Polipéptidos, dominios variables de anticuerpo y antagonistas.

Un dominio variable único de inmunoglobulina anti-receptor TNFα tipo 1 que comprende la siguiente secuencia de aminoácidos:

EVQLLESGGGLVQPGGSLRLSCAASGFTFAHETMVWVRQAPGKGLEWV

SHIPPDGQDPFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCAL

LPKRGPWFDYWGQGTLVTVSS

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/GB2008/050405.

Solicitante: DOMANTIS LIMITED.

Nacionalidad solicitante: Reino Unido.

Dirección: 980 GREAT WEST ROAD BRENTFORD, MIDDLESEX TW8 9GS REINO UNIDO.

Inventor/es: TOMLINSON, IAN, ENEVER,CAROLYN, JESPERS,LAURENT, PUPECKA,MALGORZATA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/28 (contra receptores, antígenos celulares de superficie o determinantes celulares de superficie)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > C07K16/00 (Inmunoglobulinas, p. ej. anticuerpos mono o policlonales)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/22 (contra factores de crecimiento)

PDF original: ES-2546943_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Polipéptidos, dominios variables de anticuerpo y antagonistas

La presente invención se refiere a polipéptidos resistentes a proteasas, a dominios variables únicos de inmunoglobulinas (anticuerpos) y a antagonistas anti-receptor del factor de necrosis tumoral 1 (TNFR1, p55, CD120a, P60, al receptor TNF miembro de la superfamilia 1 A, TNFRSF1A) que los comprenden. La invención también se refiere a usos, formulaciones, composiciones y dispositivos que comprenden tales ligandos anti-TNFR1.

Antecedentes de la invención

Los polipéptidos y péptidos se han convertido en agentes cada vez más importantes en una variedad de aplicaciones, que incluyen aplicaciones industriales y el uso como agentes medicinales, terapéuticos y diagnósticos. Sin embargo, en ciertos estados fisiológicos, tales como estados inflamatorios (por ejemplo, COPÓ) y cáncer, la cantidad de proteasas presentes en un tejido, órgano o animal (por ejemplo, en el pulmón, en un adyacente a un tumor) puede aumentar. Este aumento de proteasas puede dar como resultado la degradación acelerada y la inactivación de proteínas endógenas y de péptidos, polipéptidos y proteínas terapéuticos que se administran para tratar la enfermedad. En consecuencia, algunos agentes que tuvieran potencial para su uso in vivo (por ejemplo, para su uso en el tratamiento, diagnóstico o prevención de una enfermedad) tienen solo una eficacia limitada debido a que se degradan e inactivan rápidamente por las proteasas.

Los polipéptidos resistentes a las proteasas proporcionan varias ventajas. Por ejemplo, los polipéptidos resistentes a las proteasas permanecen activos in vivo más que los agentes sensibles a las proteasas y, en consecuencia, permanecen funcionales durante un periodo de tiempo que es suficiente para producir sus efectos biológicos. Existe una necesidad de procedimientos mejorados para seleccionar polipéptidos que sean resistentes a la degradación por proteasas y que también tengan una actividad biológica deseada.

TNFR1

El TNFR1 es un receptor transmembrana que contiene una región extracelular que se une al ligando y un dominio intracelular que carece de actividad de transducción de la señal intrínseca pero que se puede asociar con moléculas de transducción de señal. El complejo de TNFR1 con TNF unido contiene tres cadenas de TNFR1 y tres cadenas de TNF. (Banner y col., Cell, 73(3) 431-445 (1993)). El ligando TNF está presente como un trímero, el cual se une a tres cadenas de TNFR1. (Id). Las tres cadenas de TNFR1 se agrupan estrechamente juntas en el complejo receptor- ligando, y este agrupamiento es un pre-requisito para la transducción de la señal mediada por TNFR1. De hecho, agentes multivalentes que se unen al TNFR1, tal como los anticuerpos anti-TNFR1, pueden inducir el agrupamiento de TNFR1 y transducción de la señal en ausencia de TNF y se utilizan comúnmente como agonistas de TNFR1 (véase, por ejemplo, Belkaycol., EMBO, 14(6): 1156-1165 (1995); Mandik-Nayak y col., J. Immunol, 167:1920-1928 (2001)). En consecuencia, los agentes multivalentes que se unen al TNFR1, en general no son eficaces antagonistas del TNFR1 aunque bloqueen la unión del TFN a al TNFR1.

