COMPOSICIÓN BASADA EN POLIPÉPTIDOS PARA EL TRATAMIENTO DE MIASIS.

Composición basada en polipéptidos para el tratamiento de miasis.

La presente invención describe fragmentos de péptidos homólogos a aquellos presentes en la secuencia de la arginina quinasa que pueden conferir inmunidad protectora en mamíferos contra la infección por larvas de insectos dípteros capaces de provocar miasis

. La presente invención también describe composiciones basadas en dichos péptidos para su uso como vacuna frente a miasis.

Tipo: Patente de Invención. Resumen de patente/invención. Número de Solicitud: P201231063.

Solicitante: UNIVERSIDAD DE GRANADA.

Nacionalidad solicitante: España.

Inventor/es: OSUNA CARRILLO DE ALBORNOZ,ANTONIO, GONZALEZ GONZALEZ,GLORIA MARIBEL, YING,Argentina, ESKILDSEN,Gilberto.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > A61K39/00 (Preparaciones medicinales que contienen antígenos o anticuerpos (materiales para ensayos inmunológicos G01N 33/53))
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Péptidos con 5 a 20 aminoácidos en una secuencia... > C07K7/08 (con 12 a 20 aminoácidos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen péptidos... > A61K38/10 (Péptidos que tienen de 12 a 20 aminoácidos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P33/00 (Agentes antiparasitarios)

PDF original: ES-2441880_A1.pdf

 

google+ twitter facebook

Fragmento de la descripción:

COMPOSICiÓN BASADA EN POLlPÉPTIDOS PARA EL TRATAMIENTO DE MIASIS

CAMPO DE LA INVENCiÓN

Esta invención se refiere a composiciones para su uso como vacunas que comprenden fragmentos polipeptídicos para el tratamiento de miasis.

ANTECEDENTES DE LA INVENCiÓN

Los insectos dípteros, y las moscas en particular, transmiten enfermedades que representan un grave peligro para la salud de personas y animales. A una escala global, provocan pérdidas de producción de aves de corral y ganado que se estima que representan miles de millones de dólares. El crecimiento y rendimiento de casi todos los animales de granja se ven adversamente afectados por moscas, especialmente cuando están presentes en números altos. Los animales infectados se vuelven nerviosos y se reduce drásticamente el consumo de alimentos. El resultado: reducciones significativas de producción de carne y leche, calidad de piel deteriorada y graves pérdidas económicas.

Las moscas que no pican, a menudo se alimentan de secreciones de los ojos, nariz y cualquier herida pequeña de ganado, esto distrae a los animales del pasto, provocando una reducción en crecimiento y productividad. Las moscas que no pican no son vectores biológicos de ningún organismo patológico específico, pero debido a sus hábitos de alimentación y reproducción y la estructura de sus patas y aparato bucal, pueden actuar como vectores mecánicos para una gran gama de patógenos, desde virus hasta helmintos.

Las moscas que pican pueden provocar irritación a animales domésticos, y también son vectores para la transmisión de enfermedades. Sin embargo, debido a que se alimentan de sangre, también pueden provocar anemia e hipersensibilidad. Por tanto algunos consideran que las moscas que pican son un problema incluso más grave en la producción de ganado que las moscas que no pican.

Sin embargo, algunas moscas que no pican provocan daño significativo por sí mismas en virtud de su propensión para provocar "miasis" en animales propensos. La miasis

es una enfermedad que afecta animales y seres humanos, provocada por larvas de insectos del género dípteros, en particular moscas y entre ellas Dermatobia hominis, comúnmente conocida como tórsalo.

Las condiciones climáticas, tales como temperatura y humedad a niveles encontrados en regiones tropicales y ecuatoriales, particularmente en determinadas estaciones del año, favorecen la proliferación de insectos, en particular insectos dípteros o moscas, en grandes cantidades y por lo tanto de los casos de miasis.

Existe, por tanto, la necesidad de producir nuevas formulaciones mejoradas útiles en el tratamiento y la prevención de miasis.

BREVE DESCRIPCiÓN DE LA INVENCiÓN

En un primer aspecto, la invención proporciona un péptido que puede generar una respuesta inmunitaria protectora frente a una infección por larvas de insectos dípteros capaces de provocar miasis que comprende:

a) la secuencia de SEO ID NO 1, b) una variante de (a) que es homóloga en al menos el 70% a la SEO ID NO 1, más preferiblemente homóloga en al menos el 80%, el 85%, el 90%, el 95%, el 97%, el 98% o el 99% a la SEO ID NO 1 Y que puede generar una respuesta inmunitaria protectora frente a una infección por larvas de insectos dípteros que provocan miasis, o c) un fragmento de (a) o (b) o una mezcla el mismo, de al menos 6 aminoácidos de longitud que puede generar una respuesta inmunitaria protectora frente a una infección por larvas de insectos dípteros capaces de provocar miasis.

