Anticuerpos anti-Factor D humanizados y usos de los mismos.

Un anticuerpo anti-Factor D que comprende un dominio variable de cadena ligera que tiene al menos el 90 % de identidad de secuencia de aminoácidos con la secuencia de aminoácidos de la SEC ID Nº: 7 y un dominio variable de cadena pesada que tiene al menos el 90 % de identidad de secuencia de aminoácidos con la secuencia de aminoácidos de la SEC ID Nº: 19, en donde

(i) el dominio variable de cadena ligera comprende HVR-1 que comprende ITSTDIDDDMN (SEC ID Nº: 30), HVR-2 que comprende GGNTLRP (SEC ID Nº: 35) y HVR-3 que comprende LQSDSLPYT (SEC ID Nº: 38); y

(ii) el dominio variable de cadena pesada comprende HVR-1 que comprende GYTFTNYGMN (SEC ID Nº: 39), HVR-2 que comprende WINTYTGETTYADDFKG (SEC ID Nº: 40) y HVR-3 que comprende EGGVNN (SEC ID Nº: 41); y en donde

el aminoácido en la posición 1 del dominio variable de cadena pesada es E.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2009/041785.

Solicitante: GENENTECH, INC..

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 1 DNA WAY SOUTH SAN FRANCISCO, CA 94080 ESTADOS UNIDOS DE AMERICA.

Inventor/es: KELLEY, ROBERT, F., LOWMAN,HENRY, VAN LOOKEREN CAMPAGNE,MENNO, HUANG,ARTHUR J, WINTER,CHARLES M.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/18 (contra materiales animales o humanos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para tratar los trastornos de los sentidos > A61P27/02 (Agentes oftálmicos)
google+ twitter facebook

Texto extraído del PDF original:

DESCRIPCIÓN

Anticuerpos anti-Factor D humanizados y usos de los mismos

Antecedentes de la invención El sistema del complemento desempeña un papel fundamental en el aclaramiento de complejos inmunitarios y la respuesta inmunitaria a agentes infecciosos, antígenos extraños, células infectadas por virus y células tumorales. Sin embargo, el complemento también está implicado en la inflamación patológica y en enfermedades autoinmunitarias. Por lo tanto, la inhibición de la activación excesiva o incontrolada de la cascada del complemento podría proporcionar beneficios clínicos a pacientes con dichas enfermedades y afecciones. El sistema del complemento abarca dos rutas de activación distintas, denominadas rutas clásica y alternativa (V.M. Holers, en Clinical immunology: Principles and Practice, ed. R.R. Rich, Mosby Press; 1996, 363-391). La ruta clásica es una cascada dependiente de calcio y magnesio que es activada normalmente por la formación de complejos antígeno-anticuerpo, la ruta alternativa es una cascada dependiente de magnesio que es activada por depósito y activación de C3 sobre ciertas superficies susceptibles, (por ejemplo polisacáridos de la pared celular de levaduras y bacterias y ciertos materiales biopoliméricos). La activación de la ruta del complemento genera fragmentos biológicamente activos de proteínas del complemento, por ejemplo anafilotoxinas C3a, C4a y C5a y C5b-9 complejos de ataque a la membrana (MAC), que median las actividades inflamatorias que implican quimiotaxis de leucocitos, activación de macrófagos, neutrófilos, plaquetas, mastocitos y células endoteliales, la permeabilidad vascular, la citólisis y la lesión tisular. El Factor D es una serina proteasa altamente específica esencial para la activación de la ruta alternativa del complemento. Escinde el factor B unido a C3b, generando la enzima C3b/Bb que es el componente activo de las convertasas C3/C5 de la ruta alternativa. El Factor D puede ser una diana adecuada para la inhibición, dado que su concentración en plasma en seres humanos es muy baja (1,8 µg/ml) y ha demostrado ser la enzima limitante para la activación de la ruta alternativa del complemento (P.H. Lesavre y H.J. Müller-Eberhard. J. Exp. Med., 1978; 148: 1498-1510; J.E. Volanakis et al., New Eng. J. Med., 1985; 312: 395-401).

La regulación negativa de la activación del complemento ha demostrado ser eficaz en el tratamiento de varias indicaciones de enfermedades en modelos animales y en estudios ex vivo, por ejemplo lupus eritematoso sistémico y glomerulonefritis (Y. Wang et al., Proc. Natl. Acad. Sci.), artritis reumatoide (Y. Wang et al., Proc. Natl. Acad. Sci., 1995; 92: 8955-8959), bypass cardiopulmonar y hemodiálisis (C.S. Rinder, J. Clin. invest., 1995; 96: 1564-1572), rechazo hiperagudo en trasplante de órganos (T.J. Kroshus et al., Transplantation, 1995; 60: 1194-1202), infarto de miocardio (J. W. Homeister et al., J. Immunol., 1993; 150: 1055-1064; H.F. Weisman et al., Science, 1990; 249: 146- 151), lesión por reperfusión (E.A. Amsterdam et al., Am. J. Physiol., 1995; 268: H448-H457) y síndrome de dificultad respiratoria del adulto (R. Rabinovici et al., J. Immunol., 1992; 149: 1744-1750). Además, otras afecciones inflamatorias y enfermedades de complejos autoinmunitarios/inmunitarios también están estrechamente asociadas con la activación del complemento (V.M. Holers, ídem., B.P. Morgan. Eur. J. Clin. Invest., 1994: 24: 219-228), incluyendo lesión térmica, asma grave, choque anafiláctico, inflamación intestinal, urticaria, angioedema, vasculitis, esclerosis múltiple, miastenia grave, glomerulonefritis membranoproliferativa y síndrome de Sjögren. Existe una necesidad de anticuerpos terapéuticos en el campo de trastornos mediados por el complemento y anticuerpos anti-Factor D humanizados y variantes de anticuerpo de los mismos y fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) de la presente invención proporcionan anticuerpos de alta afinidad útiles para satisfacer esta necesidad. El documento WO2008/055206, publicado después de la fecha de prioridad de la presente solicitud, también desvela anticuerpos anti-Factor D humanizados. Sumario de la invención La presente invención se refiere a anticuerpos anti-Factor D de acuerdo con la reivindicación 1.

En un aspecto, la presente invención se refiere a anticuerpos capaces de inhibir actividades biológicas asociadas con el Factor D. En un aspecto, la presente invención se refiere a anticuerpos anti-Factor D humanizados, que tienen diversas características terapéuticamente deseadas. La invención incluye las secuencias de aminoácidos de los dominios variables de la cadena pesada y ligera de los anticuerpos anti-Factor D humanizados y sus secuencias de ácido nucleico correspondientes. La invención incluye las secuencias de aminoácidos de la cadena pesada y ligera de los anticuerpos anti-Factor D humanizados y sus secuencias de ácido nucleico correspondientes.

En un aspecto, anticuerpos específicos dentro del alcance de esta invención son los anticuerpos anti-Factor D humanizados que tienen los dominios variables de las cadenas pesada y ligera de clones 238-1 de Fab anti-Factor D humanizados. En una realización, los anticuerpos anti-Factor D humanizados comprenden las cadenas pesada y/o ligera del clon nº238 de Fab anti-Factor D humanizado. En una realización, la invención incluye el clon nº238 de Fab anti-Factor D humanizado. En una realización, la invención incluye fragmentos de anticuerpo (por ejemplo fragmentos de unión al antígeno) de anticuerpos de longitud completa del clon nº238 de Fab anti-Factor D humanizado. Descritos en el presente documento, anticuerpos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno), pueden unirse al Factor D con una afinidad de unión de al menos de aproximadamente 10-9 a 10-12M.

En el presente documento se describen, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno), en los que un fragmento Fab de dichos anticuerpos inhibe una función biológica del Factor D en una relación molar de fragmento Fab respecto al Factor D de aproximadamente 0,05:1 (0,05) a aproximadamente 10:1 (10), o de aproximadamente 0,09:1 (0,09) a aproximadamente 8:1 (8), o de aproximadamente 0,1:1 (0,1) a aproximadamente 6:1 (6), o de aproximadamente 0,15:1 (0,15) a aproximadamente 5:1 (5), o de aproximadamente 0,19:1 (0,19) a aproximadamente 4:1 (4), o de aproximadamente 0,2:1 (0,2) a aproximadamente 3:1 (3), o de aproximadamente 0,3:1 (0,3) a aproximadamente 2:1 (2), o de aproximadamente 0,4:1 (0,4) a aproximadamente 1:1 (1), o de aproximadamente 0,5:1 (0,5) a aproximadamente 1:2 (0,5), o de aproximadamente 0,6:1 (0,6) a aproximadamente 1:3 (0,33), o de aproximadamente 0,7:1 (0,7) a aproximadamente 1:4 (0,25), o de aproximadamente 0,8:1 (0,8) a aproximadamente 1:5 (0,2) o de aproximadamente 0,9:1 (0,9) a aproximadamente 1:6 (0,17).

En un aspecto, los anticuerpos de la presente invención incluyen anticuerpos humanos, humanizados o quiméricos. En otro aspecto, la presente invención incluye fragmentos de anticuerpo (por ejemplo fragmentos de unión al antígeno) de anticuerpos anti-Factor D humanizados. Los fragmentos de anticuerpo de la presente invención pueden ser, por ejemplo, Fab, Fab', F(ab')2, scFv, (scFv)2, dAb, fragmentos de la región determinante de la complementariedad (CDR), anticuerpos lineales, moléculas de anticuerpo de cadena sencilla, minicuerpos, diacuerpos, o anticuerpos multiespecíficos formados a partir de fragmentos de anticuerpo. En otros aspectos de la invención, la presente invención incluye composiciones que comprenden un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). En otra realización, la invención proporciona líneas celulares y vectores que codifican al menos una parte de un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). En un aspecto, la invención incluye un método de preparación de anticuerpos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno). En una realización, el método de preparación de un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno), en el que el método comprende (a) cultivar una célula hospedadora, por ejemplo una célula eucariota o CHO, que comprende un vector, que comprende además un polinucleótido que codifica un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno), en condiciones adecuadas para la expresión del polinucleótido que codifica el anticuerpo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) y (b) aislar el anticuerpo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). En un aspecto adicional más, la invención se refiere a una composición de materia que comprende un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno), tal como se describe en el presente documento, en combinación con un vehículo. El vehículo es un vehículo farmacéuticamente aceptable.

Otro aspecto de la presente invención es el uso de estos anticuerpos humanizados o fragmentos de anticuerpo de los mismos (por ejemplo fragmentos de unión al antígeno), para la preparación de un medicamento o composición para la prevención y/o el tratamiento de trastornos asociados con la activación excesiva o incontrolada del complemento. Estos incluyen activación del complemento durante operaciones de bypass cardiopulmonar; activación del complemento debida a isquemia-reperfusión después de infarto de miocardio agudo, aneurisma, apoplejía, choque hemorrágico, lesión por aplastamiento, fallo multiorgánico, choque hipovolémico, isquemia intestinal u otros acontecimientos que causan isquemia. La activación del complemento también ha demostrado estar asociada con afecciones inflamatorias tales como quemaduras graves, endotoxemia, choque séptico, síndrome de dificultad respiratoria del adulto, hemodiálisis; choque anafiláctico, asma grave, angioedema, enfermedad de Crohn, anemia de células falciformes, glomerulonefritis y pancreatitis posestreptocócicas. El trastorno puede ser el resultado de una reacción adversa a un fármaco, alergia a un fármaco, síndrome de fuga vascular inducido por IL-2 o alergia a medios de contraste radiográfico. También incluye enfermedad autoinmunitaria tal como lupus eritematoso sistémico, miastenia grave, artritis reumatoide, enfermedad de Alzheimer y esclerosis múltiple. En otra realización, la activación del complemento también está asociada con rechazo de trasplante. En otra realización, la activación del complemento también está asociada con enfermedades oculares (todas las afecciones y enfermedades oculares cuya patología implica al complemento, incluyendo la ruta clásica y la alternativa del complemento), tales como, por ejemplo, sin limitación, enfermedad degenerativa macular, tales como todas las fases de degeneración macular asociada a la edad (DMAE), incluyendo formas húmeda y seca (no exudativa y exudativa), retinopatía diabética y otras retinopatías asociadas a isquemia, neovascularización coroidea (NVC), uveitis, edema macular diabético, miopía patológica, enfermedad de von Hippel-Lindau, histoplasmosis del ojo, oclusión de la vena central de la retina (OVCR), neovascularización corneal y neovascularización retiniana. En un ejemplo, las afecciones oculares asociadas al complemento incluyen degeneración macular asociada a la edad (DMAE), incluyendo no exudativa (por ejemplo, DMAE seca intermedia o atrofia geográfica (AG)) y exudativa (por ejemplo DMAE húmeda (neovascularización coroidea (NVC)) DMAE, retinopatía diabética (RD), endoftalmitis y uveitis. En un ejemplo adicional, la DMAE no exudativa puede incluir la presencia de drusas duras, drusas blandas, atrofia geográfica y/o aglutinación de pigmentos. En otro ejemplo, las afecciones oculares asociadas con el complemento incluyen degeneración macular asociada a la edad (DMAE), incluyendo DMAE temprana (por ejemplo incluye múltiples drusas pequeñas a una o más de tamaño medio no extensivas), DMAE intermedia (por ejemplo incluye drusas medias extensivas a una o más drusas grandes) y DMAE avanzada (por ejemplo incluye atrofia geográfica o DMAE húmeda avanzada (NVC). En un ejemplo adicional, la DMAE seca intermedia puede incluir drusas confluentes grandes. En un ejemplo adicional, la atrofia geográfica puede incluir pérdida de fotorreceptores y/o epitelio retiniano pigmentado (ERP). En un ejemplo adicional, el área de atrofia geográfica puede ser pequeña o grande y/o puede estar en el área de la mácula o en la retina periférica. En un ejemplo, la afección ocular asociada al complemento es DMAE seca intermedia. En un ejemplo, la afección ocular asociada al complemento es atrofia geográfica. En un ejemplo, la afección ocular asociada al complemento es DMAE húmeda (neovascularización coroidea (NVC)). En el presente documento se describe un kit, que comprende un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). En el presente documento se describe un kit, que comprende un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) e instrucciones de uso. En el presente documento se describe un kit que comprende un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) e instrucciones para administrar dicho anticuerpo, para tratar un trastorno asociado al complemento. En el presente documento se describe un kit que comprende un primer recipiente que comprende una composición que comprende uno o más anticuerpos de la invención, o fragmentos de anticuerpo de los mismos (por ejemplo fragmentos de unión al antígeno); y un segundo recipiente que comprende un tampón. El tampón puede ser farmacéuticamente aceptable. Se describe una composición que comprende un anticuerpo de la invención, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) comprende además un vehículo, que puede ser farmacéuticamente aceptable. Opcionalmente un kit comprende además instrucciones para administrar la composición (por ejemplo el anticuerpo, o fragmento de anticuerpo del mismo (por ejemplo fragmento de unión al antígeno) a un sujeto. Opcionalmente un kit comprende además instrucciones para el uso del kit. En el presente documento se describe un artículo de fabricación que contiene materiales útiles para el tratamiento, la prevención y/o el diagnóstico de trastornos asociados al complemento. En el presente documento se describe un artículo de fabricación, que comprende: (a) un recipiente; (b) una etiqueta en el recipiente; y (c) una composición de materia que comprende un anticuerpo, o variante del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), de la presente invención, contenido con el recipiente, en el que la etiqueta en dicho recipiente indica que la composición puede usarse para el tratamiento, la prevención y/o el diagnóstico de trastornos asociados al complemento.

En el presente documento se describe el uso de un anticuerpo anti-Factor D de la invención, o fragmento de anticuerpo del mismo (por ejemplo fragmento de unión al antígeno), ácido nucleico de la invención, vector de expresión de la invención o célula hospedadora de la invención, en la preparación de un medicamento para el tratamiento terapéutico y/o profiláctico de una enfermedad, tal como una afección ocular asociada al complemento. Opcionalmente, la afección ocular asociada al complemento se selecciona entre degeneración macular asociada a la edad (DMAE), incluyendo no exudativa (por ejemplo, DMAE seca intermedia o atrofia geográfica (AG)) y exudativa (por ejemplo DMAE húmeda (neovascularización coroidea (NVC)) DMAE, retinopatía diabética (RD), endoftalmitis y uveitis. En un ejemplo, la afección ocular asociada al complemento es DMAE seca intermedia. En un ejemplo, la afección ocular asociada al complemento es atrofia geográfica. En un ejemplo, la afección ocular asociada al complemento es DMAE húmeda (neovascularización coroidea (NVC)).

En el presente documento se describe el uso de un artículo de fabricación en la preparación de un medicamento para el tratamiento terapéutico y/o profiláctico de una enfermedad, tal como una afección ocular asociada al complemento. La afección ocular asociada al complemento puede seleccionarse entre degeneración macular asociada a la edad (DMAE), incluyendo no exudativa (por ejemplo, DMAE seca intermedia o atrofia geográfica (AG)) y exudativa (por ejemplo DMAE húmeda (neovascularización coroidea (NVC)) DMAE, retinopatía diabética (RD), endoftalmitis y uveitis. En un ejemplo, la afección ocular asociada al complemento es DMAE seca intermedia. En un ejemplo, la afección ocular asociada al complemento es atrofia geográfica. En un ejemplo, la afección ocular asociada al complemento es DMAE húmeda (neovascularización coroidea (NVC)).

En el presente documento se describe el uso de un kit en la preparación de un medicamento para el tratamiento terapéutico y/o profiláctico de una enfermedad, tal como una afección ocular asociada al complemento. La afección ocular asociada al complemento puede seleccionarse entre degeneración macular asociada a la edad (DMAE), incluyendo no exudativa (por ejemplo DMAE seca intermedia o atrofia geográfica (AG)) y exudativa (por ejemplo DMAE húmeda (neovascularización coroidea (NVC)) DMAE, retinopatía diabética (RD), endoftalmitis y uveitis. En un ejemplo, la afección ocular asociada al complemento es DMAE seca intermedia. En un ejemplo, la afección ocular asociada al complemento es atrofia geográfica. En un ejemplo, la afección ocular asociada al complemento es DMAE húmeda (neovascularización coroidea (NVC)). Breve descripción de las figuras

Las figuras 1A-1C muestran el alineamiento de secuencias de los dominios de cadena ligera variable para los siguientes: clon n.º 111 de Fab anti-Factor D humanizado (SEC ID Nº: 1), Fab anti-Factor D humanizados, 238, 238- 1, 238-2, 238-3, 238-4, 238-5, 238-6, 238-7, 238-8, 238-9, 238-10 y 238-11 (SEC ID Nº: 6-17, respectivamente) y secuencia consenso VL Kappa I (SEC ID Nº: 65). Las posiciones están enumeradas de acuerdo con Kabat y las regiones hipervariables (de acuerdo con las definiciones de Kabat + Chothia HVR) están enmarcadas (HVR: (1) HVR-L1 identificada como A1-A11 (ITSTDIDDDMN (SEC ID Nº: 30), ITSTDIDDDLN (SEC ID Nº: 31), ITSTDIDDDIN (SEC ID Nº: 32), ITSTDIDDDMA (SEC ID Nº: 33) o ITSTDIDDDMQ (SEC ID Nº: 34)), (2) HVR-L2 identificada como B1-B7 (GGNTLRP (SEC ID Nº: 35), GGSTLRP (SEC ID Nº: 36) o GGATLRP (SEC ID Nº: 37)), (3) HVR-L3 identificada como C1-C9 (LQSDSLPYT (SEC ID Nº: 38)). Los cambios de aminoácidos en cada Fab anti-Factor D humanizado están en negrita y en cursiva.

