Formulaciones para el factor estimulante de colonias de granulocitos bovino y sus variantes.

Una formulación acuosa estable que comprende bG-CSF-T133pKF-20K PEG, un tampón citrato o succinato

, arginina, y opcionalmente un contraión para la arginina, y en la que dicha formulación contiene menos del 0,033% de un tensioactivo polisorbato.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2011/052692.

Solicitante: ELI LILLY AND COMPANY.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: LILLY CORPORATE CENTER INDIANAPOLIS, IN 46285 ESTADOS UNIDOS DE AMERICA.

Inventor/es: DAVAGNINO,JUAN, KHA,CATHERINE NGAN, KLOTZ,ALAN VOSKAMP.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen péptidos... > A61K38/19 (Citoquinas; Linfoquinas; Interferones)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P29/00 (Agentes analgésicos, antipiréticos o antiinflamatorios que no actúan sobre el sistema nervioso central, p. ej. agentes antirreumáticos; Antiinflamatorios no esteroideos (AINEs))
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con más de 20 aminoácidos; Gastrinas;... > C07K14/535 (CSF de granulocitos; CSF de granulocitos-macrófagos)

PDF original: ES-2540862_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Formulaciones para el factor estimulante de colonias de granulocitos bovino y sus variantes El factor estimulante de colonias de granulocitos (G-CSF) es un miembro de la familia supergenética de hormonas de crecimiento. El G-CSF estimula la proliferación de células precursoras de la médula ósea y su diferenciación en granulocitos. Además el G-CSF es un estímulo potente para la proliferación y maduración de neutrófilos in vivo 5 (Cohen y col., Proc. Natl. Acad. Sci. 1987; 84: 2484-2488; véase también Heidari y col., Vet. Immol. Imunopathol. 2001; 81:45-57) . El G-CSF también es capaz de inducir la activación funcional o "estimulación" de neutrófilos maduros in vitro (Weisbart, R. H. y col., Annals of Internal Medicine 1989; 110:297-303) . Se ha demostrado que el G-CSF estimula los granulocitos humanos y aumenta la liberación de superóxido estimulada por el péptido quimiotáctico N-formil-metionil-fenilalanina (S. Kitagawa, y col., Biochem. Biophys. Res. Commun. 1987; 144:1143-10 1146, y C. F. Nathan, Blood 1989; 74:301-306) , y activa la fagocitosis mediada por IgA en los neutrófilos humanos (Weisbart, R. H., y col., Nature 1988; 332: 647-649) .

Se ha encontrado que el G-CSF es útil en el tratamiento de indicaciones en las que el aumento de neutrófilos produce un beneficio. El G-CSF también es útil solo, o en combinación con otros compuestos (tales como otras citoquinas) para el crecimiento o expansión de células en cultivo, por ejemplo, para trasplantes de médula ósea. 15

Se ha descrito la clonación de ADNc y la expresión de G-CSF recombinante humano (hG-CSF) , y el hG-CSF recombinante muestra la mayoría, si no todas, las propiedades biológicas de la molécula nativa (Souza, L. y col., Science 232, 61-65 (1986) ) . El análisis de la secuencia de los clones de ADNc y ADN genómico ha permitido la deducción de la secuencia de aminoácidos y revela que la proteína tiene 204 aminoácidos de longitud con una secuencia de señal de 30 aminoácidos. La proteína madura tiene 174 aminoácidos de longitud y no posee sitios 20 potenciales de glucosilación unida a N sino varios sitios posibles para glucosilación unida a O.

Se conocen en la técnica preparaciones farmacéuticas que contienen hG-CSF e incluyen numerosas formulaciones. Por ejemplo, se describen varias formulaciones de hG-CSF, de Piedmonte y col., Advanced Drug Deliver y Reviews, 60: 50-58 (2008) , Herman y col., en Formulation, Characterization, and Stability of Protein Drugs, Rodney Pearlman and Y. John Wang, eds., Plenum Press, New York (1996) , Patente de EE. UU. Nº 5.919.757 de Michaelis y col., y la 25 Patente de EE. UU. Nº 6.908.610 de Sato y col. Tradicionalmente, se incluyen tensioactivos en las formulaciones de hG-CSF y pueden proteger el hG-CSF en superficies de contacto potencialmente desestabilizantes, contra superficies que se ponen en contacto durante el proceso, y contra la alteración de su estabilidad conformacional.

También se ha descrito la clonación del ADNc y la expresión del G-CSF recombinante bovino (bG-CSF) . Por ejemplo, el polinucleótido y la secuencia de polinucleótido del bG-CSF maduro se presentan en la Patente de EE. 30 UU. Nº 5.849.883, que también describe los procedimientos para clonar, aislar y purificar el polipéptido y los análogos del mismo. El bG-CSF maduro tiene 174 aminoácidos de longitud y tienen una homología del 82% con el hG-CSF. Heidari y col., supra, describen la expresión, purificación, y actividades biológicas de bG-CSF.

La administración de bG-CSF al ganado bovino proporciona beneficios terapéuticos. En consecuencia, una formulación farmacéutica que contenga bG-CSF es deseable para utilizar su potencial terapéutico. Sin embargo, las 35 formulaciones farmacéuticas de bG-CSF que se desarrollan según los procedimientos tradicionales conocidos en la técnica dan como resultado propiedades del producto indeseables, tales como agregación y desestabilización del polipéptido bG-CSF y/o la formulación.

