Péptidos antigénicos de Neisseria.

Una proteína que comprende uno o más fragmentos de SEC ID Nº: 2918 del documento WO99/57280

(MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPIANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAKLKAEKFNCYQSPMEKTEVCGGDFSTTIDRTKWGMDYLV NVGMTKSVRIDIQIEAAKQ), en la que dicho(s) fragmento(s):

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de:

y en la que dicha proteína no es SEC ID Nº: 2916, 2918 ó 2920 del documento WO99/57280

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E10178490.

Solicitante: NOVARTIS VACCINES AND DIAGNOSITICS S.R.L.

Nacionalidad solicitante: Italia.

Dirección: Via Fiorentina 1 53100 Siena ITALIA.

Inventor/es: GRANDI, GUIDO, PIZZA, MARIAGRAZIA, RAPPUOLI, RINO, RATTI, GIULIO, GALEOTTI,CESIRA, MASIGNANI,VEGA, SCARLATO,VINCENZO, SCARSELLI,MARIA, MORA,MARIROSA.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > A61K48/00 (Preparaciones medicinales que contienen material genético que se introduce en las células del cuerpo vivo para tratar enfermedades genéticas; Terapia génica)
  • SECCION G — FISICA > METROLOGIA; ENSAYOS > INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION... > Investigación o análisis de materiales por métodos... > G01N33/569 (para microorganismos, p. ej. protozoarios, bacterias, virus)
  • SECCION C — QUIMICA; METALURGIA > BIOQUIMICA; CERVEZA; BEBIDAS ALCOHOLICAS; VINO; VINAGRE;... > MICROORGANISMOS O ENZIMAS; COMPOSICIONES QUE LOS... > Técnicas de mutación o de ingeniería genética;... > C12N15/31 (Genes que codifican proteínas microbianas, p. ej. enterotoxinas)
  • SECCION G — FISICA > METROLOGIA; ENSAYOS > INVESTIGACION O ANALISIS DE MATERIALES POR DETERMINACION... > Investigación o análisis de materiales por métodos... > G01N33/53 (Ensayos inmunológicos; Ensayos en los que interviene la formación de uniones bioespecíficas; Materiales a este efecto)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/12 (contra materiales bacterianos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/095 (Neisseria)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/40 (bacterianos)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/22 (de Neisseriaceae (F), p. ej. Acinetobacter)

PDF original: ES-2541830_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Péptidos antigénicos de Neisseria

CAMPO DE LA INVENCiÓN

La presente invención se refiere a secuencias de péptidos antigénicos de las bacterias Neisseria meningifidis.

TÉCNICA ANTERIOR

N. meningitidis es un diplococo Gram-negativo no móvil que es patógeno en seres humallOs Basándose en polisacárido capsular del organismo, se han identificado 12 serogrupos de N. meningifidis. El grupo A es el patógeno más frecuentemente implicado en la enfermedad epidémica en el África sub sahariana. Los serogrupos B y C son responsables de la gran mayoría de casos en los Estados Unidos y en la mayoría de los países desarrollados Los serogrupos W 135 e Y son responsables del resto de los casos en los Estados Unidos y países desarrollados.

La vacuna meningocócica actualmente en uso es una vacuna de polisacárido tetravalente compuesta de los serogrupos A, C y y W135 Sin embargo, el meningococo B sigue siendo un problema. El enfoque de polisacáridos no puede usarse debido a que el polisacárido capsular menB es un polímero del ácido N-acetilneuramínico enlazado a a (2-8) que también está presente en el tejido de mamifero. Un enfoque a una vacuna de menB usa mezclas de proteínas de la membrana externa (OMP) . Para superar la variabilidad antigénica, se han construido vacunas multivalentes que contienen hasta nueve porinas diferentes [por ejemplo, Poolman JT (1992) Development of a meningococcal vaccine. Infect. Agents Dis. 4:13-28]. Proteínas adicionales que van a usarse en las vacunas de la membrana extema han sido las proteínas opa y opc, pero ninguno de estos enfoques ha sido capaz de superar la variabilidad antigénica [por ejemplo, Ala'Aldeen & Borriello (1996) ]. Las proteínas 1 y 2 de unión a transferrina meningocócicas están ambas expuestas en la superficie y generan anticuerpos bactericidas capaces de aniquilar cepas homólogas y heterólogas. [Vaccine 14 (1) :49-53].