La región extracelular del TNFR1 comprende un segmento terminal de trece aminoácidos (aminoácidos 1-13 de la SEC ID N° 603 (humano); aminoácidos 1-13 de la SEC ID N° 604 (ratón)), Dominio 1 (aminoácidos 14-53 de la SEC ID N° 603 (humano); aminoácidos 14-53 de la SEC ID N° 604 (ratón)), Dominio 2 (aminoácidos 54-97 de la SEC ID N° 603 (humano); aminoácidos 54-97 de la SEC ID N° 604 (ratón)), Dominio 3 (aminoácidos 98-138 de la SEC ID N°

603 (humano); aminoácidos 98-138 de la SEC ID N° 604 (ratón)), y Dominio 4 (aminoácidos 139-167 de la SEC ID N° 603 (humano); aminoácidos 139-167 de la SEC ID N° 604 (ratón)) que continúa con la región proximal de membrana (aminoácidos 168-182 de la SEC ID N° 603_(humano); aminoácidos 168-183 SEC ID N° 604 (ratón)). (Véase, Banner y col., Cell 73(3) 431-445 (1993) y Loetscher y col., Cell 61(2) 351-359 (1990)). Los dominios 2 y 3 están en contacto con el ligando unido (TNF(3, TNFa). (Banner y col., Cell, 73(3) 431-445 (1993)). La región extracelular de TNFR1 también contiene una región que se denomina como dominio de ensamblaje de unión preligando o dominio PLAD (aminoácidos 1-53 de la SEC ID N° 603_ (humano); aminoácidos 1-53 de la SEC ID N°

604 (ratón)) (El Gobierno de los EE. UU., documento WO 01/58953; Deng y col., Nature Medicine, ido: 10.1038/nm1304 (2005)).

El TNFR1 se desprende de la superficie de las células in vivo por medio de un proceso que incluye la proteolisis del TNFR1 en el Dominio 4 o en la región proximal de membrana (aminoácidos 168-182 de la SEC ID N° 603; aminoácidos 168-183 de la SEC ID N° 604), para producir una forma soluble de TNFR1. El TNFR1 soluble mantiene la capacidad de unirse al TFN a, y de esta manera funciona como un inhibidor endógeno de la actividad del TFN a.

El documento WO 2007/049017 describe antagonistas del TNFR1 para su uso en el tratamiento de enfermedades respiratorias.

Sumario de la invención

En un aspecto, la invención proporciona un dominio variable único de inmunoglobulina anti-receptor TFN a tipo 1 que comprende una secuencia de aminoácidos que es idéntica a la secuencia de aminoácidos de DOM1h-131-206 (que se muestra en la Figura 3). La divulgación proporciona un monómero DOM-1h-131-206 (sustancialmente) puro.

En una realización, el DOM-1h-131-206 es al menos un monómero puro en un 98, 99, 99,5%, o el 100% puro.

En un aspecto, la Invención proporciona un dominio polipeptídico variable único de inmunoglobulina anti-receptor TFN a tipo 1 codificado por una secuencia de aminoácidos que es idéntica a la secuencia de nucleótidos del DOM- 1 h-131-206 (como se muestra en la Figura 19).

En un aspecto, la divulgación proporciona una proteína de fusión que comprende el polipéptido de la invención.

En un aspecto, la invención proporciona un antagonista del receptor TFN a tipo 1 (TNFR1; p55) que comprende un dominio variable único de inmunoglobulina anti-TNFR1 de acuerdo con la invención. En una realización, el antagonista comprende un primer y un segundo dominio variable único de inmunoglobulina, en que cada dominio variable es de acuerdo con la invención. Por ejemplo, en que el antagonista comprende un monómero de dicho dominio variable único o un homodímero de dicho dominio variable único.