Un segundo aspecto se refiere a polinucleótidos (de aquí en adelante polinucleótido de la invención) que tienen una secuencia seleccionada de: a) la secuencia de AON de SEO ID NO 11 o la secuencia complementaria a la misma; b) una secuencia que se hibrida selectivamente con dicha secuencia (a) o un fragmento de la misma; o c) una secuencia que codifica para un polipéptido que tiene la misma secuencia de aminoácidos que la codificada por dicha secuencia (a) o (b) .

Un tercer aspecto de la invención se refiere a anticuerpos o fragmentos de los mismos que pueden unirse a una cualquiera de las secuencias peptídicas mencionadas anteriormente.

Un cuarto aspecto de la invención se refiere a una composición veterinaria o farmacéutica (de aquí en adelante "composición farmacéutica") que comprende cualquiera de los péptidos y/o anticuerpos o fragmentos de los mismos mencionados anteriormente. Otra realización se refiere a la composición farmacéutica para su uso en terapia. Otra realización más se refiere a la composición farmacéutica para su uso en el tratamiento o la prevención de la enfermedad miasis provocada por larvas de insectos dípteros capaces de provocar dicha enfermedad.

En una realización preferida de la invención, la composición farmacéutica es una composición útil como vacuna, en la que esta composición de vacuna puede usarse para proteger mamíferos, preferiblemente un ser humano, más preferiblemente un mamífero que pertenece a la subfamilia biológica bovina, caprina, ovina o equina, contra la infección producida por larvas de insectos dípteros capaces de provocar miasis.

En un aspecto preferido, la invención proporciona una composición de vacuna que comprende cualquiera de los péptidos mencionados anteriormente junto con un vehículo farmacéuticamente aceptable.

En otro aspecto preferido, la invención proporciona la composición de vacuna que comprende anticuerpos o fragmentos de los mismos capaces de unirse a una cualquiera de las secuencias peptídicas mencionadas anteriormente junto con un vehículo farmacéuticamente aceptable.

En una realización más preferida de la invención, la enfermedad miasis se provoca por larvas de insectos dípteros que pertenecen a una cualquiera de las siguientes familias: Calliphoridae (moscas azules) , Oestridae (moscardón) , Sarcophagidae (moscas de la carne) o Gasterophilidae.

En una realización preferida adicional de la invención, la miasis se provoca por insectos dípteros que pertenecen a la familia Oestridae, preferiblemente al género Oestrus, Dermatobia o Hypoderma; más preferiblemente a las especies Oestrus ovis Linnaeus, Dermatobia hominis, Hypoderma spp (rezno) o Gasterophilus spp.

En una realización más preferida de la invención, la miasis se provoca por insectos dípteros que pertenecen a la familia Calliphoridae, preferiblemente al género Cochliomyia, Lucilla o Chr y somya.

En otra realización de la invención, la miasis se provoca por insectos dípteros que pertenecen a la familia Calliphoridae, preferiblemente al género Cordylobia o Chr y somya; más preferiblemente, a las especies Cordylobia anthropophaga o Chr y somya bezziana.

La invención también se refiere a un vector recombinante, tal como un vector de expresión, que comprende un polinucleótido de la invención operativamente unido a una secuencia reguladora, por ejemplo un promotor; una célula huésped que se transforma con un polinucleótido de la invención; y un procedimiento de producción de un polipéptido adecuado para su uso como composición farmacéutica, preferiblemente como vacuna, que comprende mantener una célula huésped transformada con un polinucleótido de la invención en condiciones para proporcionar la expresión del péptido.

En un aspecto adicional, la invención proporciona un método de vacunación de un sujeto humano o un animal contra una infección producida por una larva de insecto díptero capaz de provocar miasis, en el que el animal es preferiblemente un mamífero que pertenece a la subfamilia biológica bovina, caprina, ovina o equina.

BREVE DESCRIPCiÓN DE LAS FIGURAS

Figura 1: Esta figura muestra el número de larvas encontradas en 6 terneros sometidos... [Seguir leyendo]

 


Reivindicaciones:

1. Péptido que comprende: a) la secuencia SEQ ID NO 1; o b) una variante de la secuencia de a) que sea homóloga en al menos el 70% a la SEQ ID

NO 1, basándose en la identidad de la totalidad de los aminoácidos de dicha secuencia, y que puede generar una respuesta inmunitaria protectora frente a una infección por

larvas de insectos dípteros capaces de provocar miasis.

2. Péptido de acuerdo con la reivindicación 1, en el que el péptido comprende la SEQ ID NO

1.

