete a ensayo en presencia y ausencia de concentraciones múltiples de compuestos de prueba que se solubilizan en DMSO (por ejemplo 10!M - 100!M) . Los compuestos de prueba se incuban previamente en un volumen total de 25 !L durante 30 minutos a temperatura ambiental en presencia de 2.5 !L de IVRP, 2.5% de DMSO, y amortiguador TRAP 1 X (20 mM de Tris-HCl, pH 8.3, 1.5 mM de 45 MGCl2, 63mM Kcl, 0.05% de Tween20, 1.0 mM de EGTA, 0.1 mg/ml de albumina de suero de bovino) . Después de la preincubación, se agregan 25 !L de la mezcla de la reacción del ensayo TRAP a cada muestra. La mezcla de la reacción del ensayo TRAP está compuesta por amortiguador TRAP 1X, 50 !L de dNTP, 2.0 !g/ml del iniciador ACX, 4 !g/ml del iniciador U2, 0.8 attomol/ml TSU2, 2 unidades/50 !l de polimerasa Taq (Perkin Elmer) y 2 !g/ml del iniciador etiquetado con la terminación [32P]5´ TS (3, 000 Ci/mmol) . Los tubos de reacción se colocan posteriormente 50 en el ciclador térmico de la PCR (MJ Research) y la PCR se lleva a cabo de la siguiente forma: 60 minutos a 30ºC, 20 ciclos de {30 segundos a 94ºC, 30 segundos a 60ºC, 30 segundos a 72ºC}, 1 minuto a 72ºC, enfriamiento a 10ºC. Se describe el ensayo TRAP, tal como se indico arriba, en la patente de los Estados Unidos Núm. 5, 629, 154. Los iniciadores y el substrato utilizado tienen las secuencias: iniciador TS (5´-AATCCGTCGAGCAGAGTT-3´) iniciador ACX (5´-GCGCGG[CTTACC] 3CTAACC-3´) ; Iniciador U2 (5´-ATCGCTTCTCGGCCTTTT-3´) ; TSU2 (5´

55 AATCCGTCGAGCAGAGTTAAAAGGCCGAGAAGCGAT-3´) .

Después de finalizar el paso de la PCR, se agregan 4 !l del amortiguador de carga 10X que contiene azul de bromofenol a cada tubo de reacción y los productos (20 !l) se someten a prueba en una PAGE de nodesnaturalización al 12.5% en el 0, 5X TBE a 400 V. El gel completado se seca posteriormente y los productos de TRAP se visualizan mediante el Phosphorimager o mediante una autoradiografía. La actividad de la telomerasa en presencia del compuesto de prueba se mide comparando la comparación de la etiqueta en el producto de la reacción con una reacción paralela que carezca del agente.

Los siguientes clones descritos en los ejemplos han sido depositados ante la Recolección de Cultivos de Tipo Americano, Rockville, MD 20852, EUA:

Fago lambda A 25-1.1Numero de admisión ATCC 209024 pGRN121Numero de admisión ATCC 209016 Fago lambda A Gc5Numero de admisión ATCC 98505




Reivindicaciones:

1. Polinucleótido que comprende una secuencia que codifica un polipéptido capaz de presentar actividad catalítica de telomerasa cuando se asocia con una ARN telomerasa y que es:

(a) un polinucléotido que presenta la secuencia de la inserción del plásmido ATCC 209016; o

(b) un polinucleótido que se hibrida con (a) en condiciones restrictivas; o

(c) un polinucleótido que se hibrida con la SEC ID nº 3 ó con la SEC ID nº 8 en condiciones restrictivas; o

(d) una secuencia de polinucleótido que se degenera como resultado del código genético para las secuencias definidas en (a) o (b) .

2. Polinucleótido según la reivindicación 1, unido operativamente a un promotor.

3. Utilización de un polinucleótido según la reivindicación 1, en el análisis o la detección de una secuencia del gen hTHT o de hTHT RNA.

4. Utilización de un polinucleótido según la reivindicación 1 o la reivindicación 2, para la preparación de una célula huésped recombinante.

5. Vector que contiene un polinucleótido según la reivindicación 1.

6. Célula que contiene un vector según la reivindicación 5.

7. Utilización in vitro de un vector de expresión que contiene un polinucleótido según la reivindicación 1, en la expresión de un polipéptido capaz de presentar actividad catalítica de telomerasa cuando se asocia a una ARN telomerasa.

8.Composición que comprende por lo menos 20% de proteína catalítica de telomerasa humana que presenta una secuencia codificada por un polinucleótido según la reivindicación 1, presentando la composición únicamente actividad catalítica de telomerasa si se añade a la composición ARN telomerasa con el fin de asociarse con dicha proteína.