En una realización, el antagonista es un anticuerpo o un fragmento de unión al antfgeno del mismo, tal como un fragmento de unión al antígeno monovalente (por ejemplo, scFv, Fab, Fab, dAb) que tiene una especificidad de unión por el TNFR1. Otros ejemplos de antagonistas son ligandos que se describen en el presente documento que se unen al TNFR1. Los ligandos pueden comprender un dominio variable único de inmunoglobulina o dominio de anticuerpo (dAb) que tiene especificidad de unión por el TNFR1, o las regiones determinantes de complementariedad de tal dAb en un formato adecuado. En algunas realizaciones, el ligando es un monómero de dAb que consiste esencialmente, o consiste en, un dominio variable único de inmunoglobulina o dAb que tiene una especificidad de unión por el TNFR1. En otras realizaciones, el ligando es un polipéptido que comprende dAb (o las CDR de un dAb) en un formato adecuado, tal como un formato de anticuerpo.

Algunos antagonistas de TNFR1 no inhiben la unión del TFN a al TNFR1, pero inhiben la transducción de la señal por medio de TNFR1. Por ejemplo, un antagonista del TNFR1 puede inducir el agrupamiento inducido por TFN a, que precede a la transducción de la señal por medio de TNFR1. Tales antagonistas proporcionan varias ventajas. Por ejemplo, en presencia de tal antagonista,... [Seguir leyendo]

 


Reivindicaciones:

1. Un dominio variable único de ¡nmunoglobulina anti-receptor TNFa tipo 1 que comprende la siguiente secuencia de aminoácidos:

EVQLLESGGGLVQPGGSLRLSCAASGFTFAHETMVWVRQAPGKGLEWV

SHIPPDGQDPFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCAL

LPKRGPWFDYWGQGTLVTVSS

2. Un dominio variable único de ¡nmunoglobulina anti-receptor TNFa tipo 1 de acuerdo con la reivindicación 1, codificado por una secuencia que es idéntica a la secuencia de nucleótidos del DOMIh-131-206, mostrado en la figura 19.

3. Un antagonista del receptor TNFa tipo 1 que comprende un dominio variable único de ¡nmunoglobulina anti- TNFR1 de acuerdo con cualquier reivindicación precedente.

4. El antagonista de la reivindicación 3, que comprende un primero y segundo dominios variables únicos de ¡nmunoglobulina, en el que cada dominio variable está de acuerdo con una cualquiera de las reivindicaciones 1-2.

5. El antagonista de la reivindicación 3 o 4, en el que el antagonista comprende un monómero de dicho dominio variable único o un homodfmero de dicho dominio variable único, en el que dicho dominio variable es idéntico a la secuencia de aminoácidos del DOMIh-131-206.

6. El antagonista del TNFR1 de las reivindicaciones 3-5 para su uso en medicina, en el que es administrado por vía oral, a través del tracto Gl, o por medio de suministro pulmonar.

7. El antagonista del TNFR1 de las reivindicaciones 3-5 para su uso en el tratamiento y/o profilaxis de una afección inflamatoria.

8. El antagonista del TNFR1 de la reivindicación 7, en el que dicha afección inflamatoria es seleccionada entre: una enfermedad pulmonar, psoriasis, artritis, enfermedad inflamatoria del intestino.

9. El antagonista del TNFR1 de las reivindicaciones 3-5 para su uso en el tratamiento y/o profilaxis de una enfermedad respiratoria en un sujeto humano.

10. El antagonista del TNFR1 de la reivindicación 9, en que dicha enfermedad respiratoria es seleccionada entre: inflamación del pulmón, EPOC, Asma, Neumonía, enfermedad de fibrosis quística intersticial pulmonar, alergia, inflamación pulmonar.

11. Un ligando de doble especificidad que comprende un dominio variable de acuerdo con una cualquiera de las reivindicaciones 1 - 2.

12. Un ácido nucleico aislado o recombinante que codifica un polipéptido que comprende un dominio variable único de ¡nmunoglobulina de acuerdo con una cualquiera de las reivindicaciones 1-2.

13. Un vector que comprende el ácido nucleico de la reivindicación 12.

14. Una célula huésped que comprende el ácido nucleico de la reivindicación 12, o el vector de la reivindicación 13.

15. Una composición farmacéutica que comprende un dominio variable único de ¡nmunoglobulina de una cualquiera de las reivindicaciones 1 a 2, o un antagonista de una cualquiera de las reivindicaciones 3 a 5, y un vehículo, excipiente o diluyente farmacéuticamente aceptable.

16. El dominio variable único de ¡nmunoglobulina de una cualquiera de las reivindicaciones 1 a 2 o un antagonista de una cualquiera de las reivindicaciones 3 a 5, que comprende un dominio constante de anticuerpo.