La figura 2A-C muestra el alineamiento de secuencias de los dominios de cadena pesada variable para los siguientes: clon n.º 111 de Fab anti-Factor D humanizado (SEC ID Nº: 2) y Fab anti-Factor D humanizados, 238, 238-1, 238-2, 238-3, 238-4, 238-5, 238-6, 238-7, 238-8, 238-9,238-10 y 238-11 (SEC ID Nº: 18-29, respectivamente) y secuencia consenso VH subgrupo 7 (SEC ID Nº: 66). Las posiciones están enumeradas de acuerdo con Kabat y las regiones hipervariables (de acuerdo con las definiciones de Kabat + Chothia HVR) están enmarcadas (HVR: (1) HVR-H1 identificada como D1-D10 (GYTFTNYGMN (SEC ID Nº: 39), (2) HVR-H2 identificada como E1-E19 (WINTYTGETTYADDFKG (SEC ID Nº: 40), (3) HVR-H3 identificada como F1-F6 (EGGVNN (SEC ID Nº: 41), EGGVAN (SEC ID Nº: 42), EGGVQN (SEC ID Nº: 43), EGGVNA(SEC ID Nº: 44) o EGGVNQ (SEC ID Nº: 45)). Los cambios de aminoácidos en cada Fab anti-Factor D humanizado están en negrita y en cursiva.

La figura 3 muestra la secuencia de nucleótidos (SEC ID Nº: 46) de la cadena ligera de Fab anti-Factor D humanizado 238. La secuencia de nucleótidos codifica la cadena ligera de Fab anti-Factor D humanizado 238 con el codón de inicio y de terminación mostrados en negrita y subrayados. El codón correspondiente al primer aminoácido en la figura 4 (SEC ID Nº: 47) está en negrita y subrayado.

La figura 4 muestra la secuencia de aminoácidos (SEC ID Nº: 47) de la cadena ligera para Fab anti-Factor D humanizado 238. La secuencia de aminoácidos carece de la secuencia señal del extremo N del polipéptido codificado por la SEC ID Nº: 46 mostrada en la figura 3. Las secuencias HVR están en negrita y en cursiva. Las regiones variables son regiones no subrayadas, mientras que el primer dominio constante CL1 está subrayado. Se muestran las regiones marco (FR) y las regiones HVR: FR1-LC (SEC ID Nº: 48), FR2-LC (SEC ID Nº: 49), FR3-LC (SEC ID Nº: 50), FR4-LC (SEC ID Nº: 51), HVR1-LC (SEC ID Nº: 30 (ITSTDIDDDMN)), HVR2-LC (SEC ID Nº: 35 (GGNTLRP)), HVR3-LC (SEC ID Nº: 38 (LQSDSLPYT)) y CL1 (SEC ID Nº: 52). La figura 5 muestra la secuencia de nucleótidos (SEC ID Nº: 53) de la cadena pesada de Fab anti-Factor D humanizado 238. La secuencia de nucleótidos codifica la cadena pesada de Fab anti-Factor D humanizado 238 con el codón de inicio y de terminación mostrados en negrita y subrayados. El codón correspondiente al primer aminoácido en la figura 6 (SEC ID Nº: 54) está en negrita y subrayado. La figura 6 muestra la secuencia de aminoácidos (SEC ID Nº: 54) de la cadena pesada para Fab anti-Factor D humanizado 238. La secuencia de aminoácidos carece de la secuencia señal del extremo N del polipéptido codificado por SEC ID Nº: 53 mostrada en la figura 5. Las secuencias HVR están en negrita y en cursiva. Las regiones variables son regiones no subrayadas, mientras que el primer dominio constante CH1 está subrayado. Se muestran las regiones marco (FR) y las regiones HVR: FR1-HC (SEC ID Nº: 55), FR2-HC (SEC ID Nº: 56), FR3-HC (SEC ID Nº: 57), FR4-HC (SEC ID Nº: 58), HVR1-HC (SEC ID Nº: 39 (GYTFTNYGMN)), HVR2-HC (SEC ID Nº: 40 (WINTYTGETTYADDFKG)), HVR3-HC (SEC ID Nº: 41 (EGGVNN)) y CH1 (SEC ID Nº: 59). La figura 7 muestra la secuencia de nucleótidos (SEC ID Nº: 60) de la cadena ligera de Fab anti-Factor D humanizado 238-1. La secuencia de nucleótidos codifica la cadena ligera de Fab anti-Factor D humanizado 238-1 con el codón de inicio y de terminación mostrados en negrita y subrayados. El codón correspondiente al primer aminoácido en la figura 8 (SEC ID Nº: 61) está en negrita y subrayado. La figura 8 muestra la secuencia de aminoácidos (SEC ID Nº: 61) de la cadena ligera para Fab anti-Factor D humanizado 238-1. La secuencia de aminoácidos carece de la secuencia señal del extremo N del polipéptido codificado por SEC ID Nº: 60 mostrada en la figura 7. Las secuencias HVR están en negrita y en cursiva. Las regiones variables son regiones no subrayadas, mientras que el primer dominio constante CL1 está subrayado. Se muestran las regiones marco (FR) y las regiones HVR: FR1-LC (SEC ID Nº: 48), FR2-LC (SEC ID Nº: 49), FR3-LC (SEC ID Nº: 50), FR4-LC (SEC ID Nº: 51), HVR1-LC (SEC ID Nº: 30 (ITSTDIDDDMN)), HVR2-LC (SEC ID Nº: 35 (GGNTLRP)), HVR3-LC (SEC ID Nº: 38 (LQSDSLPYT)) y CL1 (SEC ID Nº: 52).

La figura 9 muestra la secuencia de nucleótidos (SEC ID Nº: 62) de la cadena pesada de Fab anti-Factor D humanizado 238-1. La secuencia de nucleótidos codifica la cadena pesada de Fab anti-Factor D humanizado 238-1 con el codón de inicio y de terminación mostrados en negrita y subrayados. El codón correspondiente al primer aminoácido en la figura 10 (SEC ID Nº: 63) está en negrita y subrayado. La figura 10 muestra la secuencia de aminoácidos (SEC ID Nº: 63) de la cadena pesada para Fab anti-Factor D humanizado 238-1. La secuencia de aminoácidos carece de la secuencia señal del extremo N del polipéptido codificado por SEC ID Nº: 62 mostrada en la figura 9. Las secuencias HVR están en negrita y en cursiva. Las regiones variables son regiones no subrayadas, mientras que primer dominio constante CH1 está subrayado. Se muestran las regiones marco (FR) y las regiones HVR: FR1-HC (SEC ID Nº: 64), FR2-HC (SEC ID Nº: 56), FR3-HC (SEC ID Nº: 57), FR4-HC (SEC ID Nº: 58), HVR1-HC (SEC ID Nº: 39 (GYTFTNYGMN)), HVR2-HC (SEC ID Nº: 40 (WINTYTGETTYADDFKG)), HVR3-HC (SEC ID Nº: 41 (EGGVNN)) y CH1 (SEC ID Nº: 59). La figura 11 muestra los resultados del ensayo hemolítico, que muestran inhibición de la actividad alternativa del complemento, para el clon n.º 111 de Fab anti-Factor D humanizado y Fab anti-Factor D humanizados 238 y 238-1. Se muestran valores de CI50.

La figura 12 muestra los resultados del ensayo hemolítico, que muestran inhibición de la actividad de la ruta alternativa (AP) del complemento, para Fab anti-Factor D humanizado 238, a tres concentraciones en suero (9,7 nM, 16,2 nM y 26,5 nM) de Factor D. La tabla 3 muestra los valores de CI50 (nM) y CI90 (nM) (los valores representan el promedio de tres experimentos repetidos), correspondientes a las tres concentraciones en suero de Factor D. Las relaciones molares de anticuerpo respecto a Factor D diana también se muestran en la tabla 3. La figura 13 muestra la duración simulada de la inhibición de la activación de la ruta alternativa (AP) el complemento en un ojo humano usando una única inyección intravítrea (IVT) de Fab 238 anti-Factor D a una dosis de 2,5 mg (suponiendo una semivida (t1/2) de Fab 238 anti-Factor D = 11,5 días, basado en una gradación según una escala entre especies a partir del conejo). Se estimó que una única inyección IVT de Fab 238 anti-Factor D inhibía la activación de la AP del complemento en el tejido retiniano durante al menos aproximadamente 74 días y en el humor vítreo durante al menos aproximadamente 97 días. En la figura 13, la línea discontinua muestra la concentración simulada de Fab 238 anti-Factor D en el humor vítreo después de la administración intravítrea. En la figura 13, la línea continua muestra la concentración simulada de Fab 238 anti-Factor D en el tejido retiniano después de la administración intravítrea. La diferencia de la concentración en el humor vítreo y el tejido retiniano se basa en una estimación del coeficiente de reparto en tejido retiniano del 20 %; en otras palabras, el 20 % del fármaco total administrado al humor vítreo tendrá acceso al tejido retiniano. Descripción detallada de la invención

I. Definiciones Los términos usados en toda esta solicitud deben interpretarse con el significado habitual y típico para los expertos en la materia. Sin embargo, los solicitantes desean que a los siguientes términos se les dé la definición particular tal como se define a continuación. La frase “sustancialmente idéntica” con respecto a una secuencia de polipéptidos de una cadena de anticuerpo puede interpretarse como una cadena de anticuerpo que muestra al menos el 70 %, u 80 %, o 90 % o 95 % de identidad de secuencia con la secuencia de polipéptidos de referencia. El término con respecto a una secuencia de ácido nucleico puede interpretarse como una secuencia de nucleótidos que muestra al menos aproximadamente el 85 %, o 90 %, o 95 % o 97 % de identidad de secuencia con la secuencia de ácido nucleico de referencia. Se interpretará que el término “identidad” u “homología” significan el porcentaje de residuos de aminoácidos en la secuencia candidata que son idénticos al residuo de una secuencia correspondiente con la que se compara, después de alinear las secuencias e introducir huecos, si fuera necesario, para conseguir el porcentaje de identidad máximo para toda la secuencia y sin considerar ninguna sustitución conservativa como parte de la identidad de secuencia. Ni las extensiones ni las inserciones N- o C-terminales se considerarán reductoras de la identidad o la homología. En la técnica son bien conocidos métodos y programas informáticos para el alineamiento. La identidad de secuencia puede medirse usando software de análisis de secuencias.

El término “anticuerpo” se usa en el sentido más amplio y cubre específicamente anticuerpos monoclonales (incluyendo anticuerpos monoclonales de longitud completa), anticuerpos policlonales y anticuerpos multiespecíficos (por ejemplo, anticuerpos biespecíficos). Los anticuerpos (Abs) y las inmunoglobulinas (Igs) son glucoproteínas que tienen las mismas características estructurales. Aunque los anticuerpos muestran especificidad de unión a una diana específica, las inmunoglobulinas incluyen tanto anticuerpos como otras moléculas similares a anticuerpos que carecen de especificidad por la diana. Los anticuerpos e inmunoglobulinas nativas son habitualmente gucoproteínas heterotetraméricas de aproximadamente 150.000 daltons, compuestas por dos cadenas ligeras (L) idénticas y dos cadenas pesadas (H) idénticas. Cada cadena pesada tiene en un extremo un dominio variable (VH) seguido por una serie de dominios constantes. Cada cadena ligera tiene un dominio variable en un extremo (VL) y un dominio constante en su otro extremo.

Un anticuerpo “aislado” es uno que ha sido identificado y separado y/o recuperado de un componente de su entorno natural. Los componentes contaminantes de su entorno natural son materiales que interferirían en usos de diagnóstico o terapéuticos para el anticuerpo y pueden incluir enzimas, hormonas y otros solutos proteicos o no proteicos. En un ejemplo, el anticuerpo se purificará (1) a más del 95 % en peso de anticuerpo, tal como se determina mediante el método de Lowry y de la forma más preferente más del 99 % en peso, (2) a un grado suficiente para obtener al menos 15 residuos de la secuencia de aminoácidos N-terminal o interna mediante el uso de un secuenciador de taza giratoria, o (3) a homogeneidad mediante SDS-PAGE en condiciones reductoras o no reductoras usando azul de Coomassie o, preferentemente, tinción con plata. El anticuerpo aislado incluye el anticuerpo in situ dentro de células recombinantes, dado que al menos un componente del entorno natural del anticuerpo no estará presente. Habitualmente, sin embargo, el anticuerpo aislado se preparará mediante al menos una etapa de purificación. Tal como se usa en el presente documento, “anticuerpo anti-Factor D humano” significa un anticuerpo que se une específicamente a Factor D humano, de tal manera que inhiba o reduzca sustancialmente la activación del complemento. El término “Factor D” se usa en el presente documento para referirse a polipéptidos de Factor D de secuencia nativa y variante.

Un Factor D de “secuencia nativa”, es un polipéptido que tiene la misma secuencia de aminoácidos que un polipéptido de Factor D derivado de la naturaleza, independientemente de su modo de preparación. Por lo tanto, el Factor D de secuencia nativa puede aislarse de la naturaleza o puede producirse mediante medios recombinantes y/o sintéticos. Además de una proteína de Factor D madura, tal como una proteína de Factor D humano madura (NM_001928), la expresión “Factor D de secuencia nativa”, abarca específicamente formas precursoras de origen natural del Factor D (por ejemplo, una preproteína inactiva, que es escindida proteolíticamente para producir la forma activa), formas variantes de origen natural (por ejemplo, formas cortadas y empalmadas de forma alternativa) y variantes alérgicas de origen natural del Factor D, así como variantes conformacionales estructurales de moléculas de Factor D que tienen la misma secuencia de aminoácidos que un polipéptido de Factor D derivado de la naturaleza. Los polipéptidos de Factor D de animales no humanos, incluyendo primates superiores y mamíferos no humanos, están específicamente incluidos dentro de esta definición. “Variante del Factor D” significa un polipéptido de Factor D activo, tal como se define a continuación que tiene al menos aproximadamente el 80 % de identidad de secuencia de aminoácidos con un polipéptido de Factor D de secuencia nativa, tal como el polipéptido de Factor D humano de secuencia nativa (NM_001928). Habitualmente, una variante del Factor D tendrá al menos aproximadamente el 80 % de identidad de secuencia de aminoácidos, o al menos aproximadamente el 85 % de identidad de secuencia de aminoácidos, o al menos aproximadamente el 90 % de identidad de secuencia de aminoácidos, o al menos aproximadamente el 95 % de identidad de secuencia de aminoácidos, o al menos aproximadamente el 98 % de identidad de secuencia de aminoácidos, o al menos aproximadamente el 99 % de identidad de secuencia de aminoácidos con la secuencia de aminoácidos humana madura (NM_001928). El “porcentaje de identidad de secuencia de aminoácidos ( %)” se define como el porcentaje de residuos de aminoácidos en una secuencia candidata que son idénticos a los residuos de aminoácidos en una secuencia de Factor D de referencia, después de alinear las secuencias e introducir huecos, si fuera necesario, para conseguir el máximo porcentaje de identidad de secuencia y sin considerar ninguna sustitución conservativa como parte de la identidad de secuencia. El alineamiento para fines de determinar el porcentaje de identidad de secuencia de aminoácidos puede conseguirse de diversas maneras que están dentro del alcance de la técnica, por ejemplo, usando software informático disponible públicamente tal como software BLAST, BLAST-2, ALIGN o Megalign (DNASTAR). Los expertos en la materia pueden determinar parámetros apropiados para medir el alineamiento, incluyendo cualesquiera algoritmos necesarios para conseguir el máximo alineamiento a lo largo de toda la longitud de las secuencias que están siendo comparadas. A continuación se calcula la identidad de secuencia con respecto a la secuencia más larga, es decir incluso si una secuencia más corta muestra un 100 % de identidad de secuencia con una parte de una secuencia más larga, la identidad de secuencia global será menor del 100 %.

El “porcentaje de Identidad de secuencia de ácido nucleico ( %)” se define como el porcentaje de nucleótidos en una secuencia candidata que son idénticos a los nucleótidos en una secuencia que codifica Factor D de referencia, después de alinear las secuencias e introducir huecos, si fuera necesario, para conseguir el máximo porcentaje de identidad de secuencia. El alineamiento para fines de determinar el porcentaje de identidad de secuencia de ácido nucleico puede conseguirse de diversas maneras que están dentro del alcance de la técnica, por ejemplo, usando software informático disponible públicamente tal como software BLAST, BLAST-2, ALIGN o Megalign (DNASTAR). Los expertos en la materia pueden determinar parámetros apropiados para medir el alineamiento, incluyendo cualesquiera algoritmos necesarios para conseguir el máximo alineamiento a lo largo de toda la longitud de las secuencias que están siendo comparadas. A continuación se calcula la identidad de secuencia con respecto a la secuencia más larga, es decir incluso si una secuencia más corta muestra un 100 % de identidad de secuencia con una parte de una secuencia más larga, la identidad de secuencia global será menor del 100 %.

Una molécula de ácido nucleico “aislada” es una molécula de ácido nucleico que es identificada y separada de al menos una molécula de ácido nucleico contaminante con la que está habitualmente asociada en la fuente natural del ácido nucleico. Una molécula de ácido nucleico aislada es diferente en la forma o configuración en la que se encuentra en la naturaleza. Las moléculas de ácido nucleico aisladas, por lo tanto, se distinguen de la molécula de ácido nucleico, dado que ésta existe en células naturales. Sin embargo, una molécula de ácido nucleico aislada incluye moléculas de ácido nucleico contenidas en células que habitualmente expresan un polipéptido codificado en donde, por ejemplo, la molécula de ácido nucleico está en una ubicación cromosómica diferente de la de las células naturales.

Una molécula de ácido nucleico que codifica un polipéptido de Factor D “aislada” es una molécula de ácido nucleico que es identificada y separada de al menos una molécula de ácido nucleico contaminante con la que está habitualmente asociada en la fuente natural del ácido nucleico que codifica Factor D. Una molécula de ácido nucleico que codifica un polipéptido de Factor D aislada es diferente en la forma o configuración en la que se encuentra en la naturaleza. Las moléculas de ácido nucleico que codifican un polipéptido de Factor D aisladas, por lo tanto, se distinguen de la molécula o moléculas de ácido nucleico codificantes, dado que existen en células naturales. Sin embargo, una molécula de ácido nucleico que codifica Factor D aislada incluye moléculas de ácido nucleico que codifican Factor D contenidas en células que habitualmente expresan Factor D en donde, por ejemplo, la molécula de ácido nucleico está en una ubicación cromosómica diferente de la de células naturales.

