Polipéptidos estabilizados del factor de crecimiento similares a insulina.

Una proteína precursora del IGF-1 humano, en donde:

(i) uno o más de los siguientes residuos de la proteína precursora se suprimen o mutan: G1, P2, E3, R36 y R37; y

(ii) la escisión del péptido E de IGF-1 mediante una proteasa se reduce mediante la modificación de la proteína precursora, en donde la modificación es la supresión o mutación de R71 o S72 de la proteína precursora.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2007/070468.

Solicitante: NOVARTIS AG.

Nacionalidad solicitante: Suiza.

Dirección: Lichtstrasse, 35 4056 Basel SUIZA.

Inventor/es: GLASS,DAVID JONATHAN, FORNARO,MARA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/65 (Factores de crecimiento de tipo insulina (Somatomedinas), p. ej. IGF-1, IGF-2)

PDF original: ES-2529261_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Polipéptidos estabilizados del factor de crecimiento similares a insulina Antecedentes de la invención

Los factores de crecimiento similares a insulina (IGF) son parte de un sistema complejo que las células utilizan para comunicarse con su ambiente fisiológico. Este sistema complejo (a menudo denominado como los ejes del factor de crecimiento similares a insulina) consiste de dos receptores de la superficie de la célula (IGF-1R y IGF-2R), dos ligandos (IGF-1 e IGF-2), una familia de seis proteínas de enlazamiento de IGF de alta afinidad (IGFBP 1-6), y enzimas asociadas que degradan IGFBP (proteasas). Este sistema no sólo es importante para la regulación de la fisiología normal sino también para una cantidad de estados patológicos (Glass, Nat Cell Biol 5: 87 - 9, 23)

Se ha demostrado que los ejes del IGF juegan un papel en la promoción de la proliferación celular y en la inhibición de la muerte celular (apoptosis). El IGF-1 se secreta principalmente por el hígado como resultado de la estimulación mediante la hormona de crecimiento humana (hGH). Casi cada célula en el cuerpo humano es afectada por el IGF- 1, especialmente las células en los músculos, cartílagos, huesos, hígado, riñón, nervios, piel y pulmones. Además de efectos como los de la insulina, IGF-1 también puede regular el crecimiento celular. IGF-1 e IGF-2 son regulados por una familia de productos génicos conocidos como las proteínas de enlazamiento del IGF. Estas proteínas ayudan a modular la acción del IGF en formas complejas que involucran tanto la inhibición de la acción del IGF al evitar el enlazamiento con los receptores del IGF como también la promoción de la acción del IGF ayudando al suministro a los receptores e incrementando la vida media del IGF en el torrente sanguíneo. Existen por lo menos seis proteínas de enlazamiento caracterizadas (IGFBP1-6).

En su forma madura, el IGF-1 humano (gpetlcgaelvdaquvcgdrgfyfnkptg ygsssrrapqtgivdeccfrscdlrrlem ycaplkpaksa; SEQ ID NO:1), también llamado somatomedina, es una proteína pequeña de 7 aminoácidos que ha demostrado que estimula el crecimiento de un amplio rango de las células en cultivo. La proteína madura inicialmente es codificada mediante tres ARNm variantes de empalme conocidos. El marco de lectura abierto de cada ARNm codifica una proteína precursora que contiene el IGF-1 de 7 aminoácidos y un péptido E particular en el terminal C, que depende del ARNm particular del IGF-1. Estos péptidos E han sido llamados los péptidos Ea (rsvraqrhtdmpktqkevhlknasrgsagnknyrm; SEQ ID NO: 2), Eb (rsvraqrhtdmpktqkyqppstnkntksqrrkgwpkthpggeqkegt easlqirgkkkeqrreigsrnaecrgkkgk; SEQ ID NO: 3), y Ec (rsvraqrhtdm pktqkyqppstnkntksqrrkgstfeerk; SEQ ID NO: 4) y varían de 35 a 87 aminoácidos de longitud y abarcan una región de secuencia común en el terminal N y una región de secuencia variable en el terminal C. Por ejemplo, el marco de lectura abierto de tipo silvestre para el IGF-1-Ea codifica un polipéptido de 15 aminoácidos (gpetlcgaelvdaquvcgdrgfyfnkptgygsssrrapqtgivde ccfrscdlrrlemycaplkpaksa rsvraqrhtdmpktqkevhlknasrgsagnknyrm; SEQ ID NO: 5). En la expresión fisiológica, se escinden los péptidos E del precursor mediante proteasas endógenas para proporcionar el IGF-1 maduro de 7 aminoácidos que se sabe que es bioactivo. En ciertos contextos, se sabe que de uno a tres de los aminoácidos del terminal N del IGF-1 son escindidos bajo condiciones fisiológicas, produciendo IGF-1 activo que tiene entre 67 - 7 aminoácidos. La expresión génica del IGF-2 y el procesamiento se caracterizan por atributos similares excepto que se ha identificado sólo un péptido E (rdvstpptvlpdnfprypvgkffqydtwkqstqurrglpallrarrghvlakeleafreakrhrplialpt qdpahggappemasnrk; SEQ ID NO: 6) para IGF-2 humano para el precursor de 156 aminoácidos (ayrpsetlcggelvdtquvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatpakserdvstpptvlpdnfprypvgkffqydtwkqstqurrglpallrarrgh vlakeleafreakrhrplialptqdpahggappemasnrk; SEQ ID NO: 7). Tanto IGF-1 como IGF-2 parecen ser candidatos pobres a fármacos, debido a que estas proteínas son rápidamente degradadas por proteasas endógenas en el suero de los pacientes. Una estrategia que se ha contemplado es estabilizar el IGF-1 como un fármaco formando un complejo con una de sus proteínas de enlazamiento.