DIVULGACiÓN DE LA INVENCiÓN

La invención se refiere a fragmentos de la proteína 953 desvelada en las solicitudes de patente internaciooal W099/57280 y WOO0/22430 (las "solicitudes intemacionales") , en las que los fragmentos comprenden al menos un determinante antigénico, los fragmentos están seleccionadas de los 4 fragmentos de la reivindicación 1, Y la invención proporciona proteínas que comprenden uno o más de estos 5 fragmentos La invención está sometida a la condiciÓfl de que no incluye dentro de su alcance proteínas limitadas a cualquiera de las secuencias de proteína de longitud completa desveladas en las solicitudes intemacionales (es decir, las SEC ID N° 2-3020 pares de W099157280 y las SEC ID N° 963-1045 impares de WOO0f22430)

Las proteínas de la invención pueden prepararse, por supuesto, por diversos medios (por ejemplo, expresión recombinante, purificación a partir de cultivo celular, síntesis química, etc.) y en diversas formas (por ejemplo, fusiones nativas, del extremo C y/o extremo N, etc.) . Se preparan preferentemente en forma sustancialmente pura (es decir, sustancialmente libre de otras proteínas de Neisseria o de células huésped) . Se producen preferentemente proteínas cortas usando síntesis química de péptidos Según otro aspecto, la invención proporciona anticuerpos que recooocen los fragmentos de la invención, con la condición de que la invención no incluya dentro de su alcance anticuerpos que reconocen cualquiera de las secuencias de proteínas completas en las solicitudes internacionales. Los anticuerpos pueden ser polidonales o monoclooales, y pueden producirse por cualquier medio adecuado Composiciones que comprenden proteína ylo anticuerpo según la invención pueden ser adecuadas como vacunas, por ejemplo, o como reactivos de diagnóstico, o como composiciones inmunogénicas La proteína, o anticuerpo según la invenciórJ, puede usarse como medicamentos (por ejemplo, como vacunas o como composiciones inmunogénicas) o como reactivos de diagnóstico. Pueden usarse en la fabricación de: (i) un medicamento para tratar o prevenir infección debida a la bacteria de Neisseria; (ii) un reactivo de diagnóstico para detectar la presencia de bacterias de Neisseria o de anticuerpos producidos contra bacterias de Neisseria; ylo (iii) un reactivo que puede producir anticuerpos contra bacterias de Neisseria. Dichas bacterias de Neisseria pueden ser de cualquier especie o cepa (tal como N. gonorrlloeae) , pero son preferentemente N. meningitidis, especialmente la cepa A o la cepa B.

La divulgación también proporciona un método para tratar un paciente, que comprende administrar al paciente una cantidad terapéuticamente eficaz del ácido nucleico, proteína y/o anticuerpo según la invención.

Un resumen de las técnicas y procedimientos convencionales que pueden emplearse con el fin de realizar la invención (por ejemplo, utilizar las secuencias desveladas para vacunación o fines de diagnóstico) sigue a continuación. Este resumen no es una limitación de la invención, sino que más bien da ejemplos que pueden usarse, pero no se requieren.