El término “antagonista” se usa en el sentido más amplio, e incluye cualquier molécula que es capaz de neutralizar, bloquear, inhibir parcial o totalmente, abolir, reducir o interferir con una actividad biológica del Factor D. Los antagonistas del Factor D incluyen, sin limitación, anticuerpos anti-Factor D y variantes de anticuerpo de los mismos, fragmentos de unión al antígeno de los mismos, otros polipéptidos, péptidos y moléculas pequeñas no peptídicas de unión, que se unen al Factor D y son capaces de neutralizar, bloquear, inhibir parcial o totalmente, abolir, reducir o interferir con actividades del Factor D, tales como la capacidad del Factor D de participar en la patología de una afección ocular asociada al complemento. Una “molécula pequeña” se define en el presente documento que tiene un peso molecular por debajo de 600, preferible por debajo de aproximadamente 1000 daltons.

“Activo/a” o “actividad” o “actividad biológica” en el contexto de un antagonista del Factor D de la presente invención es la capacidad de antagonizar (inhibir parcial o totalmente) una actividad biológica del Factor D. Un ejemplo de una actividad biológica de un antagonista del Factor D es la capacidad de conseguir una mejora medible en el estado, por ejemplo patología, de una enfermedad o afección asociada al Factor D, tal como, por ejemplo, una afección ocular asociada al complemento. La actividad puede determinarse en ensayos in vitro o in vivo, incluyendo ensayos de unión, ensayos de hemólisis de la ruta alternativa (por ejemplo ensayos que miden la inhibición de la actividad o activación de la ruta alternativa del complemento), usando un modelo animal relevante, o ensayos clínicos en seres humanos.

La expresión “trastorno asociado al complemento” se usa en el sentido más amplio e incluye trastornos asociados con activación excesiva o incontrolada del complemento. Estos incluyen activación del complemento durante operaciones de bypass cardiopulmonar; activación del complemento debido a isquemia-reperfusión después de infarto de miocardio agudo, aneurisma, apopeljía, choque hemorrágico, lesión por aplastamiento, fallo multiorgánico, choque hipovolémico, isquemia intestinal u otros acontecimientos que causan isquemia. La activación del complemento también ha demostrado estar asociada con afecciones inflamatorias tales como quemaduras graves, endotoxemia, choque séptico, síndrome de dificultad respiratoria del adulto, hemodiálisis; choque anafiláctico, asma grave, angioedema, enfermedad de Crohn, anemia de células falciformes, glomerulonefritis posestreptocócica y pancreatitis. El trastorno puede ser el resultado de una reacción adversa a un fármaco, alergia a un fármaco, síndrome de fuga vascular inducido por IL-2 o alergia a medios de contraste radiográfico. También incluye enfermedad autoinmunitaria tal como lupus eritematoso sistémico, miastenia grave, artritis reumatoide, enfermedad de Alzheimer y esclerosis múltiple. La activación del complemento también está asociada con rechazo del trasplante. La activación del complemento también está asociada con enfermedades oculares tales como degeneración macular asociada a la edad, retinopatía diabética y otras retinopatías asociadas a isquemia, neovascularización coroidea (NVC), uveitis, edema macular diabético, miopía patológica, enfermedad de von Hippel-Lindau, histoplasmosis del ojo, oclusión de la vena central de la retina (OVCR), neovascularización corneal y neovascularización retiniana. La expresión “afección ocular asociada al complemento” se usa en el sentido más amplio e incluye todas las afecciones oculares cuya patología implica al complemento, incluyendo las rutas clásica y alternativa y en particular la ruta alternativa del complemento. Las afecciones oculares asociadas con el complemento incluyen, sin limitación, enfermedades maculares degenerativas, tales como todas las fases de degeneración macular asociada a la edad (DMAE), incluyendo formas seca y húmeda (no exudativa y exudativa), neovascularización coroidea (NVC), uveitis, retinopatía diabética y otras asociadas a isquemia y otras enfermedades neovasculares intraoculares, tales como edema macular diabético, miopía patológica, enfermedad de von Hippel-Lindau, histoplasmosis del ojo, oclusión de la vena central de la retina (OVCR), neovascularización corneal y neovascularización retiniana. En un ejemplo, las afecciones oculares asociadas con el complemento incluyen degeneración macular asociada a la edad (DMAE), incluyendo no exudativa (por ejemplo DMAE seca intermedia o atrofia geográfica (AG)) y exudativa (por ejemplo DMAE húmeda (neovascularización coroidea (NVC)) DMAE, retinopatía diabética (RD), endoftalmitis y uveitis. En un ejemplo adicional, la DMAE no exudativa puede incluir la presencia de drusas duras, drusas blandas, atrofia geográfica y/o aglutinación de pigmentos. En un ejemplo, las afecciones oculares asociadas con el complemento incluyen degeneración macular asociada a la edad (DMAE), incluyendo DMAE temprana (por ejemplo incluye múltiples drusas pequeñas a una o más de tamaño medio no extensivas), DMAE intermedia (por ejemplo incluye drusas medias extensivas a una o más drusas grandes) y DMAE avanzada (por ejemplo incluye atrofia geográfica o DMAE húmeda avanzada (NVC). (Ferris et al., AREDS Informe No. 18; Sallo et al., Eye Res., 34(3): 238-40 (2009); Jager et al., New Engl. J. Med., 359(1): 1735 (2008)). En un ejemplo adicional, DMAE seca intermedia puede incluir drusas grandes confluentes. En un ejemplo adicional, la atrofia geográfica puede incluir pérdida de fotorreceptores y/o epitelios retinianos pigmentados (ERP). En un ejemplo adicional, el área de atrofia geográfica puede ser pequeña o grande y/o puede estar en el área de la mácula o en la retina periférica. En un ejemplo, la afección ocular asociada al complemento es DMAE seca intermedia. En un ejemplo, la afección ocular asociada al complemento es atrofia geográfica. En un ejemplo, la afección ocular asociada al complemento es DMAE húmeda (neovascularización coroidea (NVC)).

El “Tratamiento” es una intervención realizada con la intención de prevenir el desarrollo o alterar la patología de un trastorno. Por consiguiente, “tratamiento” se refiere a tratamiento tanto terapéutico como profiláctico o medidas preventivas. Los que necesitan tratamiento incluyen los que ya tienen el trastorno así como aquellos en los que debe prevenirse el trastorno. En el tratamiento de una enfermedad asociada con el sistema inmunitario, un agente terapéutico puede alterar directamente la magnitud de la respuesta de un componente de la respuesta inmunitaria, o hacer a la enfermedad más susceptible al tratamiento mediante otros agentes terapéuticos, por ejemplo, antibióticos, antifúngicos, agentes antiinflamatorios, quimioterapéuticos, etc. La “patología” de una enfermedad, tal como una afección ocular asociada al complemento, incluye todos los fenómenos que comprometen el bienestar del paciente. Esto incluye, sin limitación, crecimiento celular anormal o incontrolable (células neutrófilas, eosinófilas, monocíticas, linfocíticas), producción de anticuerpos, producción de auto-anticuerpos, producción del complemento, interferencia con el funcionamiento normal de células colindantes, liberación de citoquinas u otros productos de secreción a niveles anormales, supresión o agravamiento de cualquier respuesta inflamatoria o inmunológica, infiltración de células inflamatorias (neutrófilos, eosinófilos, monocitos, linfocitos) en espacios celulares, etc. El término “mamífero” tal como se usa en el presente documento se refiere a cualquier animal clasificado como un mamífero, incluyendo, sin limitación, seres humanos, primates superiores, animales domésticos y de granja y animales de zoológico, competición deportiva o de compañía tales como caballos, cerdos, vacas, perros, gatos y hurones, etc. En una realización de la invención, el mamífero es un ser humano. La administración “en combinación con” uno o más agentes terapéuticos adicionales incluye administración simultánea (concurrente) y consecutiva en cualquier orden.

Una “cantidad terapéuticamente eficaz” es la cantidad de un “antagonista del Factor D” que se requiere para conseguir una mejora medible del estado, por ejemplo patología, de la enfermedad o afección diana, tal como, por ejemplo, una afección ocular asociada al complemento. La expresión “secuencias de control” se refiere a secuencias de ADN necesarias para la expresión de una secuencia codificante unida de forma operativa en un organismo hospedador particular. Las secuencias de control que son adecuados para procariotas, por ejemplo, incluyen un promotor, opcionalmente una secuencia operadora y un sitio de unión al ribosoma. Se sabe que las células eucariotas utilizan promotores, señales de poliadenilación y potenciadores.

El ácido nucleico está “unido de forma operativa” cuando está colocado en una relación funcional con otra secuencia de ácido nucleico. Por ejemplo, ADN para una presecuencia o líder secretor está unido de forma operativa a ADN para un polipéptido si éste se expresa como una preproteína que participa en la secreción del polipéptido; un promotor o potenciador está unido de forma operativa a una secuencia codificante si éste afecta a la transcripción de la secuencia; o un sitio de unión al ribosoma está unido de forma operativa a una secuencia codificante si éste está situado para facilitar la traducción. Generalmente, “unido/a de forma operativa” significa que las secuencias de ADN que están siendo unidas son contiguas y, en el caso de un líder secretor, contiguas y en fase de lectura. Sin embargo, los potenciadores no tienen que ser contiguos. La unión se consigue mediante ligamiento en sitios de restricción convenientes. Si dichos sitios no existen, los adaptadores o enlazadores de oligonucleótidos sintéticos se usan de acuerdo con la práctica convencional.

La “rigurosidad” de las reacciones de hibridación es fácilmente determinable por un experto en la materia y generalmente es un cálculo empírico dependiente de la longitud de la sonda, la temperatura de lavado y la concentración de sal. En general, las sondas más largas requieren temperaturas más elevadas para hibridación apropiada, mientras que las sondas más cortas necesitan temperaturas más bajas. La hibridación generalmente depende de la capacidad del ADN desnaturalizado para rehibridarse cuando hebras complementarias están presentes en un entorno por debajo de su temperatura de fusión. Cuanto mayor sea el grado de homología deseada entre la sonda y la secuencia de hibridación, mayor será la temperatura relativa que puede usarse. Como resultado, es lógico que temperaturas relativas más elevadas tenderían a hacer las condiciones de la reacción más rigurosas, mientras que temperaturas más bajas lo harían menos. Para detalles adicionales y explicación de rigurosidad de las reacciones de hibridación, véase el documento Ausubel et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995). “Condiciones rigurosas” o “condiciones de alta rigurosidad”, tal como se definen en el presente documento, pueden ser identificadas por aquellos que: (1) emplean baja fuerza iónica y alta temperatura para el lavado, por ejemplo cloruro sódico 0,015 M /citrato sódico 0,0015 M /dodecil sulfato sódico al 0,1 % a 50°C; (2) emplean durante hibridación un agente desnaturalizante, tal como formamida, por ejemplo, formamida al 50 % (v/v) con albúmina de suero bovino al 0,1 %/Ficoll al 0,1 %/polivinilpirrolidona al 0,1 %/tampón fosfato sódico 50 mM a pH 6,5 con cloruro sódico 750 mM, citrato sódico 75 mM a 42C; o (3) emplean formamida al 50 %, 5 x SSC (NaCl 0,75 M, citrato sódico 0,075 M), fosfato sódico 50 mM (pH 6,8), pirofosfato sódico al 0,1 %, 5 x solución de Denhardt, ADN de esperma de salmón sonicado (50 µg/ml), SDS al 0,1 % y sulfato de dextrano 10 % a 42°C, con lavados a 42°C en 0,2 x SSC (cloruro sódico/citrato sódico) y formamida al 50 % a 55°C, seguido por un lavado a alta rigurosidad constituido por 0,1 x SSC que contiene EDTA a 55°C. “Condiciones moderadamente rigurosas” pueden identificarse según lo descrito por Sambrook et al., Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, e incluyen el uso de solución de lavado y condiciones de hibridación (por ejemplo, temperatura, fuerza iónica y %SDS) menos rigurosas que las descritas anteriormente. Un ejemplo de condiciones moderadamente rigurosas es incubación durante una noche a 37°C en una solución que comprende: formamida al 20 %, 5 x SSC (NaCl 150 mM, citrato trisódico 15 mM), fosfato sódico 50 mM (pH 7,6), 5 x solución de Denhardt, sulfato de dextrano al 10 % y 20 mg/ml de ADN de esperma de salmón sometido a cizalla desnaturalizado, seguido por lavar los filtros en 1 x SSC a aproximadamente 37-50°C. El experto en la materia reconocerá cómo ajustar la temperatura, la fuerza iónica, etc., según sea necesario para adaptarse a factores tales como la longitud de la sonda y similares. El término “variable” en el contexto de dominio variable de anticuerpos, se refiere al hecho de que ciertas partes de los dominios variables difieren ampliamente en secuencia entre anticuerpos y se usan en la unión y especificidad de cada anticuerpo particular por su diana particular. Sin embargo, la variabilidad no está distribuida uniformemente a través de los dominios variables de anticuerpos. Se concentra en tres segmentos llamados regiones determinantes de la complementariedad (CDR) también conocidas como regiones hipervariables (HVR) en los dominios variables tanto de la cadena ligera como de la cadena pesada. Las partes más altamente conservadas de dominios variables se denominan marco (FR). Los dominios variables de cadenas pesada y ligera nativas comprende, cada uno, cuatro regiones FR, adoptando en gran medida una configuración de lámina β, conectada por tres CDR, que forman bucles que conectan y en algunos casos forman parte de, la estructura de lámina β. Las CDR en cada cadena se mantienen juntas en estrecha proximidad mediante las regiones FR y, con las CDR de la otra cadena, contribuyen a la formación del sitio de unión de anticuerpos diana (véase Kabat et al.). Tal como se usa en el presente documento, la numeración de residuos de aminoácidos de inmunoglobulina se realiza de acuerdo con el sistema de numeración de residuos de aminoácidos de inmunoglobulina de Kabat et al., (Sequences of Proteins of Immunological Interest, National Institute of Health, Bethesda, Md. 1987), a menos que se indique lo contrario. La expresión “región hipervariable”, “HVR” o “HV”, cuando se usa en el presente documento se refiere a las regiones de un dominio variable de anticuerpo que son hipervariables en secuencia y/o forman bucles definidos estructuralmente. Generalmente, los anticuerpos comprenden seis regiones hipervariables; tres en la VH (H1, H2, H3) y tres en la VL (L1, L2, L3). Están en uso una serie de delineaciones de la región hipervariable y están todas abarcadas en el presente documento. Las regiones determinantes de la complementariedad (CDR) de Kabat se basan en la variabilidad de secuencia y son las usadas más habitualmente (Kabat et al., Sequences of Proteins of Immunological Interest, 5ª Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia se refiere, en su lugar, a la ubicación de los bucles estructurales (Chothia y Lesk J. Mol. Biol. 196:901-917 (1987)). El extremo del bucle CDR-H1 de Chothia, cuando numera usando la convención de numeración de Kabat varía entre H32 y H34 dependiendo de la longitud del bucle (esto es porque el esquema de numeración de Kabat coloca las inserciones en H35A y H35B; si ni 35A ni 35B están presentes, el bucle termina en 32; si solamente 35A está presente, el bucle termina en 33; si tanto 35A como 35B están presentes, el bucle termina en 34). Las regiones hipervariables de AbM representan un compromiso las CDR de Kabat y los bucles estructurales de Chothia y son usados por el software de modelado de anticuerpos AbM de Oxford Molecular. Las regiones hipervariables de “contacto” se basan en un análisis de las estructuras cristalinas complejas disponibles. Los residuos de cada una de estas regiones hipervariables se indican a continuación.

Bucle Kabat AbM Chothia Contacto L1 L24-L34 L24-L34 L24-L34 L30-L36 L2 L50-L56 L50-L56 L50-L56 L46-L55 L3 L89-L97 L89-L97 L89-L97 L89-L96 H1 H31-H35B H26-H35B H26-H32..34 H30-H35B (Numeración de Kabat) H1 H31-H35 H26-H35 H26-H32 H30-H35 (Numeración de Chothia) H2 H50-H65 H50-H58 H52-H56 H47-H58 H3 H95-H102 H95-H102 H95-H102 H93-H101 Las regiones hipervariables pueden comprender “regiones hipervariables extendidas” de la siguiente manera: 24-36 o 24-34 (L1), 46-56 o 50-56 (L2) y 89-97 (L3) en la VL y 26-35B (H1), 50-65, 47-65 o 49-65 (H2) y 93-102, 94-102 o 95-102 (H3) en la VH. Los residuos del dominio variable se numeran de acuerdo con Kabat et al., más arriba para cada una de estas definiciones. Los residuos del “marco” o “FR” son aquellos residuos del dominio variable diferentes de los residuos de la región hipervariable o residuos de la CDR definidos en el presente documento.

La expresión “numeración de residuos del dominio variable como en Kabat” o “numeración de la posición de aminoácidos como en Kabat” y variaciones de las mismas, se refieren al sistema de numeración usado para dominios variables de cadena pesada o dominios variables de cadena ligera de la compilación de anticuerpos en Kabat et al., Sequences of Proteins of Immunological Interest, 5ª Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991). Usando este sistema de numeración, la secuencia de aminoácidos lineal real puede contener menos o más aminoácidos correspondientes a un acortamiento de, o inserción en, un FR o CDR del dominio variable. Por ejemplo, un dominio variable de cadena pesada puede incluir un inserto de un solo aminoácido (residuo 52a de acuerdo con Kabat) después del residuo 52 de H2 y residuos insertados (por ejemplo residuos 82a, 82b y 82c, etc., de acuerdo con Kabat) después del residuo del FR de la cadena pesada. La numeración de Kabat de residuos puede determinarse para un anticuerpo dado mediante alineamiento en regiones de homología de la secuencia del anticuerpo con una secuencia numerada por Kabat “convencional”. El sistema de numeración de Kabat se usa generalmente cuando se refiere a un residuo en el dominio variable (aproximadamente los residuos 1-107 de la cadena ligera y los residuos 1-113 de la cadena pesada) (por ejemplo, Kabat et al., Sequences of Immunological Interest. 5ª Ed. Public Health). El “sistema de numeración EU” o “índice de la EU” se usa generalmente cuando se refiere a un residuo en una región constante de cadena pesada de inmunoglobulina (por ejemplo, el índice de la EU notificado en Kabat et al., más arriba; la región bisagra del dominio constante de cadena pesada es aproximadamente los residuos 216-230 (numeración EU) de la cadena pesada). El “índice EU como en Kabat” se refiere a la numeración de residuos del anticuerpo Eu de IgG1 humana. A menos que se indique lo contrario en el presente documento, las referencias a números de residuos en el dominio variable de anticuerpos significan numeración de residuos mediante el sistema de numeración de Kabat. A menos que se indique lo contrario en el presente documento, las referencias a números de residuos en el dominio constante de anticuerpos significa numeración de residuos mediante el sistema de numeración de EU (por ejemplo, véase la solicitud provisional de los Estados Unidos n.º 60/640.323, Figures for EU numbering).