Resumen de la invención

La invención se basa en el descubrimiento de que un precursor de la proteína del IGF-1 o IGF-2 que contiene sustancialmente su péptido E es bioactivo y se estabiliza en presencia de suero, que resulta en un polipéptido de IGF-1 o IGF-2 que es útil como un compuesto farmacéutico. En las composiciones de la invención, se evita la escisión normal del péptido E del IGF-1, por ejemplo, mediante la mutación o supresión ya sea de la arginina en la posición 1 o la serina en la posición 2 de los péptidos E (que corresponden a las posiciones 71 y 72 en el precursor de tipo silvestre del IGF-1). En el IGF-2, se evita la escisión, por ejemplo, mediante la mutación o supresión ya sea de la arginina en la posición 1 o el ácido aspártico en la posición 2 del péptido E (que corresponde a las posiciones 68 y 69 en el precursor de tipo silvestre del IGF-2). Otras modificaciones de una proteína precursora del IGF pueden evitar o reducir esta escisión.

Además, modificaciones adicionales de la secuencia de aminoácidos del precursor del IGF-1 pueden conferir beneficios farmacéuticos adicionales. Por ejemplo, los polipéptidos de la invención pueden exhibir mayor afinidad por el receptor del IGF-1 o la disminución de la capacidad de enlazamiento a una proteína de enlazamiento inhibidora del IGF-1 o IGF-2.

En aras a la claridad y consistencia, la numeración de los residuos de aminoácidos en los precursores del IGF-1 o IGF-2 o en las proteínas maduras a través de esta solicitud y en las reivindicaciones, se basa en la numeración de la secuencia de proteína precursora de tipo silvestre sin péptido de señal.

De acuerdo con lo anterior, la invención incluye un polipéptido que contiene una proteína precursora del IGF-1 humano, en donde la escisión del péptido E del IGF-1 mediante una proteasa se reduce por la modificación de la proteína precursora. El péptido E puede ser el péptido Ea, Eb, o Ec. En el terminal N del precursor, se pueden eliminar o mutar los aminoácidos G1, P2, o E3 de la proteína precursora, como lo puede hacer R36 (por ejemplo, R36A) y R37 (por ejemplo, R37A).

La proteína, precursora puede incluir adicionalmente la secuencia de consenso de glicosilación NXS/T ligada a N, por ejemplo mediante la inserción de 93 - 12 aminoácidos de Ea entre los aminoácidos N95 y T96 del Eb. En general, la proteína precursora puede incluir un oligosacárido ligado covalentemente a una cadena lateral de aminoácido de la proteína precursora, tal como una cadena lateral de arginina de la proteína precursora.

Además, un residuo de la proteína precursora puede ser reemplazado por un aminoácido no natural (por ejemplo, uno que incluya un grupo acetileno o azido). Tales aminoácidos no naturales pueden facilitar el enlazamiento de una fracción poli(etilenglicol) a una cadena lateral de la proteína precursora, a través de estrategias típicas de pegilación de proteína que son bien conocidas en la técnica.

La proteína precursora puede incluir adicionalmente uno o más péptidos E adicionales enlazados al terminal C de la proteína precursora. Por ejemplo, un polipéptido puede Incluir, del terminal N al terminal C, (I) una proteína precursora del IGF-1 que tiene un primer péptido Eb, en donde se eliminan G1, P1, y E1, se mutan R36 o R37 o ambos, se eliminan R71 y S72, y se eliminan los últimos siete aminoácidos del terminal C del primer péptido Eb; (2) un segundo péptido Eb, en donde se eliminan R71, S72, y los últimos siete aminoácidos de terminal... [Seguir leyendo]

 


Reivindicaciones:

1. Una proteína precursora del IGF-1 humano, en donde:

(i) uno o más de los siguientes residuos de la proteína precursora se suprimen o muían: G1, P2, E3, R36 y R37; y

(ii) la escisión del péptido E de IGF-1 mediante una proteasa se reduce mediante la modificación de la proteína precursora, en donde la modificación es la supresión o mutación de R71 o S72 de la proteína precursora.