9. Utilización de una composición según la reivindicación 8, en la preparación de un complejo, acomplejando un componente del molde de ARN con dicha proteína.

10. Utilización de un polinucleótido según la reivindicación 1, en el aumento de la capacidad proliferante de una célula de vertebrado introduciendo in vitro dicho polinucleótido dentro de la célula.

11. Utilización de un polipéptido que se puede obtener por expresión de un vector según la reivindicación 5, en el aumento de la capacidad proliferante de una célula de vertebrado introduciendo in vitro dicho polipéptido en la célula.

12. Utilización de una composición según la reivindicación 8, en el aumento de la capacidad proliferante de una célula de vertebrado introduciendo dicha composición dentro de la célula in vitro.

13. Procedimiento para la preparación de una composición de telomerasa recombinante que comprende la expresión de un polinucleótido según la reivindicación 1, para producir un polipéptido, poner en contacto dicho polipéptido con un componente del molde de RNA, preferentemente un componente de ARN telomerasa humana, en condiciones tales que dicho polipéptido y dicha ARN telomerasa se asocian para formar una enzima de telomerasa capaz de catalizar la adición de nucleótidos a un sustrato de telomerasa.

14. Anticuerpo o su fragmento de unión que se une específicamente a una proteína capaz de presentar una actividad catalítica de la telomerasa si dicha proteína se asocia a una ARN telomerasa, presentando dicha proteína una secuencia codificada por un polinucleótido según la reivindicación 1, siendo opcionalmente monoclonal dicho anticuerpo o fragmento.

15. Hibridoma capaz de secretar un anticuerpo según la reivindicación 14.

16. Procedimiento para determinar si un compuesto, una composición o un tratamiento es un modulador de la actividad o de la expresión de la transcriptasa inversa de telomerasa, que comprende exponer in vitro una célula según la reivindicación 6 al compuesto, la composición o el tratamiento y determinar si existe un cambio en la actividad o la expresión de la transcriptasa inversa de telomerasa.

17. Procedimiento para proporcionar un producto farmacéutico, que comprende efectuar las etapas de un procedimiento según la reivindicación 16 y a continuación formular un modulador de la actividad de la transcriptasa inversa de telomerasa o de la expresión de hTRT, identificado por dicho método para la utilización farmacéutica para conseguir la modulación de la actividad de la transcriptasa inversa de telomerasa o de la expresión de hTRT.

18. Método para detectar en una muestra un producto génico de hTRT, su mutante o variante, que comprende poner en contacto dicha muestra con un anticuerpo o fragmento de unión según la reivindicación 14 y determinar si se ha formado un complejo con un producto génico de hTRT, mutante o variante.

19. Método para detectar en una muestra un producto génico de hTRT, su mutante o variante, que comprende poner en contacto dicha muestra con un polinucleótido según la reivindicación 1 o un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica a, o exactamente complementaria a una secuencia contigua al polinucleótido del apartado (a) de la reivindicación 1 y determinar si se ha formado un complejo de hibridación.

20. Método para detectar en una muestra un producto génico de hTRT, su mutante o variante, que comprende utilizar un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente por lo menos 15 nucleótidos, idéntica a, o exactamente complementaria a una secuencia contigua del polinucleótido del apartado

(a) de la reivindicación 1, en un procedimiento de amplificación y determinar si se ha formado un producto específico de la amplificación.

21. Método para la detección de la presencia de por lo menos una célula humana positiva a la telomerasa en una muestra biológica que comprende células humanas, que comprende:

(a) medir la cantidad de un producto génico de hTRT, de su mutante o variante en dicha muestra utilizando las etapas de un procedimiento según cualquiera de las reivindicaciones 18 a 20; y

(b) comparar la cantidad de dicho producto génico, de su mutante o variante así medida con una referencia que correlaciona con una muestra que carece de células positivas a telomerasa, en el que la presencia de una cantidad mayor del producto génico de hTRT, mutante o variante en dicha muestra comparada con dicha referencia correlaciona con la presencia de células positivas a telomerasa en dicha muestra biológica.

22. Método para el diagnóstico de un estado relacionado con la telomerasa, que comprende:

(a) determinar la cantidad de un producto génico de hTRT, mutante o variante en una muestra de célula o tejido de un paciente utilizando las etapas de un procedimiento según cualquiera de las reivindicaciones 18 a 20; y

(b) comparar la cantidad de dicho producto génico, mutante o variante en la muestra con la cantidad en una célula o tejido sanos del mismo tipo, en el que una cantidad diferente de dicho producto génico en la muestra comparada con la célula o tejido sanos es el diagnóstico de un estado relacionado con la telomerasa.