Tal como se usa en el presente documento, “polipéptido” se refiere, en general, a péptidos y proteínas que tienen más de aproximadamente diez aminoácidos. En un ejemplo, el polipéptido es una proteína de mamífero, cuyos ejemplos incluyen Factor D y fragmentos y/o variantes de Factor D. En otro ejemplo, el polipéptido es un anticuerpo de longitud completa, o fragmento de anticuerpo del mismo (por ejemplo fragmento de unión al antígeno), que se une al Factor D humano, cuyos ejemplos incluyen fragmentos Fab, Fab', F(ab')2 y Fγ; diacuerpos, anticuerpos lineales; moléculas de anticuerpo de cadena sencilla; y anticuerpos multiespecíficos formados a partir de fragmentos de anticuerpo (por ejemplo fragmento de unión al antígeno). Una “variante” o “variante de secuencia de aminoácidos” de un polipéptido de partida es un polipéptido que comprende una secuencia de aminoácidos diferente de la de los polipéptidos de partida. Generalmente, una variante poseerá al menos el 80 % de identidad de secuencia, preferentemente al menos el 90 % de identidad de secuencia, más preferentemente al menos el 95 % de identidad de secuencia y de la forma más preferente al menos el 98 % de identidad de secuencia con el polipéptido nativo. El porcentaje de identidad de secuencia se determina por ejemplo, mediante la versión de Fitch et al., Proc. Natl. Acad. Sci. EE. UU., 80: 1382-1386 (1983), del algoritmo descrito por Needleman et al., J. Mol. Biol., 48: 443-453 (1970), después de alinear las secuencias para permitir la máxima homología. Pueden prepararse variantes de secuencia de aminoácidos de un polipéptido introduciendo cambios de nucleótidos apropiados en ADN que codifica el polipéptido, o mediante síntesis peptídica. Dichas variantes incluyen, por ejemplo, deleciones de y/o inserciones en y/o sustituciones de, residuos dentro de la secuencia de aminoácidos del polipéptido de interés. Cualquier combinación de deleción, inserción y sustitución se realiza para llegar a la construcción final, siempre que la construcción final posea las características deseadas. Los cambios de aminoácidos también pueden alterar procesos postraduccionales del polipéptido, tales como cambiar el número o la posición de sitios de glucosilación. Los métodos para generar variantes de secuencia de aminoácidos de polipéptidos se describen en la patente de Estados Unidos n.º 5.534.615, por ejemplo.

Una “variante de anticuerpo” o “anticuerpo modificado” de un anticuerpo de partida es un anticuerpo que comprende una secuencia de aminoácidos diferente de la del anticuerpo de partida, en la que uno o más de los residuos de aminoácidos del anticuerpo de partida han sido modificados. Generalmente, una variante de anticuerpo poseerá al menos el 80 % de identidad de secuencia, preferentemente al menos el 90 % de identidad de secuencia, más preferentemente al menos el 95 % de identidad de secuencia y de la forma más preferente al menos el 98 % de identidad de secuencia con el anticuerpo de partida. El porcentaje de identidad de secuencia se determina por ejemplo, mediante la versión de Fitch et al., Proc. Natl. Acad. Sci. EE. UU., 80: 1382-1386 (1983), del algoritmo descrito por Needleman et al., J. Mol. Biol., 48: 443-453 (1970), después de alinear las secuencias del anticuerpo de partida y la variante de anticuerpo candidata para permitir máxima homología. La identidad o similitud con respecto al parental secuenciado se define en el presente documento como el porcentaje de residuos de aminoácidos en la secuencia variante candidata que son idénticas (es decir el mismo residuo) o similar (es decir residuo de aminoácido del mismo grupo basado en propiedades de cadena lateral comunes, véase a continuación) con los residuos del anticuerpo parental, después de alinear las secuencias e introducir huecos, si fuera necesario, para conseguir el máximo porcentaje de identidad de secuencia. Las variantes de secuencia de aminoácidos de un anticuerpo pueden prepararse introduciendo cambios de nucleótidos apropiados en ADN que codifica el anticuerpo, o mediante síntesis peptídica. Dichas variantes incluyen, por ejemplo, deleciones de y/o inserciones en y/o sustituciones de, residuos dentro de la secuencia de aminoácidos del anticuerpo de interés. Cualquier combinación de deleción, inserción y sustitución se realiza para llegar a la construcción final, siempre que la construcción final posea las características deseadas. Los cambios de aminoácidos también pueden alterar procesos postraduccionales del anticuerpo; tales como cambiar el número o la posición de sitios de glucosilación. Los métodos para generar variantes de la secuencia de anticuerpo de anticuerpos son similares a aquellos para generar variantes de secuencia de aminoácidos de polipéptidos descritos en la patente de Estados Unidos n.º 5.634.615, por ejemplo.

Una variante “desamidada” de una molécula de polipéptido es un polipéptido en el que uno o más residuos de asparagina (N o Asn) del polipéptido original se han convertido en aspartato (D o Asp), es decir la cadena lateral de amida neutra se ha convertido en un residuo con un carácter ácido global. La desamidación puede prevenirse convirtiendo asparaginas (N o Asn) en glutamina (Q o Gin) o alanina (A o Ala) o serina (S o Ser) (Amphlett, G. et al., Pharm. Biotechnol., 9: 1-140 (1996)).

Una variante “oxidada” de una molécula de polipéptido es un polipéptido en el que uno o más residuos de metionina (M o Met) o triptófano (W o Trp) del polipéptido original se han convertido en sulfona o sulfóxido mediante el azufre de la metionina. La oxidación puede prevenirse convirtiendo la metionina (M o Met) en leucina (L o Leu) o isoleucina (I o Ile) (Amphlett, G. et al., Pharm. Biotechnol., 9: 1-140 (1996)).

Una variante de “piroglutamato” de una molécula de polipéptido es un polipéptido en el que uno o más residuos de glutamina (Q o Gln) del polipéptido original se han convertido en piroglutamato, lo que se produce cuando residuos de glutamina, por ejemplo residuos de glutamina N-terminales, se ciclan espontáneamente dando como resultado piroglutamato. La conversión en piroglutamato puede prevenirse convirtiendo un residuo o residuos de glutamina (Q o Gln)) en glutamato (E o Glu) (Amphlett, G. et al., Pharm. Biotechnol., 9: 1-140 (1996)). La expresión “fragmento de anticuerpo” se refiere a una parte de un anticuerpo de longitud completa, generalmente la región de unión a la diana o variable. Los ejemplos de fragmentos de anticuerpo incluyen fragmentos Fab, Fab', F(ab')2 y Fv. La frase “fragmento o análogo funcional” de un anticuerpo es un compuesto que tiene actividad biológica cualitativa en común con un anticuerpo de longitud completa. Por ejemplo, un fragmento o análogo funcional de un anticuerpo anti-Factor D humano es uno que puede unirse al Factor D de tal manera que previene o reduce sustancialmente la activación del complemento. Tal como se usa en el presente documento, “fragmento funcional” con respecto a anticuerpos, se refiere a fragmentos Fv, F(ab) y F(ab')2. Un fragmento “Fv” es el fragmento de anticuerpo mínimo que contiene un sitio de reconocimiento y unión a la diana completo. Esta región consta de un dímero de un dominio variable de cadena pesada y uno de cadena ligera en estrecha asociación, no covalente (dímero VH-VL). Es en esta configuración en la que las tres CDR de cada dominio variable interactúan para definir un sitio de unión a la diana en la superficie del dímero VH-VL. Colectivamente, las seis CDR otorgan especificidad de unión a la diana al anticuerpo. Sin embargo, incluso un único dominio variable (o la mitad de un Fv que comprende solamente tres CDR específicas para una diana) tiene la capacidad de reconocer y unirse a la diana. Los fragmentos de anticuerpo “Fv de cadena sencilla” o “sFv” comprenden los dominios VH y VL de un anticuerpo, en los que estos dominios están presentes en una única cadena polipeptídica. Generalmente, el polipéptido Fv comprende además un enlazador polipeptídico entre los dominios VH y VL lo que permite al sFv formar la estructura deseada para unión a la diana.

El fragmento Fab contiene el dominio constante de la cadena ligera y el primer dominio constante (CH1) de la cadena pesada. Los fragmentos Fab' difieren de los fragmentos Fab por la adición de unos pocos residuos en el extremo carboxilo del dominio de cadena pesada CH1 incluyendo una o más cisteínas de la región bisagra del anticuerpo. Los fragmentos F(ab') se producen mediante escisión del puente disulfuro en las cisteínas bisagra del producto de digestión con pepsina de F(ab')2. Los acoplamientos químicos adicionales de fragmentos de anticuerpo (por ejemplo fragmentos de unión al antígeno) son conocidos por los expertos en la materia. Tal como se usa en el presente documento, “biblioteca” se refiere a una pluralidad de secuencias de anticuerpos o fragmentos de anticuerpo (por ejemplo, polipéptidos de la invención), o los ácidos nucleicos que codifican estas secuencias, siendo las secuencias diferentes en la combinación de aminoácidos variantes que se introducen en estas secuencias de acuerdo con los métodos de la invención.

La expresión “anticuerpo monoclonal”, tal como se usa en el presente documento, se refiere a un anticuerpo obtenido de una población de anticuerpos sustancialmente homogéneos, es decir, los anticuerpos individuales que componen la población son idénticos excepto por posibles mutaciones de origen natural que pueden estar presentes en cantidades menores. Los anticuerpos monoclonales son altamente específicos, estando dirigidos contra un único sitio diana. Además, en contraste con preparaciones de anticuerpos convencionales (policlonales) que normalmente incluyen diferentes anticuerpos dirigidos contra diferentes determinantes (epítopos), cada anticuerpo monoclonal está dirigido contra un único determinante en la diana. Además de su especificidad, los anticuerpos monoclonales son ventajosos en que pueden ser sintetizados por el cultivo de hibridoma, no contaminado por otras inmunoglobulinas. El modificador “monoclonal” indica el carácter del anticuerpo como el obtenido de una población sustancialmente homogénea de anticuerpos y no debe interpretarse que requiere la producción del anticuerpo mediante ningún método particular. Por ejemplo, los anticuerpos monoclonales para uso con la presente invención pueden aislarse de bibliotecas de anticuerpos en fagos usando técnicas bien conocidas. Los anticuerpos monoclonales parentales a usar de acuerdo con la presente invención pueden prepararse mediante el método de hibridoma descrito por primera vez por Kohler y Milstein, Nature 256, 495 (1975), o pueden prepararse mediante métodos recombinantes. Las formas “humanizadas” de anticuerpos no humanos (por ejemplo murinos) son inmunoglobulinas quiméricas, cadenas de inmunoglobulina o fragmentos de las mismas (tales como Fv, Fab, Fab', F(ab')2 u otras subsecuencias de unión a la diana de anticuerpos) que contienen secuencias mínimas derivadas de inmunoglobulinas no humanas.

En general, el anticuerpo humanizado comprenderá sustancialmente todos de al menos uno y normalmente dos, dominios variables, en los que todas o sustancialmente todas las regiones CDR corresponden a las de una inmunoglobulina no humana y todas o sustancialmente todas las regiones FR son las de una secuencia consenso de inmunoglobulina humana. El anticuerpo humanizado también puede comprender al menos una parte de una región constante (Fc) de inmunoglobulina, normalmente la de una plantilla de inmunoglobulina humana seleccionada.

Los términos “célula”, “línea celular” y “cultivo celular” incluyen la progenie. Se entiende también que no toda la progenie puede ser idéntica de forma precisa en contenido de ADN, debido a mutaciones deliberadas o involuntarias. Una progenie variante que tiene la misma función o propiedad biológica, según lo cribado en la célula transformada originalmente, está incluida. Las “células hospedadoras” usadas en la presente invención generalmente son huéspedes procariotas o eucariotas. El término “vector” significa una construcción de ADN que contiene una secuencia de ADN que está unida de forma operativa a una secuencia de control adecuada capaz de efectuar la expresión del ADN en un hospedador adecuado. Dichas secuencias de control incluyen un promotor para efectuar la transcripción, una secuencia operadora opcional para controlar dicha transcripción, una secuencia que codifica sitios de unión al ribosoma de ARNm adecuados y secuencias que controlan la terminación de la transcripción y la traducción. El vector puede ser un plásmido, una partícula de fago, o simplemente un inserto genómico potencial. Una vez transformado en un hospedador adecuado, el vector puede replicarse y funcionar independientemente del genoma del hospedador o puede, en algunos casos, integrarse en el propio genoma. En la presente memoria descriptiva, “plásmido” y “vector” se usan algunas veces de forma intercambiable, dado que el plásmido es la forma de vector usada más habitualmente. Sin embargo, la invención pretende incluir otras formas de vectores que sirven para una función equivalente y que son, o se vuelven, conocidas en la técnica. La palabra “marca” cuando se usa en el presente documento se refiere a un compuesto o composición detectable que puede estar conjugada directa o indirectamente a una molécula o proteína, por ejemplo, un anticuerpo. La marca puede ser, a su vez, detectable (por ejemplo, marcas con radioisótopo o marcas fluorescentes) o, en el caso de una marca enzimática, puede catalizar la alteración química de un compuesto o composición de sustrato que es detectable.

Tal como se usa en el presente documento, “fase sólida” significa una matriz no acuosa a la que el anticuerpo de la presente invención puede adherirse. Los ejemplos de fases sólidas abarcadas en el presente documento incluyen aquellas formadas parcial o totalmente por vidrio (por ejemplo vidrio de poro controlado), polisacáridos (por ejemplo, agarosa), poliacrilamidas, poliestireno, alcohol polivinílico y siliconas. En ciertas realizaciones, dependiendo del contexto, la fase sólida puede comprender el pocillo de una placa de ensayo; en otras se trata de una columna de purificación (por ejemplo una columna de cromatografía por afinidad). La “presentación en fagos” es una técnica mediante la cual polipéptidos variantes se presentan como proteínas de fusión en al menos una parte de proteína de revestimiento en la superficie de partículas de fago, por ejemplo, fago filamentoso. Una utilidad de la presentación en fagos reside en el hecho de que grandes bibliotecas de variantes de proteínas aleatorizadas pueden clasificarse rápida y eficazmente para aquellas secuencias que se unen a un antígeno diana con alta afinidad. La presentación de bibliotecas de péptidos y proteínas en fagos se ha usado para cribar millones de polipéptidos en busca de unos con propiedades de unión específicas. Se han usado métodos de presentación en fagos polivalentes para presentar pequeños péptidos aleatorios y pequeñas proteínas a través de fusiones al gen III o el gen VIII del fago filamentoso. Wells y Lowman (1992) Curr. Opin. Struct. Biol. 3: 355-362 y referencias mencionadas en ese documento. En una presentación en fagos monovalentes, una biblioteca de proteínas o péptidos se fusiona con un gen III o una parte del mismo y se expresa a bajos niveles en presencia de la proteína del gen III de tipo silvestre, de modo que las partículas de fago presenten una copia o ninguna de las proteínas de fusión. Los efectos de avidez se reducen con respecto al fago polivalente de modo que la clasificación es tomando como base la afinidad por el ligando intrínseco y se usan vectores de fagémidos, que simplifican las manipulaciones de ADN. Lowman y Wells (1991) Methods: A companion to Methods in Enzymology 3: 205-0216.

Un “fagémido” es un vector plasmídico que tiene un origen de replicación bacteriano, por ejemplo, Co1E1 y una copia de una región intergénica de un bacteriófago. El fagémido puede usarse en cualquier bacteriófago conocido, incluyendo bacteriófago filamentoso y bacteriófago lambdoide. El plásmido también contendrá generalmente un marcador seleccionable para resistencia a antibióticos. Los segmentos de ADN clonados en estos vectores pueden propagarse como plásmidos. Cuando células que albergan estos vectores están provistas de todos los genes necesarios para la producción de partículas de fagos, el modo de replicación del plásmido cambia a replicación en círculo rodante para generar copias de una hebra del ADN del plásmido y empaquetar partículas de fago. El fagémido puede formar partículas de fago infecciosas o no infecciosas. Este término incluye fagémidos que contienen un gen de proteína de revestimiento del fago o fragmento del mismo enlazado a un gen de polipéptido heterólogo como una fusión génica de modo que el polipéptido heterólogo se presente en la superficie de la partícula de fago. Una “región Fc variante” comprende una secuencia de aminoácidos que difiere de la de otra región Fc en virtud de al menos una “modificación de aminoácidos” tal como se define en el presente documento. Preferentemente, la región Fc variante tiene al menos una sustitución de aminoácidos en comparación con una región Fc de secuencia nativa o con la región Fc de un polipéptido parental, por ejemplo de aproximadamente una a aproximadamente diez sustituciones de aminoácidos y preferentemente de aproximadamente una a aproximadamente cinco sustituciones de aminoácidos en una región Fc de secuencia nativa o en la región Fc del polipéptido parental. La región Fc variante en el presente documento poseerá preferentemente al menos aproximadamente el 80 % de homología con una región Fc de secuencia nativa y/o con una región Fc de un polipéptido parental y de la forma más preferente al menos aproximadamente el 90 % de homología con éste, más preferentemente al menos aproximadamente el 95 % de homología con éste. Los ejemplos de “regiones Fc humanas de secuencia nativa” se muestran en la figura 23 del documento WO 00/42072 e incluyen una región Fc de IgG1 humana de secuencia nativa (alotipos no A y A); región Fc de IgG2 humana de secuencia nativa; región Fc de IgG3 humana de secuencia nativa; y región Fc de IgG4 humana de secuencia nativa, así como variantes de las mismas de origen natural. Regiones Fc murinas de secuencia nativa se muestran en la figura 22A del documento WO 00/42072. De acuerdo con esta invención, afinidad de unión a FcRn “alterada” es una que tiene afinidad de unión a FcRn potenciada o disminuida en comparación con un polipéptido parental o con un polipéptido que comprende una región Fc de secuencia nativa. En un ejemplo, el anticuerpo con afinidad de unión a FcRn alterada presenta unión incrementada a FcRn a pH 6,0 y/o unión disminuida a FcRn a pH 7,0. La variante que “presenta unión incrementada” a una FcR se une a al menos una FcR con mejor adicional que el polipéptido parental. La variante que “presenta unión disminuida” a una FcR, se une a al menos una FcR con peor afinidad que un polipéptido parental. La variante que se une a una FcR con “mejor afinidad” que un polipéptido parental, es una que se une a una FcR con sustancialmente mejor afinidad de unión que el anticuerpo parental, cuando las cantidades de variante de polipéptido y polipéptido parental en el ensayo de unión son esencialmente las mismas. Por ejemplo, la variante de polipéptido con afinidad de unión a FcR mejorada puede presentar de aproximadamente 1,15 veces a aproximadamente 100 veces, por ejemplo de aproximadamente 1,2 veces a aproximadamente 50 veces de mejora en la afinidad de unión a FcR en comparación con el polipéptido parental, en donde se determina la afinidad de unión a FcR. Una “modificación de aminoácidos” se refiere a un cambio en la secuencia de aminoácidos de una secuencia de aminoácidos predeterminada. Las modificaciones ejemplares incluyen una sustitución, inserción y/o deleción de aminoácidos. Un ejemplo de una modificación de aminoácidos en el presente documento es una sustitución.