General

La práctica de la presente invención empleará, a menos que se indique lo contrario, técnicas convencionales de biología molecular, microbiología, ADN recombinante e inmunología, que están dentro del conocimiento general de la técnica. Tales técnicas se explican completamente en la bibliografía, por ejemplo, Sambrook Molecular Cloning; A Laborator y Manual, segunda edición (1989) ; DNA Cloning, Volúmenes I and 11 (D.N Glover ed 1985) ; Oligonucleotide Synthesis (M.J. Gait ed, 1984) ; Nucleic Acid Hybridization (B.O. Hames & S.J. Higgins eds. 1984) ; Transcription and Translation (B.o. Hames & S.J. Higgins eds. 1984) ; Animal Cell Culture (R.1. Freshney ed. 1986) ; Immobilized Cells and Enzymes (IRL Press, 1986) ; B. Perbal, A Practical Guide to Molecular Cloning (1984) ; the Methods in Enzymology series (Academic Press, Inc.) , especialmente los volúmenes 154 y 155; Gene Transfer Vectors for Mammalian Cells (J.H. Miller and M.P. Calas eds. 1987, Cold Spring Harbar Laborator y ) ; Mayer and Walker, eds. (1987) , Immunochemical Methods in Cell and Molecular Biology (Academic Press, London) ; Scopes, (1987) Protein Purification: Principies and Practice, segunda edición (Springer-Verlag, NY) y Handbook of Experimental Immunology, Volúmenes I-IV (D.M. Weir and C. C. Blackwell eds 1986) . En esta memoria descriptiva se usan las abreviaciones estándar para nucleótidos y aminoácidos Definiciones Una composición que contiene X está ·sustancialmente libre de" Y cuando al menos el 85 % en peso del total X+Y en la composición es X. Preferentemente, X comprende al menos aproximadamente el 90 % en peso del total de X+Yen la composición, más preferentemente al menos aproximadamente el 95 % o incluso el 99 % en peso.

El término "que comprende" significa "que incluye", así como "que consiste", por ejemplo, una composición "que comprende" X puede consistir exclusivamente en X o puede incluir algo adicional a X, tal como X+Y

El término "determinante antigénico" incluye epítopes de linfocitos B y epítopes de linfocitos T.

El término "heterólogo" se refiere a dos componentes biológicos que no se encuentran junios en la naturaleza. Los componentes pueden ser células huésped, genes o regiones reguladoras, tales como promotores. Aunque los componentes heter6logos no se encuentran juntos en la naturaleza, pueden funcionar juntos, como cuando un promotor heterólogo a un gen está operativa mente ligado al gen. Otro ejemplo es donde una secuencia de Neisseria es heteróloga a una célula huésped de ratón. Un ejemplo adicional sería dos epítopes de las mismas proteínas o proteínas diferentes que se han ensamblado en una proteína individual en una disposición no encontrada en la naturaleza.

... [Seguir leyendo]

 


Reivindicaciones:

Una proleína que comprende uno o más fragmenlos de SEC ID N°-2918 del documento W099f57280 (MKKII FAALAAAAISTASAATYKVOEYHANARFAIDHFNTSTNVGGFYGL TGSVEFOQAKROGKIDITIPIANLQSGSQH FTDHLKSADIFDAAQYPDIRFVSTKFN FNGKKL VSVOGNL TMHGKTAPVKLKAEKFNCYQSPMEKTEVCGGOFSTIID

RTKWGMOYLV NVGMTKSVRIOIQIEAAKQ) , en la que dicho (s) fragmento (s) "

(a) comprenden al menos un determinante antigénico; y

(b) comprenden una secuencia seleccionada de:

"~nThrS'HTilr"~nVa'lGlyGlyí'he"l'yrGlyL~, j'lhr 51

GlnSerG1YSerGlnH18PheThIAspH1SLeUL~sserA:a"spIlePheAspAlaAlaGln 95

ValGluPheAspGlnAlaLysArgA"spGlyLysIl~AspI.!.e 67 15 122 l~etHisGlyLysThrAl.aProyal LysLeuL"f~AlaGluLys 135

yen la que dicha proteína no es SEC ID N°" 2916, 2918 6 2920 del documento W099f57280

2_ Un anticuerpo que reconoce el fragmento como se define en la reivindicación 1