23. Kit para la detección de un gen de hTRT, producto génico, mutante o variante, comprendiendo dicho kit un polinucleótido según la reivindicación 1 o un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente de por lo menos 15 nucleótidos, idéntica a, o exactamente complementaria a una secuencia contigua de un polinucleótido del apartado (a) de la reivindicación 1.

24. Kit para la detección de un gen de hTRT, producto génico, mutante o variante, comprendiendo dicho kit un polinucleótido que se puede obtener expresando un vector según la reivindicación 5.

25. Kit para la detección de un gen de hTRT, producto génico, mutante o variante, comprendiendo dicho kit una composición según la reivindicación 8.

26. Kit para la detección de un gen de hTRT, producto génico, mutante o variante, comprendiendo dicho kit un anticuerpo o su fragmento de unión según la reivindicación 14.

27. Polinucleótido según la reivindicación 1 o un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente de por lo menos 15 nucleótidos, idéntica a, o exactamente complementaria a una secuencia contigua del polinucleótido del apartado (a) de la reivindicación 1, para su utilización como producto farmacéutico.

28. Polipéptido que se puede obtener mediante la expresión de un vector según la reivindicación 5, para su utilización como producto farmacéutico.

29. Composición según la reivindicación 8, para su utilización como producto farmacéutico.

30. Anticuerpo o fragmento de unión según la reivindicación 14, para su utilización como producto farmacéutico.

31. Utilización de un polinucleótido según la reivindicación 1 o de un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente de por lo menos 15 nucleótidos, idéntica a, o exactamente complementaria a una secuencia contigua del polinucleótido del apartado (a) de la reivindicación 1, para la preparación de un medicamento.

32. Utilización de un polipéptido que se puede obtener mediante la expresión de un vector según la reivindicación 5, en la preparación de un medicamento.

33. Utilización de una composición según la reivindicación 8, en la preparación de un medicamento.

34. Utilización de un anticuerpo o fragmento de unión según la reivindicación 14, en la preparación de un medicamento.

35. Utilización de un polinucleótido según la reivindicación 1 o de un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente de por lo menos 15 nucleótidos, idéntica a, o exactamente complementaria a una secuencia contigua del polinucleótido del apartado (a) de la reivindicación 1, en la preparación de un medicamento para aumentar la capacidad de proliferación de una célula de vertebrado, disminuir la capacidad de proliferación de una célula de vertebrado o tratar un estado asociado a un nivel elevado o disminuido de actividad de la telomerasa.

36. Utilización de un polipéptido que se puede obtener mediante la expresión de un vector según la reivindicación 5, en la preparación de un medicamento para aumentar la capacidad de proliferación de una célula de vertebrado, disminuir la capacidad de proliferación de una célula de vertebrado o tratar un estado asociado a un nivel elevado o disminuido de actividad de la telomerasa.

37. Utilización de una composición según la reivindicación 8, en la preparación de un medicamento para aumentar la capacidad de proliferación de una célula de vertebrado, disminuir la capacidad de proliferación de una célula de vertebrado o tratar un estado asociado a un nivel elevado o disminuido de actividad de la telomerasa.

38. Utilización de un anticuerpo o fragmento de unión según la reivindicación 14, en la preparación de un medicamento para aumentar la capacidad de proliferación de una célula de vertebrado, disminuir la capacidad de proliferación de una célula de vertebrado o tratar un estado asociado a un nivel elevado o disminuido de actividad de la telomerasa.

39. Composición farmacéutica que comprende un polinucleótido según la reivindicación 1 o un polinucleótido que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente de por lo menos 15 nucleótidos, idéntica a, o exactamente complementaria a una secuencia contigua del polinucleótido del apartado (a) de la reivindicación 1, opcionalmente junto con un excipiente farmacéuticamente aceptable.

40. Composición farmacéutica que comprende un polipéptido que se puede obtener mediante la expresión de un vector según la reivindicación 5, opcionalmente junto con un excipiente farmacéuticamente aceptable.

41. Composición farmacéutica que comprende una composición según la reivindicación 8, opcionalmente junto con un excipiente farmacéuticamente aceptable.

42. Composición farmacéutica que comprende un anticuerpo o fragmento de unión según la reivindicación 14, opcionalmente junto con un excipiente farmacéuticamente aceptable.

43. Utilización de un polinucleótido, que comprende una secuencia de por lo menos 12 nucleótidos, opcionalmente de por lo menos 15 nucleótidos, idéntica a o exactamente complementaria a una secuencia contigua del polinucleótido del apartado (a) de la reivindicación 1, en la preparación de una vacuna capaz de provocar una respuesta inmunitaria.

44. Utilización de una composición según la reivindicación 8, en la preparación de una vacuna capaz de provocar una respuesta inmunitaria.






Acerca de · Contacto · Patentados.com desde 2007 hasta 2014 // Última actualización: 27/11/2014.