Una “modificación de aminoácidos en” una posición especificada, por ejemplo de la región Fc, se refiere a la sustitución o deleción de los residuos especificados, o la inserción de al menos un residuo de aminoácidos adyacente al residuo especificado. Por inserción “adyacente” a un residuo especificado se entiende inserción a uno o dos residuos del mismo. La inserción puede ser N-terminal o C-terminal al residuo especificado.

Una “sustitución de aminoácidos” se refiere al reemplazo de al menos un residuo de aminoácido existente en una secuencia de aminoácidos predeterminada por otro residuo de aminoácido “de reemplazo” diferente. El residuo o residuos de reemplazo pueden ser “residuos de aminoácidos de origen natural” (es decir, codificados por el código genético) y seleccionado entre el grupo constituido por: alanina (ala); arginina (Arg); asparagiria (Asn); ácido aspártico (Asp); cisteína (Cys); glutamina (Gln); ácido glutámico (Glu); glicina (Gly), histidina (His); isoleucina (Ile); leucina (Leu); lisina (Lys); metionina (Met); fenilalanina (Phe); prolina (Pro); serina (Ser); treonina (Thr); triptófano (Trp); tirosina (Tyr); y valina (Val). La sustitución por uno o más residuos de aminoácidos de origen no natural también está abarcada por la definición de una sustitución de aminoácidos en el presente documento. Un “residuo de aminoácido de origen no natural” se refiere a un residuo, diferente de los residuos de aminoácidos de origen natural enumerados anteriormente, que es capaz de unirse covalentemente a un residuo o residuos de aminoácidos adyacentes en una cadena polipeptídica. Los ejemplos de residuos de aminoácidos de origen no natural incluyen norleucina, ornitina, norvalina, homoserina y otros análogos de residuos de aminoácidos tales como los descritos en Ellman et al., Meth. Enzym, 202: 301-336 (1991). Para generar dichos residuos de aminoácidos de origen no natural, pueden usarse los procedimientos de Noren et al., Science, 244: 182 (1989) y Ellman et al.; más arriba. En resumen, estos procedimientos implican activar químicamente un ARNt supresor con un residuo de aminoácido de origen no natural seguido por transcripción y traducción in vitro del ARN. Una “inserción de aminoácidos” se refiere a la incorporación de al menos un aminoácido en una secuencia de aminoácidos predeterminada. Aunque la inserción constará habitualmente la inserción de uno o dos residuos de aminoácidos, la presente solicitud contempla “inserciones de péptidos” más grandes, por ejemplo inserción de aproximadamente tres a aproximadamente cinco o incluso hasta aproximadamente diez residuos de aminoácidos. El residuo o residuos insertados pueden ser de origen natural o de origen no natural, tal como se ha desvelado anteriormente. Una “deleción de aminoácidos” se refiere a la eliminación de al menos un residuo de aminoácido de una secuencia de aminoácidos predeterminada. II. Descripción detallada En el presente documento se describen antagonistas del Factor D, que incluye anticuerpos anti-Factor D y variantes de los mismos y fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) útiles para la prevención y el tratamiento de afecciones asociadas al complemento, incluyendo afecciones oculares (todas las afecciones y enfermedades oculares cuya patología implica al complemento, incluyendo las rutas clásica y alternativa y en particular la ruta alternativa del complemento), tales como, por ejemplo, enfermedades maculares degenerativas, tales como todas las fases de degeneración macular asociada a la edad (DMAE), incluyendo formas seca y húmeda (no exudativa y exudativa), neovascularización coroidea (NVC), uveitis, retinopatía diabética y otras asociadas a isquemia, endoftalmitis y otras enfermedades neovasculares intraoculares, tales como edema macular diabético, miopía patológica, enfermedad de von Hippel-Lindau, histoplasmosis del ojo, oclusión de la vena central de la retina (OVCR), neovascularización corneal y neovascularización retiniana. Un grupo de afecciones oculares asociadas con el complemento incluye degeneración macular asociada a la edad (DMAE), incluyendo no exudativa (por ejemplo DMAE seca intermedia o atrofia geográfica (AG)) y exudativa) (por ejemplo DMAE húmeda (neovascularización coroidea (NVC)) DMAE, retinopatía diabética (RD), endoftalmitis y uveitis. En un ejemplo, la afección ocular asociada al complemento es DMAE seca intermedia. En un ejemplo, la afección ocular asociada al complemento es atrofia geográfica. En un ejemplo, la afección ocular asociada al complemento es DMAE húmeda (neovascularización coroidea (NVC)).

La DMAE es degeneración de la mácula asociada a la edad, que es la causa principal de disfunción visual irreversible de individuos por encima de los 60 años, existen dos tipos de DMAE, DMAE no exudativa (seca) y exudativa (húmeda). La forma seca, o no exudativa, implica cambios atrófica e hipertróficos en el epitelio retiniano pigmentario (ERP) que subyace a la retina central (mácula) así como depósitos (drusas) en el ERP. Los pacientes con DMAE no oxidativa pueden evolucionar a la forma húmeda, o exudativa, de DMAE, en el que vasos sanguíneos anormales llamados membranas neovasculares coroideas (CNVM) se desarrollan bajo la retina; tienen fugas de fluido y sangre y finalmente causan una cicatriz en forma de disco cegadora en y debajo de la retina. La DMAE no exudativa, que habitualmente es un precursor de DMAE exudativa, es más habitual. La presentación de DMAE no exudativa varía: drusas duras, drusas blandas, atrofia geográfica del ERP y aglutinación de pigmentos pueden estar presentes. Los componentes del complemento se depositan sobre el ERP temprano en la DMAE y son constituyentes fundamentales de las drusas. 1. Anticuerpos anti-Factor D humanizados

En el presente documento se describe la producción y el uso de anticuerpos anti-Factor D humanizados y fragmentos de los mismos. En las siguientes secciones se describen métodos ejemplares para generar anticuerpos con más detalle. Los métodos para humanizar anticuerpos no humanos son bien conocidos en la técnica. Generalmente, un anticuerpo humanizado tiene uno o más residuos de aminoácidos introducidos en él de una fuente que es no humana. Estos residuos de aminoácidos no humanos se denominan a menudo como residuos “de importación”, que son tomados normalmente de un dominio variable “de importación”. La humanización puede realizarse esencialmente después del método de Winter y colaboradores [Jones et al., Nature, 321: 522-525 (1986); Riechmann et al., Nature, 332: 823-327 (1988); Verhoeyen et al., Science, 239: 1534-1536 (1988)], sustituyendo las CDR o secuencias de CDR de roedor a las secuencias correspondientes de un anticuerpo humano. Por consiguiente, dichos anticuerpos “humanizados” son anticuerpos quiméricos (patente de Estados Unidos n.º 4.816.567), en los que sustancialmente menos de un dominio variable humano intacto ha sido sustituido por la secuencia correspondiente de una especie no humana. En la práctica, anticuerpos humanizados son normalmente anticuerpos humanos en los que algunos residuos de la CDR y posiblemente algunos residuos de la FR son sustituidos por residuos de sitios análogos en anticuerpos de roedor.

La elección de dominios variables humanos, tanto ligeros como pesados, que se usarán en la preparación de los anticuerpos humanizados puede ser en algunos casos be importante para reducir la antigenicidad y/o la respuesta HAMA (anticuerpo anti-ratón humano) cuando el anticuerpo está destinado a uso terapéutico humano. La reducción o la eliminación de una respuesta HAMA es generalmente un aspecto significativo del desarrollo clínico de agentes terapéuticos adecuados. Véase, por ejemplo, Khaxzaeli et al., J. Natl. Cancer Inst. (1988), 80: 937; Jaffers et al., Transplantation (1986), 41: 572; Shawler et al., J. Immunol. (1985), 135: 1530; Sears et al., J. Biol. Response Mod. (1984), 3: 138; Miller et al., Blood (1983), 62: 988; Hakimi et al., J. Immunol. (1991), 147: 1352; Reichmann et al., Nature (1988), 332: 323; Junghans et al., Cancer Res. (1990), 50: 1495. Tal como se describe en el presente documento, la invención proporciona anticuerpos que son humanizados de modo que la respuesta HAMA se reduce o elimina. Pueden obtenerse además variantes de estos anticuerpos usando métodos rutinarios conocidos en la técnica, algunos de los cuales se describen adicionalmente a continuación. De acuerdo con el método llamado “del mejor ajuste”, la secuencia del dominio variable de un anticuerpo de roedor es cribada contra toda la biblioteca de secuencias de dominios variables humanos conocidas. La secuencia del dominio V humano que es la más cercana a la del roedor se identifica y la región marco humana (FR) dentro de ésta se acepta para el anticuerpo humanizado (Sims et al., J. Immunol. 151: 2296 (1993); Chothia et al., J. Mol. Biol., 196: 901 (1987)). Otro método usa una región marco particular derivada de la secuencia consenso de todos los anticuerpos humanos de un subgrupo particular de cadenas ligeras o pesadas. Puede usarse el mismo marco para varios anticuerpos humanizados diferentes (Carter et al., Proc. Natl. Acad. Sci. EE. UU., 89: 4285 (1992); Presta et al., J. Immunol. 151: 2623 (1993)).

Por ejemplo, una secuencia de aminoácidos de un anticuerpo tal como se describe en el presente documento puede servir como secuencia de partida (parental) para diversificación de las secuencias marco y/o e hipervariable. Una secuencia marco seleccionada a la que está unida una secuencia hipervariable de partida se denomina en el presente documento como marco humano aceptor. Aunque los marcos humanos aceptores pueden ser de, o derivarse de, una inmunoglobulina humana (las regiones VL y/o VH de la misma), los marcos humanos aceptores pueden ser de, o derivarse de, una secuencia marco consenso humana dado que se ha demostrado que dichos marcos tienen una inmunogenicidad mínima, o ninguna, en pacientes humanos. Un “marco humano aceptor” para los fines del presente documento es un marco que comprende la secuencia de aminoácidos de un marco VL o VH derivado de un marco de inmunoglobulina humana, o de un marco consenso humano. Un marco humano aceptor “derivado de” un marco de inmunoglobulina humana o marco consenso humano puede comprender la misma secuencia de aminoácidos del mismo, o puede contener cambios en la secuencia de aminoácidos preexistentes. Cuando cambios de aminoácidos preexistentes están presentes, preferentemente no más de 5 y preferentemente 4 o menos, o 3 o menos, cambios de aminoácidos preexistentes están presentes. El marco humano aceptor de VH puede ser idéntico en secuencia a la secuencia marco VH de inmunoglobulina humana o la secuencias marco consenso humanas. El marco humano aceptor VL puede ser idéntico en secuencia a la secuencia marco VL de inmunoglobulina humana o secuencia marco consenso humana. Un “marco consenso humano” es un marco que representa el residuo de aminoácido que aparece más habitualmente en una selección de secuencias marco VL o VH de inmunoglobulina humana. Generalmente, la selección de secuencias VL o VH de inmunoglobulina humana es de un subgrupo de secuencias de dominio variable. Generalmente, el subgrupo de secuencias es un subgrupo como en Kabat et al. Para la VL, el subgrupo puede ser el subgrupo kappa I como en Kabat et al. Para la VH, el subgrupo puede ser el subgrupo III como en et al. Cuando el aceptor se deriva de una inmunoglobulina humana, puede seleccionarse opcionalmente una secuencia marco humana que se selecciona basado en su homología con la secuencia marco donadora alineando la secuencia marco donadora con diversas secuencias marco humanas en una colección de secuencias marco humanas y seleccionar la secuencia marco más homóloga como aceptor. El marco humano aceptor puede ser o derivar de secuencias de la línea germinal de anticuerpos humanos disponibles en las bases de datos públicas. Los marcos consenso humanos puede ser, o derivar de, secuencias marco consenso del subgrupo VII de VH y/o del subgrupo I de VL kappa.

La plantilla del marco humano usada para la generación de un anticuerpo anti-Factor D puede comprender secuencias marco de una plantilla que comprende una combinación de VI-4.1b+ (familia VH7) y JH4d para la cadena VH y/o una combinación de DPK4 (familia Vκl) y JK2 para la cadena VL.

Tal como se describe en el presente documento, el marco humano aceptor e VH puede comprender una, dos, tres o todas de las siguientes secuencias marco: FR1 que comprende QVQLVQSGPELKKPGASVKVSCKAS (aminoácidos 1-25 de la SEC ID Nº: 2), FR2 que comprende WVRQAPGQGLE (aminoácidos 36-49 de la SEC ID Nº: 2), FR3 que comprende RFVFSLDTSVSTAYLQISSLKAEDTAVYYCER (aminoácidos 67-98 de la SEC ID Nº: 2), RFVFSLDTSVSTAYLQISSLKAEDTAVYYCE (aminoácidos 67-97 de la SEC ID Nº: 2), RFVFSLDTSVSTAYLQISSLKAEDTAVYYC (aminoácidos 67-96 de la SEC ID Nº: 2), RFVFSLDTSVSTAYLQISSLKAEDTAVYYCS (SEC ID Nº: 3), o RFVFSLDTSVSTAYLQISSLKAEDTAVYYCSR (SEC ID Nº: 4) FR4 que comprende WGQGTLVTVSS (aminoácidos 105-115 de la SEC ID Nº: 2).

Tal como se describe en el presente documento, el marco humano aceptor de VL puede comprender una, dos, tres o todas de las siguientes secuencias marco: FR1 que comprende DIQVTQSPSSLSASVGDRVTITC (aminoácidos 1-23 de la SEC ID Nº: 1), FR2 que comprende WYQQKPGKVPKLLIS (aminoácidos 35-49 de la SEC ID Nº: 1). FR3 que comprende GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (aminoácidos 57-88 de la SEC ID Nº: 1), FR4 que comprende FGQGTKLEIK (aminoácidos 98-107 de la SEC ID Nº: 1), o FGQGTKVEIK (SEC ID Nº: 5).

Aunque el aceptor puede ser idéntico en secuencia a la secuencia marco humana seleccionada, ya sea ésta de una inmunoglobulina humana o un marco consenso humano, la secuencia del aceptor puede comprender sustituciones de aminoácidos preexistentes con respecto a la secuencia de inmunoglobulina humana o secuencia marco consenso humana. Estas sustituciones preexistentes son preferentemente mínimas; habitualmente diferencias de cuatro, tres, dos o un aminoácido solamente con respecto a la secuencia de inmunoglobulina humana o secuencia marco consenso.

Los residuos de la región hipervariable del anticuerpo no humano están incorporados en los marcos humanos aceptores VL y/o VH. Por ejemplo, se pueden incorporar residuos correspondientes a los residuos de la CDR de Kabat, los residuos del bucle hipervariable de Chothia, los residuos de Abm y/o residuos de contacto. Opcionalmente, se incorporan los residuos de la región hipervariable extendida de la siguiente manera: 24-36 o 24- 34 (L1), 46-56 o 50-56 (L2) y 89-97 (L3), 26-35B (H1), 50-65, 47-65 o 49-65 (H2) y 93-102, 94-102 o 95-102 (H3). En el presente documento se describe un anticuerpo anti-Factor D que comprende un dominio variable de cadena pesada que comprende la SEC ID Nº: 2. En el presente documento se describe un anticuerpo anti-Factor D que comprende un dominio variable de cadena ligera que comprende la SEC ID Nº: 1. En el presente documento se describe un anticuerpo anti-Factor D que comprende un dominio variable de cadena pesada que comprende la SEC ID Nº: 2 y un dominio variable de cadena ligera que comprende la SEC ID Nº: 1. También en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). Un anticuerpo anti-Factor D puede comprender cualquier secuencia de dominio variable marco adecuada, siempre que el anticuerpo conserve la capacidad de unirse al Factor D. Por ejemplo, los anticuerpos anti-Factor D descritos en el presente documento comprenden una secuencia marco del dominio variable de cadena pesada que es una combinación de VI.4.1 b+ y JH4d (Véase la figura 3). Algunos anticuerpos anti-Factor D descritos en el presente documento comprenden una secuencia consenso marco de cadena pesada del subgrupo VII humana. Algunos anticuerpos anti-Factor D descritos en el presente documento comprenden una secuencia marco de dominio variable de cadena pesada que comprende FR1 que comprende los aminoácidos 1-25 de la SEC ID Nº: 2, FR2 que comprende los aminoácidos 36-49 de la SEC ID Nº: 2, FR3 que comprende los aminoácidos 67-98 de la SEC ID Nº: 2 y FR4 que comprende los aminoácidos 105-115 de la SEC ID Nº: 2. La secuencia del dominio variable de cadena pesada comprende una o más substituciones en la posición 40 y/o 88 (numeración de Kabat). La posición 40 es cisteína (C) o alanina (A) y/o la posición 88 es cisteína (C) o alanina (A). Algunos anticuerpos anti-Factor D descritos en el presente documento comprenden una secuencia marco de dominio variable de cadena ligera que es una combinación de DPK4 y JK2 (Véase la figura 4). Algunos anticuerpos anti-Factor D descritos en el presente documento comprenden una secuencia consenso marco de cadena ligera Kappa I (κl) humana. Algunos anticuerpos anti-Factor D descritos en el presente documento comprenden una secuencia marco de dominio variable de cadena ligera que comprende FR1 que comprende los aminoácidos 1-23 de la SEC ID Nº: 1, FR2 que comprende los aminoácidos 35-49 de la SEC ID Nº: 1, FR3 que comprende los aminoácidos 57-88 de la SEC ID Nº: 1 y FR4 que comprende los aminoácidos 98-107 de la SEC ID Nº: 1. La secuencia marco variable de cadena ligera puede comprender una o más sustituciones en la posición 15, 43 y/o 104, (numeración de Kabat). En una realización de estos anticuerpos, la posición 15 es cisteína (C) o Valina (V), la posición 43 es cisteína (C) o alanina (A), la posición 104 es valina (V) o leucina (L). En el presente documento se describe un fragmento de dichos anticuerpos anti- Factor D (por ejemplo fragmentos de unión al antígeno). Además, un anticuerpo anti-Factor D puede comprender cualquier secuencia del dominio constante adecuada, siempre que el anticuerpo conserve la capacidad de unirse al Factor D. Por ejemplo, en algunas realizaciones, los anticuerpos anti-Factor D de la invención comprenden al menos una parte de un dominio constante de cadena pesada. En una realización, los anticuerpos anti-Factor D de la invención comprenden un dominio constante de cadena pesada de una cualquiera o una combinación de una cadena pasada α, δ, ε, γ o µ. Dependiendo de la secuencia de aminoácidos del dominio constante de sus cadenas pesadas (CH), las inmunoglobulinas pueden asignarse a diferentes clases o isotipos. Existen cinco clases de inmunoglobulinas: IgA, IgD, IgE, IgG e IgM, que tienen cadenas pesadas designadas α, δ, ε, γ o µ, respectivamente. Las clases γ y α se dividen además en subclases tomando como base diferencias relativamente menores en la secuencia y la función de CH, por ejemplo, los seres humanos expresan las siguientes subclases: IgG1, IgG2, IgG3, IgG4, IgA1 e IgA2. En una realización, anticuerpos anti-Factor D de la invención comprenden un dominio constante de cadena pesada que comprende sustituciones en posiciones de aminoácidos que dan como resultado un efecto deseado sobre la función efectora (por ejemplo afinidad de unión). En una realización, los anticuerpos anti-Factor D de la invención comprenden un dominio constante de cadena pesada que comprende sustituciones en posiciones de aminoácidos que no dan como resultado un efecto sobre la función efectora (por ejemplo, afinidad de unión). En una realización, los anticuerpos anti-Factor D de la invención comprenden un dominio constante de cadena pesada del tipo IgG (por ejemplo IgG1, IgG2, IgG3 o IgG4) y comprenden además una sustitución en la posición 114 (numeración de Kabat; equivalente a 118 en la numeración EU), 168 (numeración de Kabat; equivalente a 172 en la numeración UE), 172 (numeración de Kabat; equivalente a 176 en la numeración UE) y/o 228 (numeración EU). En una realización, los anticuerpos anti- Factor D de la invención comprenden un dominio constante de cadena pesada del tipo IgG (por ejemplo IgG1, IgG2, IgG3 o IgG4) y comprenden además una sustitución en la posición 114 en la que la posición 114 es una cisteína (C) o alanina (A), la posición 168 es cisteína (C) o alanina (A), la posición 172 es una cisteína (C) o alanina (A) y/o la posición 228 es una prolina (P), arginina (R) o serina (S). En un ejemplo, la invención proporciona un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