3. Péptido de acuerdo con la reivindicación 1, en el que el péptido consiste esencialmente en la SEQ ID NO 1.

4. Polinucleótido que comprende una secuencia seleccionada de cualquiera de las siguientes: a) la secuencia SEQ ID NO 11 o su secuencia complementaria; o b) una secuencia que híbrida selectivamente con la secuencia codificante de una cualquiera de las secuencias peptídicas de la reivindicación 1 apartado b) .

5. Vector de expresión que comprende un polinucleótido según la reivindicación 4, operativamente unido a una secuencia reguladora.

6. Célula huésped transformada con un polinucleótido de la reivindicación 4.

7. Procedimiento de producción del péptido de cualquiera de las reivindicaciones 1 a 3, que comprende mantener una célula huésped transformada con un polinucleótido que codifique para un péptido de cualquiera de las reivindicaciones 1 a 3, en condiciones para proporcionar la expresión del péptido.

8. Anticuerpo o fragmento de anticuerpo que se una específicamente al péptido de cualquiera de las reivindicaciones 1 a 3.

9. Composición veterinaria o farmacéutica que comprende el péptido de cualquiera de las reivindicaciones 1 a 3 y/o un anticuerpo o un fragmento del mismo tal y como se define en la reivindicación 8.

10. Composición veterinaria o farmacéutica según la reivindicación 9, para su uso en terapia.

11. Uso de la composición veterinaria o farmacéutica de la reivindicación 9, para la elaboración de un medicamento para el tratamiento o la prevención en un mamífero de una infección por larvas de insectos dípteros capaces de provocar miasis.

12. U so de la composición veterinaria o farmacéutica según la reivindicación 11, donde las larvas de insectos dípteros pertenecen a una cualquiera de las siguientes familias: Calliphoridae (moscas azules) , Oestridae (tábanos) o Sarcophagidae (moscas de la carne) .

13. Uso de la composición veterinaria o farmacéutica según la reivindicación 12, donde las larvas de insectos dípteros pertenecen a la familia Oestridae.

14. Uso de la composición veterinaria o farmacéutica según la reivindicación 13, donde las larvas de insectos dípteros pertenecen a uno cualquiera de los siguientes géneros: Oestrus, Dermatobia, Hypoderma o Gasterophilinae.

15. U so de la composición veterinaria o farmacéutica según la reivindicación 14, donde las larvas de insectos dípteros pertenecen a la especie Dermatobia hominis.

16. Composición veterinaria o farmacéutica según cualquiera de las reivindicaciones 9 a 15,

que además comprende un vehículo farmacéuticamente aceptable. 10

17. Composición veterinaria o farmacéutica según cualquiera de las reivindicaciones 9 a 15, en la que dicha composición veterinaria o farmacéutica es una vacuna.

18. Composición veterinaria o farmacéutica según una cualquiera de las reivindicaciones 11 a 15 15, en la que el mamífero es un ser humano.

19. Composición veterinaria o farmacéutica según una cualquiera de las reivindicaciones 11 a 15, en la que el mamífero pertenece a la subfamilia biológica bovina.

40

30

10

o Terneros vac Terneros Figura 1

OJ'>4

0.32

0.16

0.1:10

Figura 2

Identidades= 159/359 (44%) , Positivos = 224/359 (62%) , Huecos = 17/359 (5%)

arginina-----MVDAAVLAKLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVI54 creatinaMPFGNTHNKHKLNFKAEEEYPDLSKHNN--HMAKALTLEIYKKLRDKETPSGFTLDDVI57

. * ** * *. . * ** *...*..* **. ** ***

......

argininaQSGLENHDS---GVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTF 110 creatinaQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPllQDRHGGFKPTDKHKTDLNHENLK 116

*.*..* ** . . ...

* * *.**** *******.* ***** ****

argininaGNVDPTNEYVISTRVRCGRSMQGYPFNPCL TEAQYKEMESKVSSTLSGLEG ELKGKFYPL 170 creatinaGGDDLDPNYVLSSRVRTGRSI KGY ALPPHCSRGERRAVEKLSVEALNSL TGE FKGKYYPL 176

* * .**.*.*** ***..** . * . . ..* .* * **.***.***

...........

argininaTGMEKAVQQQLlDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFL VWCNEEDHLR 229 creatinaKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLV WVNEEDHLR 236

*. ***********. .* *. * ** ***.*** *.**** *******

argininaIISMQQGGDLGQIYKRLVTAVNEIEKR----VPFSHDDRLGFL TFCPTNLGTTIRASVH 284 creatinaVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVL TCPSNLG TGLRGGVH 296

.***..**......*. ...**. ** ...**.. **.****.* **

. .............. .