2. El polipéptido de la reivindicación 1, en donde la proteína precursora comprende al péptido Ea.

3. El polipéptido de la reivindicación 1, en donde la proteína precursora comprende al péptido Eb.

4. El polipéptido de la reivindicación 3, en donde se suprimen los últimos siete aminoácidos del terminal C de Eb.

5. El polipéptido de la reivindicación 1, en donde la proteína precursora comprende al péptido Ec.

6. El polipéptido de cualquier reivindicación precedente, en donde G1 de la proteína precursora es suprimido o mutado.

7. El polipéptido de cualquier reivindicación precedente, en donde P2 de la proteína precursora es suprimido o mutado.

8. El polipéptido de cualquier reivindicación precedente, en donde E3 de la proteína precursora es suprimido o mutado.

9. El polipéptido de cualquier reivindicación precedente, en donde R36 de la proteína precursora es suprimido o mutado.

1. El polipéptido de cualquier reivindicación precedente, en donde R36 es mutado a alanina.

11. El polipéptido de cualquier reivindicación precedente, en donde R37 de la proteína precursora es suprimido o mutado.

12. El polipéptido de cualquier reivindicación precedente, en donde R37 es mutado a alanina.

13. El polipéptido de cualquier reivindicación precedente, que comprende además la secuencia consenso de glicosilación ligada a N NXS/r.

14. El polipéptido de la reivindicación 3, que comprende además los aminoácidos 93-12 de Ea insertados entre los aminoácidos N95 y T96 de la Eb.

15. El polipéptido de cualquier reivindicación precedente, que comprende además un ollgosacárido enlazado covalentemente a una cadena lateral de aminoácido de la proteína precursora.

16. El polipéptido de la reivindicación 15, en donde el oligosacárido está enlazado covalentemente a una cadena lateral de arglnlna de la proteína precursora.

17. El polipéptido de cualquier reivindicación precedente, en donde un residuo de la proteína precursora es reemplazado por un aminoácido no natural.

18. El polipéptido de la reivindicación 17, en donde el aminoácido no natural comprende un grupo acetileno o azido.

19. El polipéptido de cualquier reivindicación precedente, que comprende además una fracción poli(etilenglicol) unida covalentemente a una cadena lateral de la proteína precursora.

2. El polipéptido de cualquier reivindicación precedente, que comprende además un péptido E adicional enlazado al terminal C de la proteína precursora.

21. Un polipéptido que comprende la SEQ ID NO: 8.

22. Un polipéptido que comprende la SEQ ID NO: 53.

23. Un polipéptido que comprende, desde el terminal N hasta el terminal C,

una proteína precursora del IGF-1 que comprende un primer péptldo Eb, en donde G1, P2, y E3 se suprimen R36 y R37 se suprimen,

R71 y S72 se suprimen, y

se suprimen los últimos siete aminoácidos del terminal C del primer péptido Eb;

un segundo péptido Eb, en donde R71, S72, y los últimos siete aminoácidos del terminal C del segundo péptido Eb se suprimen; un tercer péptido Eb, en donde R71, S72, y los últimos siete aminoácidos del terminal C del tercer péptido Eb se suprimen; y un cuarto péptido Eb, en donde R71 y S72 se suprimen.

24. Una proteína precursora del IGF-2 humano, en donde:

(i) uno o más de los siguientes residuos de la proteína precursora se suprime o mutan: P4, S5, E6 y R38; y

(¡i) la escisión del péptido E de IGF-2 por una proteasa se reduce mediante la modificación de la proteína precursora, en donde la modificación es la supresión o mutación del R68 o D69 de la proteína precursora.

25. El polipéptido de la reivindicación 24, en donde P4 de la proteína precursora se suprime o se muta.

26. El polipéptido de la reivindicación 24 o la reivindicación 25, en donde S5 de la proteína precursora se suprime o se muta.

27. El polipéptido de una cualquiera de las reivindicaciones 24 a 26, en donde E6 de la proteína precursora se suprime o se muta.

28. El polipéptido de una cualquiera de las reivindicaciones 24 a 27, en donde R38 de la proteína precursora se suprime o se muta.

29. Un polipéptido de cualquier reivindicación precedente para uso en terapia.

3. El uso del polipéptido de cualquiera de las reivindicaciones 1 a 28 para la fabricación de un medicamento para el tratamiento de una enfermedad musculoesquelética, diabetes, muerte celular neuronal, o anemia.

31. Un polipéptido de acuerdo con una cualquiera de las reivindicaciones 1 a 28 para uso en el tratamiento de una enfermedad musculoesquelética, diabetes, muerte celular neuronal, o anemia.

32. El uso del polipéptido de cualquiera de las reivindicaciones 1 a 28 para la fabricación de un medicamento para el tratamiento de una enfermedad pulmonar obstructiva crónica (EPOC) o una lesión por quemadura.

33. Un polipéptido de acuerdo con una cualquiera de las reivindicaciones 1 a 28 para uso en el tratamiento de la EPOC o una lesión por quemadura.

34. Un ácido nucleico que codifica al polipéptido de una cualquiera de las reivindicaciones 1-28.

35. Un vector que comprende un ácido nucleico de acuerdo con la reivindicación 34.

36. Una célula transfectada con un vector de acuerdo con la reivindicación 35.