Además, los anticuerpos anti-Factor D descritos en el presente documento pueden comprender al menos una parte de un dominio constante de cadena ligera. Los anticuerpos anti-Factor D descritos en el presente documento pueden comprender un dominio constante de cadena ligera de una cualquiera o una combinación de una cadena ligera kappa o lambda, dado que la cadena ligera de cualquier especie de vertebrado puede asignarse a uno de dos tipos claramente distintos, llamados kappa y lambda, basado en las secuencias de aminoácidos de sus dominios constantes. Los anticuerpos anti-Factor D descritos en el presente documento pueden comprender un dominio constante de cadena ligera que comprende sustituciones en posiciones de aminoácidos que dan como resultado un efecto deseado sobre la función efectora (por ejemplo, afinidad de unión). Los anticuerpos anti-Factor D descritos en el presente documento pueden comprender un dominio constante de cadena ligera que comprende sustituciones en posiciones de aminoácidos que no dan como resultado un efecto sobre la función efectora (por ejemplo, afinidad de unión). Los anticuerpos anti-Factor D descritos en el presente documento pueden comprender un dominio constante de cadena ligera del tipo kappa y comprender además una sustitución en la posición 110, 144, 146 y/o 168 (numeración de Kabat). Los anticuerpos anti-Factor D descritos en el presente documento pueden comprender un dominio constante de cadena ligera del tipo kappa y comprender además una sustitución en la posición 110 en la que 110 es una cisteína (C) o valina (V), en la posición 144 en la que 144 es una cisteína (C) o alanina (A), en la posición 146 en la que 146 es una isoleucina (I) o valina (V) y/o en la posición 168 en la que 168 es una cisteína (C) o serina (S). En el presente documento se describen fragmentos de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

2. Anticuerpos anti-Factor D modificados En el presente documento se describe la producción y el uso de anticuerpos anti-Factor D modificados, por ejemplo anticuerpos anti-Factor D humanizados modificados y variantes de los mismos y fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno). Métodos ejemplares para generar anticuerpos modificados se describen con más detalle en las siguientes secciones. Un anticuerpo anti-Factor D parental, incluyendo, un anticuerpo anti-Factor D humanizado, puede modificarse para generar anticuerpos anti-Factor D modificados y variantes de los mismos. Los anticuerpos anti-Factor D modificados y variantes de los mismos, pueden tener propiedades físicas, químicas, biológicas para homogeneidad mejoradas respecto al anticuerpo parental. Además, en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). Un anticuerpo tal como se describe en el presente documento puede comprender una o más alteraciones de aminoácidos (por ejemplo sustituciones) en una o más de las regiones hipervariables del anticuerpo parental. Como alternativa, o además, una o más alteraciones (por ejemplo sustituciones) de residuos de la región marco pueden introducirse en el anticuerpo parental. Los ejemplos de residuos de la región marco a modificar incluyen aquellos que se unen de forma no covalente al antígeno directamente (Amit et al., (1986) Science, 233: 747-753); interactúan con/efectúan la conformación de una CDR (Chothia et al. (1987) J. Mol. Biol., 196: 901-917) y/o participan en la interfaz VL-VH (EP 239 400B1). La modificación de uno o más de dichos residuos de la región marco puede dar como resultado una mejora de la afinidad de unión del anticuerpo por el antígeno. Por ejemplo, de aproximadamente a aproximadamente 5 residuos del marco pueden ser alterados. Los ejemplos de residuos de la región marco o HVR a modificar incluyen sitios, en los que las modificaciones en dichos sitios dan como resultado la generación de variantes desaminadas (por ejemplo, uno o más residuos asparagina (N o Asn) modificados a aspartato (D o Asp), variantes de oxidación (por ejemplo, uno o más residuos de metionina (M o Met) y/o triptófano (W o Trp) modificados a sulfona o sulfóxido) o variantes de piroglutamato (por ejemplo, uno o más residuos de glutamina (Q o Gln) modificados a piroglutamato). Los ejemplos de residuos de la región marco o residuos de la región HVR a modificar incluyen posibles sitios de desamidación (es decir asparagina (N o Asn)), sitios de oxidación (es decir metionina (M o Met) o triptófano (W o Trp)) o sitios de conversión de piroglutamato (es decir glutamina (Q o Gin)), en los que la modificación en dichos sitios previene la desamidación y/u oxidación y/o conversión en piroglutamato, respectivamente. Para prevenir la formación de variantes desaminadas, asparagina (N o Asn) puede mutarse a alanina (A o Ala), glutamina (Q o Gln) o serina (S o Ser). Para prevenir la formación de variantes oxidadas, metionina (Met) o triptófano (W o Trp) pueden mutarse a leucina (L) o isoleucina (I). Para prevenir la formación de variantes de piroglutamato, glutamina (Q o Gln) puede mutarse a glutamato (E o Glu). (Amphlett, G. et al., Pharm. Biotechnol., 9: 1-140 (1996)). Como alternativa, o además, una o más alteraciones (por ejemplo sustituciones) de residuos de la región marco pueden estar en la región Fc en el anticuerpo parental. También en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). Un anticuerpo tal como se describe en el presente documento puede comprender una región Fc variante de modo que la semivida del anticuerpo in vivo se incremente o disminuya con respecto al anticuerpo parental o el anticuerpo que comprende una región Fc de secuencia nativa. El anticuerpo puede comprender una región Fc variante que incrementa o disminuye la afinidad de unión del receptor Fc neonatal (FcRh) al anticuerpo (véase el documento WO2000042072). Por ejemplo, dicho anticuerpo puede comprender una modificación de aminoácidos en una o más cualesquiera posiciones de aminoácidos 238, 252, 253, 254, 255, 256, 265, 272, 286, 288, 303, 305, 307, 309, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 386, 388, 400, 413, 415, 424, 433, 434, 435, 436, 439 o 447 de la región Fc, en las que la numeración de los residuos en la región Fc es la del índice EU como en Kabat. Dichas variantes de polipéptidos con unión reducida a un FcRn pueden comprender una modificación de aminoácidos en una o más cualesquiera posiciones de aminoácidos 252, 253, 254, 255, 288, 309, 386, 388, 400, 415, 433, 435, 436, 439 o 447 de la región Fc, en las que la numeración de los residuos en la región Fc es la del índice EU como en Kabat. Las variantes de polipéptidos mencionadas anteriormente pueden presentar, como alternativa, unión incrementada a FcRn y comprender una modificación de aminoácidos en una o más cualesquiera posiciones de aminoácidos 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 o 434 de la región Fc, en las que la numeración de los residuos en la región Fc es la del índice EU como en Kabat. Por ejemplo, el anticuerpo comprende una región Fc variante que se une con semivida incrementada in vivo con respecto al anticuerpo parental o el anticuerpo que comprende una región Fc de secuencia nativa. Por ejemplo, el anticuerpo comprende una región Fc variante que se une con afinidad incrementada a FcRn con respecto al anticuerpo parental o el anticuerpo que comprende una región Fc de secuencia nativa. La afinidad de unión del FcRn puede medirse de la siguiente manera: La unión de anticuerpos contra FcRn humano puede estudiarse mediante resonancia del plasmón superficial usando, por ejemplo, un instrumento BiaCore 3000. FcRn humano está acoplado a un chip sensor usando un kit de acoplamiento a amina. Por ejemplo, un chip sensor CM5 puede activarse con EDC/NHS durante 7 min a 5 µl/min. 100 µg/ml de FcRn humano pueden inyectarse durante de 30 s a 2 min a un caudal de 10 µl/min sobre el chip activado para dar una unidad de respuesta de unión final (UR) de 100 a 200. Después de la conjugación, el chip acoplado a FcRn puede bloquearse mediante una inyección de 35 µl de clorhidrato de etanolamina 1 M a 5 µl/min. La unión de los anticuerpos a FcRn humano a pH 6,0 o pH 7,4 puede determinarse. El tampón de corrida para el experimento de unión es PBS pH 6,0 o pH 7,4 que contenía P20 al 0,01 % y azida sódica al 0,02 %. Los anticuerpos pueden intercambiarse en tampón en tampón de corrida a pH 6,0 o pH 7,4. Los experimentos pueden realizarse a 25°C. Para la corrida a pH 6,0, anticuerpos, con concentraciones que varían entre 4 µM y 0,7 nM, se hacen fluir sobre un chip revestido con FcRn a 30 µl/min durante 4 min y a continuación se les permite disociarse del chip durante 5 min. Para la corrida a pH 7,4, anticuerpos, con concentraciones que varían entre 12 µM y 100 nM, se inyectan sobre el chipo revestido con FcRn a 20 µl/min durante 1,5 min y a continuación se liberan durante 2 min. También se hace fluir a los anticuerpos sobre un punto no conjugado en el chip sensor para permitir la sustracción de unión inespecífica de fondo de la unión al chip acoplado a FcRn. El chip puede regenerarse con un pulso de 30 s de TRIS 0,1 M pH 8,3 entre inyecciones. La UR en estado estacionario para cada inyección puede registrarse al final de cada fase de inyección y más tarde se calculan las constantes de disociación (KD) representando gráficamente la UR en estado estacionario frente a la concentración de inyección.

Un procedimiento útil para generar dichos anticuerpos modificados y fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) y variantes de los mismos, se denomina “mutagénesis mediante alanina” (Cunningham y Wells (1989) Science 244:1081-1085). En este caso, uno o más de los residuos de la región hipervariable son sustituidos por residuos de alanina o polialanina para afectar a la interacción de los aminoácidos con el antígeno. Aquellos residuos de la región hipervariable que demuestran sensibilidad funcional a las sustituciones son refinados a continuación introduciendo mutaciones adicionales u otras en o para los sitios de sustitución: Por lo tanto, aunque el sitio para introducir una variación de la secuencia de aminoácidos está predeterminado, no es necesario que la naturaleza de la mutación per se esté predeterminada. Los mutantes con ala producidos de esta manera son cribados para su actividad biológica (es decir afinidad de unión o ensayo de hemólisis) tal como se describe en el presente documento.

Normalmente se comenzaría con una sustitución conservativa tal como las mostradas a continuación bajo el encabezamiento de “sustituciones preferidas”. Si dichas sustituciones dan como resultado un cambio de actividad biológica (por ejemplo afinidad de unión), entonces se introducen cambios más sustanciales, denominados “sustituciones ejemplares” en la siguiente tabla, o tal como se describe adicionalmente a continuación en referencia a las clases de aminoácidos y los productos son cribados. En la tabla a continuación se enumeran sustituciones preferidas.

Tabla 1: Sustituciones preferidas Residuo Original Sustituciones ejemplares Sustituciones preferidas Ala (A) val; leu; ile val Arg (R) lys; gln; asn lys Asn (N) gln; his; lys; arg gln Asp (D) Glu glu Cys (C) Ser ser Gln (Q) Asn asn Glu (E) Asp asp Gly (G) pro; ala ala His (H) asn; gin; lys; arg arg Ile (I) leu; val; met; ala; phe; norleucina leu Leu (L) norleucine; ile; val; met; ala; phe ile Lys (K) arg; gln; asn arg Met (M) leu; phe; ile leu Phe (F) leu; val; ile; ala; tyr leu Pro (P) Ala ala Ser (S) Thr thr Thr (T) Ser ser Trp (W) tyr; phe tyr Tyr (Y) trp; phe; thr; ser phe Val (V) ile; leu; met; phe; ala; norleucina leu Modificaciones aún más sustanciales en las propiedades biológicas de los anticuerpos o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) se consiguen seleccionando sustituciones que difieren significativamente en su efecto en mantener (a) la estructura de la cadena principal polipeptídica en el área de la sustitución, por ejemplo, como una conformación en lámina o helicoidal, (b) la carga o hidrofobicidad de la molécula en el sitio diana, o (c) el volumen de la cadena lateral. Los residuos de origen natural se dividen en grupos basado en propiedades de la cadena lateral comunes: (1) hidrófobos: norleucina, met, ala, val, leu, ile; (2) hidrófilos neutros: cys, ser, thr, asn, gln; (3) ácidos: asp, glu; (4) básicos: his, lys, arg; (5) residuos que influyen en la orientación de la cadena: gly, pro; y (6) aromáticos: trp, tyr, phe.

Las sustituciones no conservativas conllevarán intercambiar un miembro de una de estas clases por otra clase. Tal como se describe en el presente documento, los sitios seleccionados para modificación pueden modificarse y estas modificaciones con afinidad de unión mejorada se seleccionan mediante presentación en fagos. Las moléculas de ácido nucleico que codifican mutantes de secuencia de aminoácidos o secuencias de aminoácidos modificadas se preparan mediante diversos métodos conocidos en la técnica. Estos métodos incluyen, aunque sin limitarse a, mutagénesis mediada por oligonucleótidos (o dirigida), mutagénesis por PCR y mutagénesis mediante casete de una variante preparada anteriormente o una versión no variante del anticuerpo parental. Un método para preparar mutantes o variantes o secuencias de aminoácidos modificadas es mutagénesis dirigida (véase, por ejemplo, Kunkel (1985) Proc. Natl. Acad. Sci. EE. UU. 82: 488). El anticuerpo modificado puede tener solamente un único residuo de la región hipervariable sustituido. Como alternativa, dos o más de los residuos de la región hipervariable del anticuerpo parental habrán sido sustituidos, por ejemplo de aproximadamente dos a aproximadamente diez sustituciones de la región hipervariable. También en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

Habitualmente, el anticuerpo modificado tendrá una secuencia de aminoácidos que tiene al menos el 75 % de identidad o similitud de secuencia de aminoácidos (definida anteriormente en la sección Definiciones) con la secuencia de aminoácidos del dominio variable de cadena pesada o ligera del anticuerpo parental, más preferentemente al menos el 80 %, más preferentemente al menos el 85 %, más preferentemente al menos el 90 % y de la forma más preferente al menos el 95 %. También en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

Después de la producción del anticuerpo modificado, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) se determina la actividad biológica de esa molécula con respecto al anticuerpo parental, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). Tal como se ha indicado anteriormente, esto puede implicar determinar la afinidad de unión y/u otras actividades biológicas de la variante del anticuerpo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). Tal como se describe en el presente documento, un panel de anticuerpos modificados, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) se prepara y se criba para afinidad de unión por el antígeno tal como Factor D o un fragmento del mismo. Uno o más de los mutantes del anticuerpo o anticuerpos modificados, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) seleccionados a partir de esta criba inicial son sometidos opcionalmente a uno o más ensayos adicionales de actividad biológica para confirmar que la variante o variantes del anticuerpo, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) son de hecho útiles, por ejemplo para estudios preclínicos. Los anticuerpos anti-Factor D modificados, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) descritos en el presente documento pueden someterse a modificaciones adicionales, a menudo dependiendo del uso pretendido del anticuerpo modificado, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). Dichas modificaciones pueden implicar una alteración adicional de la secuencia de aminoácidos, fusión a uno o más polipéptidos heterólogos y/o modificaciones covalentes tales como las elaboradas a continuación. Con respecto a las alteraciones de la secuencia de aminoácidos, anteriormente se han elaborado modificaciones ejemplares. Por ejemplo, cualquier residuo de cisteína no implicado en el mantenimiento de la conformación apropiada del anticuerpo modificado también puede sustituirse, generalmente con serina, para mejorar la estabilidad oxidativa de la molécula y prevenir reticulación aberrante. A la inversa, pueden añadirse uno o más enlaces de cisteína al anticuerpo para mejorar su estabilidad (particularmente cuando el anticuerpo es un fragmento de anticuerpo tal como un fragmento Fv). Otro tipo de mutante de aminoácido tiene un patrón de glucosilación alterado. Esto puede conseguirse delecionando uno o más restos de carbohidrato descubiertos en el anticuerpo y/o añadiendo uno o más sitios de glucosilación que no están presentes en el anticuerpo. La glucosilación de anticuerpos, o fragmentos de anticuerpo (por ejemplo fragmentos de unión al antígeno) está normalmente enlazada a N o enlazada a O. Enlazada a N se refiere a la fijación del resto de carbohidrato a la cadena lateral de un residuo de asparagina. Las secuencias de tripéptido asparagina-X-serina y asparagina-X-treonina, donde X es cualquier aminoácido excepto prolina, son las secuencias de reconocimiento para fijación enzimática del resto de carbohidrato a la cadena lateral de asparagina. Por lo tanto, la presencia de cualquiera de estas secuencias de tripéptido en un polipéptido crea un sitio de glucosilación potencial. Glucosilación enlazada a O se refiere a la fijación de uno de los azúcares N-aceilgalactosamina, galactosa, o xilosa a un hidroxiaminoácido, de la forma más habitual serina o treonina, aunque también pueden usarse 5-hidroxiprolina o 5-hidroxilisina. La adición de sitios de glucosilación al anticuerpo se consigue convenientemente alterando la secuencia de aminoácidos de modo que contenga una o más de las secuencias de tripéptido descritas anteriormente (para sitios de glucosilación enlazados a N). La alternancia también puede realizarse mediante la adición de, o sustitución por, uno o más residuos serina o treonina a la secuencia del anticuerpo original (para sitios de glucosilación enlazados a O). La invención proporciona un anticuerpo anti-Factor D modificado que comprende un dominio variable de cadena pesada que comprende la SEC ID Nº: 19 y un dominio variable de cadena ligera que comprende la SEC ID Nº: 7. En una realización, la invención proporciona un polipéptido que comprende una secuencia de aminoácidos SEC ID Nº: 19. En otra realización, la invención proporciona un polipéptido que comprende una secuencia de aminoácidos SEC ID Nº: 7. También en el presente documento se describe un fragmento de dicho polipéptido.