arg ininal KVP KLASN KAKLE EV AAKYN LQVRGTRG EHTEAEGGVYD ISN KRRMG L TE F EAVKEMYD 344 creatina VKLAH LSKHPKFEEIL TRLRLQKRGTGGVDT AAVGSVFDVSNADRLGSSEVEQVQLVVD 355

.*..*... *.**... ** *** * * * * *.*.** *.*.* * * .. *

argininaGITELlKLEKSL--------------356 creatinaGVKLMVEMEKKLEKGQS I DDLI PAQK 381

Figura 3

Figura 4

Dermatobia -----------------------HPAKNWGDVSVFGNLD---------------------16 AAN11983.1 MVDAAVLAKLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLE N 60

*.. ** **

Dermatobia ---------PNGE-------------------FVVSTR----NWGDVSVFGNLDPNGEFV 44 AAN11983.1 HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFGNVDPTNE YV 120

*. * * .. *.**** ***.** *.*

. . . .

Dermatobia VSTRVR---SLEGYPFNPCLTEAQYKEME------------QKGTFYPLTGMSKDVQQ-87 AAN11983.1 ISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAV QQQ 180

.***** * ***************** ** ******* * ***.

. .

Dermatobia ------------KFLQAANAC------RGIYHNENKTFLVWCNEEDHLR----------118 AAN11983.1 LlDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGG DLG 240

.******** ******. **************

Dermatobia ---------------RIPFSHDDRLGFLTFCPTNLGTTLR--------------------143 AAN11983.1 QIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEV 300

*.*********************.*.

.

Dermatobia -------------------------------------------------------AAN11983.1 AAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELlKLEKSL 356

Figura 5

sequence listing_sT25 final text Listado De Secuencias <110> Universidad de Granada <120> COMPOSICIÓN BASADA EN POLIPÉPTIDOS PARA EL TRATAMIENTO DE MIASIS

<130> 153930

<160> 12

<170> PatentIn version 3.4

<210> 1

<211> 13

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <220>

<221> PEPTIDE

<222> (1) .. (13)

<223> Fragmento antigenico <400> 1

Leu Gly Phe Leu Thr Phe cys Pro Thr Asn Leu Gly Thr 1 5 10

<210> 2

<211> 16

<212> PRT

<213> Secuencia artificial

<220>

<221> PEPTIDE

<222> (1) .. (16)

<223> Fragmento antigenico <400> 2

Asn Glu Ile Glu Lys Arg val Pro Phe Ser His ASp ASp Arg Leu Gly1 5 10 15

<210> 3

<211> 26

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <400> 3

His Pro Ala Lys Asn Trp Gly ASp Val Ser val Phe Gly Asn Leu ASp1 5 10 15

Pro Asn Gly Glu Phe val val Ser Thr Arg 20 25

<210> 4

sequence listing_sT25 final text

<211> 24

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <400> 4

Asn Trp Gly ASp val Ser val Phe Gly Asn Leu ASp Pro Asn Gly Gl u 1 5 10 15

Phe val val Ser Thr Arg val Arg20

<210> 5

<211> 22

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <400> 5

Ser Leu Glu Gly Tyr Pro Phe Asn Pro cys Leu Thr Glu Ala Gl n Tyr1 5 10 15

Lys Glu Met Gl u Gl n Lys20

<210> 6

<211> 16

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <400> 6

Gly Thr Phe Tyr Pro Leu Thr Gly Met Ser Lys ASp val Gln Gl n Lys1 5 10 15

<210> 7

<211> 9

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <400> 7

Phe Leu Gln Ala Ala Asn Ala cys Arg1 5

<210> 8

<211> 8

<212> PRT

<213> Secuencia artificial

sequence listing_sT25 final text

<220>

<223> Fragmento antigenico <400> 8

Gly Ile Tyr His Asn Glu Asn Lys1 5

<210> 9

<211> 13

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <400> 9

Thr Phe Leu val Trp cys Asn Glu Glu ASp His Leu Arg1 5 10

<210> 10

<211> 25

<212> PRT

<213> Secuencia artificial

<220>

<223> Fragmento antigenico <400> 10

Arg Ile Pro Phe Ser His ASp ASp Arg Leu Gly Phe Leu Thr Phe cys1 5 10 15

Pro Thr Asn Leu Gly Thr Thr Leu Arg20 25

<210> 11

<211> 39

<212> DNA

<213> Secuencia artificial

<220>

<223> Secuencia nucleotidica codificante de la SEQ ID No 1

<400> 11 ctgggcttcc tgaccttctg ccccaccaac ctgggcacc 39

<210> 12

<211> 48

<212> DNA

<213> Secuencia artificial

<220>

<223> Secuencia nucleotidica codificante de la SEQ ID No 2