Por lo tanto, existe una necesidad de una formulación farmacéutica de bG-CSF estable con propiedades deseables, tales como propiedades de mínima agregación del producto y desestabilización. En consecuencia, la presente 40 divulgación proporciona formulaciones farmacéuticas acuosas adecuadas con un polipéptido bG-CSF o una variante del mismo que muestran propiedades deseables y también proporciona ventajas relacionadas.

La presente invención se define en las reivindicaciones.

La presente divulgación proporciona formulaciones acuosas estables que comprenden un polipéptido bG-CSF o una variante del mismo, una sustancia tampón, y un excipiente, en que dicha formulación está sustancialmente libre de 45 monolaurato de sorbitán polioxietilenado (20) . La divulgación también proporciona procedimientos de utilización, una forma liofilizada o en polvo, y los procesos para preparar la formulación.

Las formulaciones acuosas estables del factor estimulante de colonias de granulocitos bovinos ("bG-CSF") contienen un polipéptido bG-CSF o una variante del mismo. Como se utiliza en el presente documento "polipéptido G-CSF bovino" (de manera alternativa denominado "polipéptido bG-CSF", "G-CSF bovino", o "bG-CSF") y variantes del 50 mismo incluirán los polipéptidos y proteínas que tienen al menos una actividad biológica de un CSF, análogos de bG-CSF, bG-CSF mutantes, bG-CSF glucosilados alterados, bG-CSF conjugado con PEG, isoformas de bG-CSF, miméticos de bG-CSF, fragmentos de bG-CSF, proteínas híbridas de bG-CSF, proteínas de fusión, oligómeros y multímeros, homólogos, variantes del patrón de glucosilación, variantes, variantes de corte y empalme, y muteínas, de los mismos, independientemente de la actividad biológica de los mismos, e independientemente además del 55 procedimiento de síntesis o fabricación de los mismos incluyendo pero sin limitarse a, recombinante (sea producido a partir de ADNc, ADN genómico, ADN sintético u otra forma de ácido nucleico) , in vitro, in vivo, por microinyección de moléculas de ácido nucleico, sintético, transgénico, y procedimientos de gen activado, Adicionalmente, la expresión polipéptido bG-CSF o una variante del mismo engloba polipéptidos bG-CSF que comprenden una o más sustituciones, adiciones o eliminaciones de aminoácidos. Véase la Patente de EE. UU. Nº 5.849.883 para más ejemplos de análogos de G-CSF bovino. La secuencia del polipéptido bG-CSF maduro que tiene 174 aminoácidos de longitud es la siguiente: 5

TPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGG LFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQM EDLGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRF

LELAYRGLRYLAEP 10

Además, el polipéptido bG-CSF con un aminoácido inicial metionina es el siguiente:

MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAH KLCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHG GLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQ MEDLGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHR 15

FLELAYRGLRYLAEP

Se han descrito sustituciones en una amplia variedad de posiciones de aminoácidos en el bG-CSF. Las sustituciones incluyen pero no se limitan a las que modulan la estabilidad farmacéutica, aumentan la actividad agonista, aumentan la resistencia a proteasas, convierten el polipéptido en antagonista, etc., se engloban en la expresión polipéptido bG-CSF o una variante del mismo. 20

La expresión polipéptido bG-CSF o una variante del mismo también incluye el bG-CSF glucosilado, tal como pero no limitado a polipéptidos glucosilados en cualquier posición de aminoácido, formas del polipéptido glucosilado unido a N, o formas del polipéptido glucosilado unido a O. Las variantes que contienen cambios únicos de nucleótidos también se consideran como variantes biológicamente activas del polipéptido bG-CSF. Las... [Seguir leyendo]

 


Reivindicaciones:

1. Una formulación acuosa estable que comprende bG-CSF-T133pKF-20K PEG, un tampón citrato o succinato, arginina, y opcionalmente un contraión para la arginina, y en la que dicha formulación contiene menos del 0, 033% de un tensioactivo polisorbato. 5

2. La formulación de la reivindicación 1 en la que el bG-CSF-T133 pKF -20K PEG está presente en una cantidad de entre 0, 5 y 12 gramos/litro, el tampón es citrato y dicho tampón de citrato tiene una molaridad de aproximadamente 30 mM, la arginina tiene una molaridad de aproximadamente 250 mM, y en la que la formulación tiene un valor del pH de aproximadamente 6, 0.

3. Una formulación acuosa estable que consiste esencialmente en bG-CSF-T133 pKF -20K PEG, un tampón citrato 10 o succinato, arginina, y opcionalmente un contraión para arginina.

4. La formulación de la reivindicación 3 en la que el bG-CSF-T133 pKF -20K PEG está presente en una cantidad de entre 0, 5 y 12 gramos/litro, el tampón es citrato y dicho tampón de citrato tiene una molaridad de aproximadamente 30 mM, la arginina tiene una molaridad de aproximadamente 250 mM, y en la que la formulación tiene un valor del pH de 6, 0. 15

5. Una formulación acuosa estable que consiste esencialmente en bG-CSF-T133 pKF -20K PEG, un tampón citrato en la que el tampón citrato tiene una molaridad de aproximadamente 30 mM, arginina en la que la arginina tiene una molaridad de aproximadamente 250 mM, y opcionalmente un contraión para la arginina.

6. Una formulación de una cualquiera de las reivindicaciones 1 a 5 para su uso en el tratamiento o prevención de mastitis en una vaca periparturienta. 20