En un aspecto, la invención proporciona un anticuerpo anti-Factor D modificado, en donde el dominio de cadena ligera comprende la secuencia de la SEC ID Nº: 61. En otro aspecto, la invención proporciona un anticuerpo anti- Factor D modificado, en el que el dominio de cadena pesada comprende la secuencia de la SEC ID Nº: 63. En un ejemplo, la invención proporciona un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En un aspecto, la invención proporciona un polipéptido que comprende la secuencia de la SEC ID Nº: 61. En otro aspecto, la invención proporciona un polipéptido que comprende la secuencia de la SEC ID Nº: 63. También en el presente documento se describe un fragmento de dicho polipéptido.

En un aspecto, la invención proporciona un anticuerpo anti-Factor D modificado de anti-Factor D humanizado n.º 111, en el que el dominio de cadena ligera variable comprende la secuencia de aminoácidos SEC ID Nº: 7 y en el que el dominio de cadena pesada variable comprende la secuencia SEC ID Nº: 19. En un ejemplo, la invención proporciona un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

3. Afinidad y actividad biológica de anticuerpos anti-Factor D En el presente documento se describen anticuerpos y variantes de los mismos o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno), que tienen características identificadas en el presente documento como deseables en un anticuerpo anti-Factor D. Los anticuerpos y variantes de los mismos o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno), que tienen características identificadas en el presente documento como deseables en un anticuerpo anti-Factor D, pueden ser cribados para actividad biológica inhibidora, por ejemplo in vitro o in vivo o midiendo la afinidad de unión. a. Afinidad Para determinar si un anticuerpo anti-Factor D y variantes de los mismos o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno), se unen al mismo epítopo en Factor D humano al que se ha unido un anticuerpo de interés (por ejemplo, aquellos anticuerpos que antagonizan la actividad del Factor D), puede realizarse un ensayo de bloqueo cruzado (Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow y David Lane (1988)). Como alternativa, puede realizarse mapeo epitópico para determinar si un anticuerpo anti-Factor D se une a un epítopo de interés (Champe et al., J. Biol. Chem., 270: 1388-1394 (1995). Las afinidades del anticuerpo, por ejemplo por el Factor D humano, pueden determinarse usando métodos convencionales, incluyendo los descritos en el ejemplo 3.

En el presente documento se describen anticuerpos anti-Factor D, o variantes de anticuerpo de los mismos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno), que compiten con un anticuerpo anti- Factor D murino y/o anticuerpo anti-Factor D humanizado clon n.º 111 y/o un anticuerpo que comprende secuencias de dominio variable o HVR del anticuerpo anti-Factor D humanizado clon n.º 111. Anticuerpos anti-Factor D, o variantes de los mismos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) que se unen al mismo epítopo que un anticuerpo anti-Factor D murino y/o anticuerpo anti-Factor D humanizado clon n.º 111 y/o un anticuerpo que comprende secuencias de dominio variable o HVR del anticuerpo anti-Factor D humanizado clon n.º 111, también se describen. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad monovalente del anticuerpo por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es menor, por ejemplo al menos 1 o 2 veces menor que la afinidad monovalente de un anticuerpo quimérico (por ejemplo afinidad del anticuerpo quimérico como un fragmento Fab por el Factor D), que comprende, consta de o consiste esencialmente en un dominio variable de cadena ligera de y dominio variable de cadena pesada de un anticuerpo anti-Factor D murino. También en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad bivalente del anticuerpo por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es menor, por ejemplo al menos 1 o 2 veces menor que la afinidad bivalente de un anticuerpo quimérico (por ejemplo afinidad del anticuerpo quimérico como una IgG por el Factor D), que comprende, consta de o consiste esencialmente en un dominio variable de cadena ligera y dominio variable de cadena pesada de un anticuerpo anti- Factor D murino. También en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad monovalente del anticuerpo por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es mayor, por ejemplo al menos 1 o 2 veces mayor que la afinidad monovalente de un anticuerpo quimérico (por ejemplo afinidad del anticuerpo quimérico como un fragmento Fab por el Factor D), que comprende, consta de o consiste esencialmente en un dominio variable de cadena ligera y dominio variable de cadena pesada de un anticuerpo anti-Factor D murino. También en el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describe un anticuerpo anti-Factor D, o variantes de anticuerpo del mismo, en el que la afinidad bivalente del anticuerpo por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es mayor, por ejemplo al menos 1 o 2 veces mayor que la afinidad bivalente de un anticuerpo quimérico (por ejemplo afinidad del anticuerpo quimérico como una IgG por el Factor D), que comprende, consta de o consiste esencialmente en un dominio variable de cadena ligera y un dominio variable de cadena pesada de un anticuerpo anti-Factor D murino. También en el presente documento se describe un fragmento de dichos anticuerpos anti- Factor D (por ejemplo fragmentos de unión al antígeno).

En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es 20 nM (20x10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es 10 nM (10x10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es 1,0 nM (1,0×10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es 0,5 nM (0,5×10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es 1,0 pM (1,0×10-12 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo afinidad del anticuerpo como un fragmento Fab por el Factor D) es 0,5 pM (0,5×10-12 M) o mejor. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es 10,0 nM (10,0×10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es 5,0 nM (5,0×10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo afinidad del anticuerpo como una IgG por el Factor D) es 1,0 nM (1,0×10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es 0,5 nM (0,5x10-9 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es 5,0 pM (5,0x10-12 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es 2,0 pM (2,0x10-12 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es 1,0 pM (1,0x10-12 M) o mejor. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es 0,5 pM (0,5x10-12 M) o mejor. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) está entre 0,5 mM (0,5×10-6 M) y 0,5 pM (0,5x10-12 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) está entre 15 nM (15x10-9 M) y 0,1 nM (0,1x10-9 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) está entre 5,5 nM (5,5x10-9 M) y 1 nM (1x10-9 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) está entre 0,5 pM (0,5x10-12 M) y 2 pM (2x10-12 M). En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) está entre 0,5 mM (0,5x10-6 M) y 0,5 pM (0,5x10-12 M). En el presente documento se describe un anticuerpo anti-Factor D, o variantes de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) está entre 10 nM (10x10-9 M) y 0,05 nM (0,05x10-9 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) está entre 5,5 nM (5,5x10-9 M) y 1 nM (1x10-9 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) está entre 0,5 pM (0,5x10-12 M) y 2 pM (2x10-12 M). En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 1,4 pM (1,4x10-12 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 1,1 pM (1,1x10-12 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 0,19 nM (0,19x10-9 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 0,08 nM (0,08x10-9 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 12,3 nM (12,3x10-9 M). En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 9,0 nM (90x10-9 M). En un ejemplo, la invención proporciona un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 1,4 pM (1,4x10-12 M) +/-0,5. En otra realización, la invención proporciona un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 1,1 pM (1,1x10-12 M) +/- 0,6. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 0,19 nM (0,19x10-9 M) +/- 0,1. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 0,08 nM (0,08x10-9 M) +/- 0,01. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 12,3 nM (12,3x10-9 M) +/- 2. En el presente documento se describe un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, en el que la afinidad del anticuerpo en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 9,0 nM (9,0x10-9 M) +/- 1. En un ejemplo, la invención proporciona un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). Tal como se describe en el presente documento, un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, puede tener una afinidad en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) de aproximadamente 1,4 pM (1,4x10-12 M) +/- 2. Tal como se describe en el presente documento, un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, puede tener una afinidad en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) de aproximadamente 1,1 pM (1,1x10-12 M) +/- 2. Tal como se describe en el presente documento, un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, puede tener una afinidad en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 0,19 nM (0,1x10-9 M) +/- 2. Tal como se describe en el presente documento, un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, puede tener una afinidad en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 0,08 nM (0,08x10-9 M) +/- 2. Tal como se describe en el presente documento, un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, puede tener una afinidad en su forma monovalente por el Factor D (por ejemplo, afinidad del anticuerpo como un fragmento Fab por el Factor D) es de aproximadamente 12,3 nM (12,3x10-9 M) +/- 2. Tal como se describe en el presente documento, un anticuerpo anti-Factor D, o variante de anticuerpo del mismo, puede tener una afinidad en su forma bivalente por el Factor D (por ejemplo, afinidad del anticuerpo como una IgG por el Factor D) es de aproximadamente 9,0 nM (9,0x10-9 M) +/- 2. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). Tal como está bien establecido en la técnica, la afinidad de unión de un ligando por su receptor puede determinarse usando cualquiera de diversos ensayos y expresarse en términos de diversos valores cuantitativos. Por consiguiente, tal como se describe en el presente documento, la afinidad de unión se expresa como valores de KD y refleja la afinidad de unión intrínseca (por ejemplo, con efectos de avidez minimizados). En general y preferentemente, la afinidad de unión se mide in vitro, ya sea en un entorno libre de células o asociado a células. Tal como se describe con mayor detalle en el presente documento, la diferencia de veces de la afinidad de unión puede cuantificarse en términos de la relación del valor de afinidad de unión monovalente de un anticuerpo humanizado (por ejemplo, en forma de Fab) y el valor de afinidad de unión monovalente de un anticuerpo de referencia/comparador (por ejemplo, en forma de Fab) (por ejemplo, un anticuerpo murino que tiene secuencias de región hipervariable donadoras), en el que los valores de afinidad de unión se determinan en condiciones de ensayo similares. Por lo tanto, tal como se describe en el presente documento, la diferencia de veces de la afinidad de unión se determina como la relación de los valores de KD del anticuerpo humanizado en forma de Fab y dicho anticuerpo Fab de referencia/comparador. Por ejemplo, tal como se describe en el presente documento, de un anticuerpo de la invención (A) tiene una afinidad que es “3 veces menor” que la afinidad de un anticuerpo de referencia (M), entonces si el valor de KD para A es 3x, el valor de KD de M sería 1x y la relación de KD de A respecto a KD de M sería 3:1. A la inversa, tal como se describe en el presente documento, si un anticuerpo (C) tiene una afinidad que es “3 veces mayor” que la afinidad de un anticuerpo de referencia (R), entonces si el valor de KD para C es 1x, el valor de KD de R sería 3x y la relación de KD de C respecto a KD de R sería 1:3. Puede usarse cualquiera de una serie de ensayos conocidos en la técnica, incluyendo los descritos en el presente documento, para obtener mediciones de afinidad de unión, incluyendo, por ejemplo, Biacore, radioinmunoensayo (RIA) y ELISA. Además, los valores de KD para un anticuerpo tal como se describe en el presente documento, pueden variar dependiendo de condiciones del ensayo particular usado. Por ejemplo, tal como se describe en el presente documento, pueden obtenerse mediciones de afinidad de unión en un ensayo en el que el Fab o anticuerpo se inmoviliza y se mide la unión del ligando, es decir el Factor D, o como alternativa, el ligando, es decir el Factor D, para el Fab o anticuerpo se inmoviliza y se mide la unión del Fab o anticuerpo. Tal como se describe en el presente documento, las mediciones de afinidad de unión pueden obtenerse en un ensayo en el que las condiciones de regeneración pueden comprender (1) glicina 10 mM o MgCl2 4 M a pH 1,5 y (2) pH entre pH de 1,0 y pH de 7,5, incluyendo pH de 1,5, pH de 5,0, pH de 6,0 y pH de 7,2. Tal como se describe en el presente documento, las mediciones de afinidad de unión pueden obtenerse en un ensayo en el que las condiciones de unión pueden comprender (1) solución salina tamponada con PBS o HEPES y (2) Tween-20, es decir Tween-20 al 0,1 %. Tal como se describe en el presente documento, las mediciones de afinidad de unión pueden obtenerse en un ensayo en el que la fuente del ligando, es decir, el Factor D, puede ser de fuentes disponibles en el mercado. Tal como se describe en el presente documento, pueden obtenerse mediciones de afinidad de unión en un ensayo en el que (1) el Fab o anticuerpo se inmoviliza y se mide la unión del ligando, es decir el Factor D, (2) las condiciones de regeneración comprenden MgCl2 4 M a pH 7,2 y (3) las condiciones de unión comprenden solución salina tamponada con HEPES, pH 7,2 que contiene Tween-20 al 0,1 %. Tal como se describe en el presente documento, pueden obtenerse mediciones de afinidad de unión en un ensayo en el que (1) el ligando, es decir el Factor D, se inmoviliza y se mide la unión del Fab o anticuerpo, (2) las condiciones de regeneración comprenden glicina 10 mM a pH 1,5 y (3) las condiciones de unión comprenden tampón PBS. b. Actividad biológica Para determinar si un anticuerpo anti-Factor D, o variante o fragmento del mismo (por ejemplo fragmento de unión al antígeno) es capaz de unirse al Factor D y ejercer un efecto biológico, por ejemplo, inhibición de hemólisis por la ruta alternativa, pueden usarse ensayos de inhibición hemolítica que usan eritrocitos de conejo, incluyendo los descritos en el ejemplo 2. Dicha inhibición hemolítica puede determinarse usando ensayos convencionales (Kostavasili et al., J of Immunology, 158(4): 1763-72 (1997); Wiesmann et al., Nature, 444(7116): 159-60 (2006)). La activación del complemento en dichos ensayos puede iniciarse con suero o plasma. Las concentraciones apropiadas de Factor D en suero o plasma (Pascual et al., Kidney International, 34: 529-536 (1998); Complement Facts Book, Bernard J. Morley y Mark J. Walport, editores, Academic Press (2000); Barium et al., J. Immunol. Methods, 67: 303-309 (1984)) puede determinarse de forma rutinaria de acuerdo con métodos conocidos en la técnica, incluyendo aquellos que han sido descritos en referencias tales como Pascual et al., Kidney International, 34: 529-536 (1998) y Barnum et al., J. Immunol. Methods, 67: 303-309 (1984) y el ejemplo 4. En el presente documento se describen anticuerpos capaces de inhibir actividades biológicas asociadas con Factor D. Por ejemplo, a una concentración de 18 µg/ml (equivalente a aproximadamente 1,5 veces la concentración molar del factor D humano en la sangre; relación molar de anticuerpo anti-Factor D respecto al Factor D de aproximadamente 1,5:1), puede observarse una inhibición significativa de la actividad alternativa del complemento por el anticuerpo (véase, por ejemplo, la patente de Estados Unidos n.º 6.956.107). En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 menores de 30 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 menores de 15 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 menores de 10 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 menores de 5 nM. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 30 nM y 2 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 25 nM y 7 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 20 nM y 12 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 30 nM y 15 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 12 nM y 8 nM. En el presente documento se describen, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 7 nM y 2 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 6 nM y 3 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 8 nM y 5 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 5 nM y 2 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 10 nM y 5 nM. En el presente documento se describen anticuerpos anti- Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 8 nM y 2 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 7 nM y 3 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 entre 6 nM y 4 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI50 de aproximadamente 4,7 nM ± 0,6 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI50 de aproximadamente 6,4 nM ± 0,6 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI50 de aproximadamente 3,5 nM ± 0,5 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI50 de aproximadamente 4,4 nM ± 1,5 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI50 de aproximadamente 10,2 nM ± 0,8 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI50 de aproximadamente 23,9 nM ± 5,0 nM. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 menores de 80 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 menores de 50 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 menores de 40 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 menores de 20 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI50 menores de 15 nM. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (es decir fragmentos de unión al antígeno).

En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 80 nM y 10 nM). En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 75 nM y 15 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 70 nM y 20 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 65 nM y 25 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 60 nM y 30 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 55 nM y 35 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 50 nM y 40 nM. En el presente documento se describen anticuerpos anti- Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 80 nM y 70 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 55 nM y 25 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con valores de CI90 entre 16 nM y 12 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI90 de aproximadamente 14,0 nM ± 1,0 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI90 de aproximadamente 38,0 nM ± 11,0 nM. En el presente documento se describen anticuerpos anti-Factor D, en los que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa con un valor de CI90 de aproximadamente 72,6 nM ± 4,8 nM. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). En el presente documento se describe un anticuerpo anti-Factor D, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) en el que un fragmento Fab de dichos anticuerpos inhibe la hemólisis por la ruta alternativa en una relación molar de anticuerpo respecto al Factor D de aproximadamente 0,05:1 (0,05) a aproximadamente 10:1 (10), o de aproximadamente 0,09:1 (0,09) a aproximadamente 8:1 (8), o de aproximadamente 0,1:1 (0,1) a aproximadamente 6:1 (6), o de aproximadamente 0,15:1 (0,15) a aproximadamente 5:1 (5), o de aproximadamente 0,19:1 (0,19) a aproximadamente 4:1 (4), o de aproximadamente 0,2:1 (0,2) a aproximadamente 3:1 (3), o de aproximadamente 0,3:1 (0,3) a aproximadamente 2:1 (2), o de aproximadamente 0,4:1 (0,4) a aproximadamente 1:1 (1), o de aproximadamente 0,5:1 (0,5) a aproximadamente 1:2 (0,5), o de aproximadamente 0,6:1 (0,6) a aproximadamente 1:3 (0,33), o de aproximadamente 0,7:1 (0,7) a aproximadamente 1:4 (0,25), o de aproximadamente 0,8:1 (0,8) a aproximadamente 1:5 (0,2) o aproximadamente 0,9:1 (0,9) a aproximadamente 1:6 (0,17). En el presente documento se describen fragmentos de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

En una realización, la presente invención incluye fragmentos de anticuerpos anti-Factor D humanizados (por ejemplo fragmentos de unión al antígeno). Los fragmentos de anticuerpo de la presente invención pueden ser, por ejemplo, fragmentos Fab, Fab', F(ab')2, scFv, (scFv)2, dAb, región determinante de la complementariedad (CDR), anticuerpos lineales, moléculas de anticuerpo de cadena sencilla, minicuerpos, diacuerpos o anticuerpos multiespecíficos formados a partir de fragmentos de anticuerpo. En una realización adicional, la invención proporciona un fragmento de anticuerpo anti-Factor D humanizado (por ejemplo, fragmento de unión al antígeno) que es capaz de penetrar sustancialmente en toda la retina. En una realización adicional más, la invención proporciona un fragmento de anticuerpo anti-Factor D humanizado (por ejemplo fragmento de unión al antígeno) que es capaz de penetrar a través de todo el grosor de la retina. En un ejemplo, la invención proporciona un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno).

En el presente documento se describen anticuerpos anti-Factor D humanizados, en los que un fragmento Fab de dichos anticuerpos tiene una semivida de al menos 3, 5, 7, 10 o 12 días después de la administración al interior del ojo de un mamífero (por ejemplo ser humano) mediante una única inyección intravítrea. En el presente documento se describen anticuerpos anti-Factor D humanizados, en los que un fragmento Fab de dichos anticuerpos inhibe la activación de la ruta alternativa (AP) del complemento durante al menos 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110 o 115 días después de la administración al interior del ojo de un mamífero (por ejemplo ser humano) mediante una única inyección intravítrea. En el presente documento se describen anticuerpos anti-Factor D humanizados, en los que la concentración de un fragmento Fab de dichos anticuerpos que inhibe la activación de la ruta alternativa (AP) del complemento se mantiene en tejido retiniano durante al menos 40, 45, 50, 55, 60, 65, 70, 75, 80 o 85 días después de la administración al interior del ojo de un mamífero (por ejemplo ser humano) mediante una única inyección intravítrea. En el presente documento se describen anticuerpos anti-Factor D humanizados, en los que la concentración de un fragmento Fab de dichos anticuerpos que inhibe la activación de la ruta alternativa (AP) del complemento se mantiene en el humor vítreo durante al menos 80, 85, 90, 95, 100, 105, 110 o 115 días después de la administración al interior del ojo de un mamífero (por ejemplo, ser humano) mediante una única inyección intravítrea. En el presente documento se describe un fragmento de dichos anticuerpos anti-Factor D (por ejemplo fragmentos de unión al antígeno). GENERACIÓN DE ANTICUERPOS

SELECCIÓN Y TRANSFORMACIÓN DE CÉLULAS HOSPEDADORAS Las células hospedadoras son transfectadas o transformadas con vectores de expresión o clonación descritos en el presente documento para la producción de anticuerpos anti-Factor D y cultivadas en medios nutritivos convencionales modificados según sea apropiado para inducir promotores, seleccionar transformantes, o amplificar los genes que codifican las secuencias deseadas. Las condiciones de cultivo, tales como medios, temperatura, pH y similares, pueden ser seleccionadas por el experto en la materia sin experimentación indebida. En general, principios, protocolos y técnicas prácticas para maximizar la productividad de cultivos celulares pueden encontrarse en Mammalian Cell Biotechnology: a Practical Approach, M. Butler, ed. (IRL Press, 1991) y Sambrook et al., más arriba.

Métodos de transfección de células eucariotas y transformación de células procariotas, lo que significa introducción de ADN en el hospedador de modo que el DNA sea replicable, como un integrante extracromosómico o cromosómico, son conocidos por el experto en la materia, por ejemplo, CaCl2, CaPO4, mediado por liposomas, mediado por polietilenglicol/DMSO y electroporación. Dependiendo de la célula hospedadora usada, la transformación se realiza usando técnicas convencionales apropiadas para dichas células. El tratamiento con calcio empleando cloruro cálcico, tal como se describe en Sambrook et al, más arriba, o electroporación se usa generalmente para procariotas. La infección con Agrobacterium tumefaciens se usa para transformación de ciertas células vegetales, tal como es descrito por Shaw et al., Gene, 23:315 (1983) y el documento WO 89/05859 publicado el 29 de junio de 1989. Para células de mamífero sin dichas paredes celulares, puede emplearse el método de precipitación con fosfato cálcico de Graham and van der Eb, Virology, 52:456-457 (1978). Los aspectos generales de transfecciones de sistemas de células hospedadoras de mamífero se han descrito en la patente de Estados Unidos n.º 4.399.216. Las transformaciones dentro de levaduras se llevan a cabo normalmente de acuerdo con el método de Van Solingen et al., J., Bact., 130:946 (1977) y Hsiao et al., Proc. Natl. Acad. Sci. (EE. UU.), 76: 3829 (1979). Sin embargo, también pueden usarse otros métodos para introducir ADN en células, tales como mediante microinyección nuclear, electroporación, fusión de protoplasto bacteriano con células intactas, o policationes, por ejemplo, polibreno, poliornitina. Para diversas técnicas para transformar células de mamífero, véase Keown et al., Methods in Enzymology, 185: 527-537 (1990) y Mansour et al., Nature, 336: 348-352 (1988). Las células hospedadoras adecuadas para clonar o expresar el ADN en los vectores en el presente documento son para clonar o expresar el ADN en los vectores en el presente documento son células procariotas, levadura, o eucariotas superiores. Las procariotas adecuadas para este fin incluyen organismos tanto Gram negativos como Gram positivos, por ejemplo, Enterobacterias tales como Escherichia, por ejemplo E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, por ejemplo, Salmonella typhimurium, Serratia, por ejemplo, Serratia marcescans y Shigella, así como Bacilos, tales como B. subtilis y B. licheniformis (por ejemplo, B. licheniformis 41 P desvelados en el documento DD 266.710 publicado el 12 de abril de 1989 ), Pseudomonas, tales como P. aeruginosa, Rhizobia,

Vitreosci/la, Paracoccus y Streptomyces. Un hospedador de clonación de E. coli preferido es E. coli 294 (ATCC 31,446), aunque otras cepas tales como E. coli B, E. coli X1776 (ATCC 31,537), E. coli W3110 (ATCC 27,325) y K5 772 (ATCC 53,635) son adecuadas. Estos ejemplos son ilustrativos en lugar de limitantes. La cepa W3110 es un hospedador u hospedador parental particularmente preferido debido a que es una cepa hospedadora común para fermentaciones de productos de ADN recombinante. Preferentemente, la célula hospedadora secreta cantidades mínimas de enzimas proteolíticas. Por ejemplo, la cepa W3110 (Bachmann, Cellular and Molecular Biology, vol. 2 (Washington, D.C.: American Society for Microbiology, 1987), págs. 1190-1219; n.º de depósito de la ATCC 27.325) puede modificarse para efectuar una mutación genética en los genes que codifican proteínas endógenas al hospedador, con ejemplos de dichos huéspedes incluyendo E. coli W3110 cepa 1A2, que tiene el genotipo completo tonA; E. coli W3110 cepa 9E4, que tiene el genotipo completo tonA ptr3; E. coli W3110 cepa 27C7 (ATCC 55.244), que tiene el genotipo completo tonA ptr3 phoA E15 (argF-lac)169degPompTkanr; E. coli W3110 cepa 37D6, que tiene el genotipo completo tonA ptr3 phoA E15 (argF-lac)169 degP ompT rbs7 ilvG kanr; E. coli W3110 cepa 40B4, que es la cepa 37D6 con una mutación por deleción de degP no resistente a kanamicina; E. coli W3110 cepa 33D3 que tiene el genotipo de W3110 ∆fhuA (∆tonA) ptr3 lac iq lacL8ompT∆(nmpc-fepE) degP41 kanR (patente de Estados Unidos n.º 5.639.635) y una cepa de E. coli que tiene proteasa periplásmica mutante desvelada en la patente de Estados Unidos n.º 4.946.783 expedida el 7 de agosto de 1990. Otras cepas y derivados de las mismas, tales como E. coli 294 (ATCC 31.446), E. coli B, E. coliλ 1776 (ATCC 31.537) y E. coli RV308 (ATCC 31,608) también son adecuadas. Estos ejemplos son ilustrativos en lugar de limitantes. Los métodos para construir derivados de cualquiera de las bacterias mencionadas anteriormente que tienen genotipos definidos son conocidos en la técnica y descritos en, por ejemplo, Bass et al., Proteins, 8: 309-314 (1990). Generalmente es necesario seleccionar las bacterias apropiadas teniendo en consideración la replicabilidad del replicón en las células de una bacteria. Por ejemplo, especie E. coli, Serratia o Salmonella pueden ser adecuadas usadas como el hospedador cuando se usan plásmidos bien conocidos tales como pBR322, pBR325, pACYC177 o pKN410 para suministrar el replicón. Normalmente la célula hospedadora debe secretar cantidades mínimas de enzimas proteolíticas y pueden incorporarse de forma deseable inhibidores de proteasa adicionales al cultivo celular. Como alternativa, métodos de clonación in vitro, por ejemplo, PCR u otras reacciones de polimerasa de ácido nucleico, son adecuados. Anticuerpos de longitud completa, fragmentos de anticuerpo (por ejemplo fragmentos de unión al antígeno) y proteínas de fusión a anticuerpos pueden producirse en bacterias, en particular cuando no se necesitan función de glucosilación y efectora de Fc, tal como cuando el anticuerpo terapéutico se conjuga con un agente citotóxico (por ejemplo, una toxina) y el inmunoconjugado por sí mismo muestra eficacia en la destrucción de células tumorales. Los anticuerpos de longitud completa tienen una mayor semivida en circulación. La producción en E. coli es más rápida y más rentable. Para la expresión de fragmentos de anticuerpo y polipéptidos en bacterias, véase, por ejemplo, los documentos U.S. 5.648.237 (Carter et. al.), U.S. 5.789.199 (Joly et al.) y U.S. 5.840.523 (Simmons et al.) que describen secuencias de región de inicio de la traducción (TIR) y de señal para optimizar la expresión y la secreción. Después de la expresión, el anticuerpo se aísla de la pasta de células de E. coli en una fracción soluble y puede purificarse a través de, por ejemplo, una columna de proteína A o G dependiendo del isotipo. La purificación final puede llevarse a cabo similar al proceso para purificar el anticuerpo expresado por ejemplo, en células CHO. Además de los procariotas, los microbios eucariotas tales como hongos filamentosos o levaduras son huéspedes de clonación o expresión adecuados para vectores que codifican anticuerpos. Saccharomyces cerevisiae es la usada más habitualmente entre microorganismos huéspedes eucariotas inferiores. Sin embargo, una serie de otros géneros, especies y cepas están disponibles habitualmente y son útiles en el presente documento, tales como Schizosaccharomyces pombe; Kluyveromyces; Candida; Trichoderma; Neurospora crassa; y hongos filamentosos tales como por ejemplo, huéspedes Neurospora, Penicillium, Tolypocladium y Aspergillus, tales como A. nidulans y

A. nigger. Levaduras mielótrofas son adecuadas en el presente documento en incluyen, aunque sin limitarse a, levaduras capaces de crecer sobre metanol seleccionadas entre los géneros constituidos por Hansenula, Candida, Kloeckera, Pichia, Saccharomyces, Torulopsis y Rhodotorula. Una lista de especies específicas que son ejemplares de esta clase de levaduras puede encontrarse en C. Anthony, The Biochemistry of Methylotrophs, 269 (1982).

Las células hospedadoras adecuadas para la expresión de anticuerpos glucosilados se derivan de organismos multicelulares. En principio, cualquier cultivo de células eucariotas superiores es factible, ya sea de cultivo de vertebrados o invertebrados. Los ejemplos de células de invertebrados incluyen células vegetales y de insecto, Luckow et al., Bio/Technology 6, 47-55 (1988); Miller et al., Genetic Engineering, Setlow et al. eds. Vol. 8, págs. 277- 279 (Plenam publishing 1986); Mseda et al., Nature 315, 592-594 (1985). Se han identificado numerosas cepas de baculovirus y variantes y células hospedadoras de insecto permisivas correspondientes de huéspedes tales como Spodoptera frugiperda (oruga), Aedes (mosquito), Drosophila melanogaster (mosca de la fruta) y Bombyx mori.

Diversas cepas virales para la transfección están disponibles públicamente, por ejemplo, la variante L-1 de Autographa californica NPV y la cepa Bm-5 de Bombyx mori NPV y dichos virus pueden usarse como el virus en el presente documento de acuerdo con la presente invención, particularmente para la transfección de células de Spodoptera frugiperda. Además, también pueden utilizarse cultivos de células vegetales de algodón, maíz, patata, soja, petunia, tomate y tabaco como huéspedes. Las células de vertebrados y la propagación de células de vertebrados, en cultivo (cultivo tisular) se ha convertido en un procedimiento rutinario. Véase Tissue Culture, Academic Press, Kruse y Patterson, eds. (1973). Los ejemplos de líneas celulares huéspedes de mamífero útiles son riñón de mono; línea de riñón embrionario humano; células de riñón de cría de hámster; células de ovario de hámster chino/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. EE. UU. 77: 4216 (1980)); células de Sertoli de ratón; células de carcinoma de cuello del útero humano (HELA); células de riñón canino; células de pulmón humano; células de hígado humano; tumor mamario de ratón; y células NS0. Para la producción recombinante de un anticuerpo de la invención, o fragmento de anticuerpo del mismo (por ejemplo fragmento de unión al antígeno), el ácido nucleico (por ejemplo, ADNc o ADN genómico) que lo codifica es aislado e insertado en un vector replicable para clonación adicional (amplificación del ADN) o para expresión. El ADN que codifica el anticuerpo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) es aislado fácilmente y secuenciado usando procedimientos convencionales (por ejemplo, usando sondas de oligonucleótidos que son capaces de unirse específicamente a genes que codifican las cadenas pesada y ligera del anticuerpo).

Muchos vectores están disponibles. La elección del vector depende en parte de la célula hospedadora a usar. Generalmente, las células hospedadoras preferidas son de origen procariota o eucariota (generalmente de mamífero). El vector puede estar, por ejemplo, en forma de un plásmido, cósmido, partícula viral, o fago. La secuencia de ácido nucleico apropiada puede insertarse en el vector mediante diversos procedimientos. En general, se inserta ADN en uno o varios sitios de endonucleasa de restricción apropiados usando técnicas conocidas en la técnica. Los componentes del vector generalmente incluyen, aunque sin limitarse a, uno o más de una secuencia señal, un origen de replicación, uno o más genes marcadores, un elemento potenciador, un promotor y una secuencia de terminación de la transcripción. La construcción de vectores adecuados que contienen uno o más de estos componentes emplea técnicas de ligamiento convencionales que son conocidas por el experto en la materia. El Factor D puede producirse de forma recombinante no solo directamente, sino también como un polipéptido de fusión con un polipéptido heterólogo, que puede ser una secuencia señal u otro polipéptido que tenga un sitio de escisión específico en el extremo N de la proteína o polipéptido maduro. En general, la secuencia señal puede ser un componente del vector, o puede ser una parte del ADN que codifica el anticuerpo anti-Factor D que se inserta en el vector. La secuencia señal puede ser una secuencia señal procariota seleccionada, por ejemplo, entre el grupo de líderes de fosfatasa alcalina, penicilinasa, lpp, o enterotoxina II termoestable. Para la secreción por levaduras la secuencia señal puede ser, por ejemplo, el líder de invertasa de levadura, líder del factor alfa (incluyendo líderes de factor α de Saccharomyces y Kluyveromyces, el último descrito en la patente de Estados Unidos n.º 5.010.182), o líder de fosfatasa ácida, el líder de glucoamilasa de C. albicans (EP 362.179 publicado el 4 de abril de 1990), o la señal descrita en el documento WO 90/13646 publicado el 15 de noviembre de 1990. En expresión celular de mamífero, las secuencias señal de mamífero pueden usarse para dirigir la secreción de la proteína, tales como secuencias señal de polipéptidos secretados de las mismas o especies relacionadas, así como líderes secretores virales.

Las células hospedadoras se transforman con los vectores mencionados anteriormente para la producción de anticuerpos y se cultivaron en medios nutritivos convencionales modificados según fuera apropiado para inducir promotores, seleccionar transformantes, o amplificar los genes que codifican las secuencias deseadas.

Las células hospedadoras usadas para producir el anticuerpo, o la variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, de esta invención pueden cultivarse en diversos medios. a. Células hospedadoras procariotas Las células procariotas usadas para producir los polipéptidos de la invención se cultivan en medios conocidos en la técnica y adecuados para el cultivo de las células hospedadoras seleccionadas. Los ejemplos de medios adecuados incluyen caldo Luria (LB) más los suplementos nutrientes necesarios. Opcionalmente, los medios también contienen un agente de selección, seleccionado basado en la construcción del vector de expresión, para permitir selectivamente el crecimiento de células procariotas que contienen el vector de expresión Por ejemplo, se añade ampicilina a los medios para el crecimiento de células que expresan el gen de resistencia a ampicilina. Cualesquiera suplementos necesarios aparte de fuentes de carbono, nitrógeno y fosfato inorgánico también pueden incluirse a concentraciones apropiadas introducidas en solitario o como una mezcla con otro suplemento o medio tal como una fuente de nitrógeno compleja. Opcionalmente, el medio de cultivo puede contener uno o más agentes reductores seleccionados entre el grupo constituido por glutatión, cisteína, cistamina, tioglucolato, ditioeritritol y ditiotreitol.

Las células hospedadoras procariotas se cultivan a temperaturas adecuadas. Para el crecimiento de E. coli, por ejemplo, la temperatura preferida varía entre aproximadamente 20°C y aproximadamente 39°C, más preferentemente entre aproximadamente 25°C y aproximadamente 37°C, aún más preferentemente a aproximadamente 30°C. El pH del medio puede ser cualquier pH que varía entre aproximadamente 5 y aproximadamente 9, dependiendo principalmente del organismo hospedador. Para E. coli, el pH es preferentemente de aproximadamente 6,8 a aproximadamente 7,4 y más preferentemente aproximadamente 7,0. Si se usa un promotor inducible en el vector de expresión de la invención, la expresión de proteínas se induce en condiciones adecuadas para la activación del promotor. En un aspecto de la invención, se usan promotores de PhoA para controlar la transcripción de los polipéptidos. Por consiguiente, las células hospedadoras transformadas están cultivadas en un medio limitante de fosfato para inducción. Preferentemente, el medio limitante de fosfato es el medio C.R.A.P (véase, por ejemplo, Simmons et al., J. Immunol. Methods (2002), 263: 133-147). Pueden usarse diversos inductores más, de acuerdo con la construcción vectorial empleada, tal como es conocido en la técnica.

Tal como se describe en el presente documento, los polipéptidos expresados pueden secretarse a y recuperarse del periplasma de las células hospedadoras. La recuperación de proteínas normalmente implica romper el microorganismo, generalmente mediante medios tales como choque osmótico, sonicación o lisis. Una vez que las células están rotas, restos celulares o células completas pueden eliminarse mediante centrifugado o filtración. Las proteínas pueden purificarse adicionalmente, por ejemplo, mediante cromatografía en resina por afinidad. Como alternativa, las proteínas pueden transportarse a los medios de cultivo y aislarse en ellos. Las células pueden eliminarse del cultivo y el sobrenadante del cultivo que está siendo filtrado y concentrado para purificación adicional de las proteínas producidas. Los polipéptidos expresados pueden aislarse e identificarse adicionalmente usando métodos conocidos habitualmente tales como electroforesis en gel de poliacrilamida (PAGE) y ensayo de transferencia de Western.

En un aspecto de la invención, la producción de anticuerpos se lleva a cabo en gran cantidad mediante un proceso de fermentación. Diversos procedimientos de fermentación por lotes alimentados a gran escala están disponibles para la producción de proteínas recombinantes. Las fermentaciones a gran escala tienen al menos 1000 litros de capacidad, preferentemente aproximadamente 1.000 a 100.000 litros de capacidad. Estos fermentadores usan hélices agitadoras para distribuir oxígeno y nutrientes, especialmente glucosa (la fuente de carbono/energía preferida). Fermentación a pequeña escala se refiere en general a la fermentación en un fermentador que no tiene más de aproximadamente 100 litros de capacidad volumétrica y puede variar entre aproximadamente 1 litro y aproximadamente 100 litros.

En un proceso de fermentación, la inducción e la expresión de proteínas se inicia normalmente después de que las células han crecido en condiciones adecuadas a una densidad deseada, por ejemplo, una DO550 de aproximadamente 180-220, fase en la cual las células están en la fase estacionaria temprana. Diversos inductores pueden usarse, de acuerdo con la construcción vectorial empleada, tal como es conocido en la técnica y se ha descrito anteriormente. Las células pueden cultivarse durante periodos más cortos antes de la inducción. Las células son inducidas habitualmente durante aproximadamente 12-50 horas, aunque puede usarse un tiempo de inducción más largo o más corto. Para mejorar el rendimiento de producción y la calidad de los polipéptidos de la invención, pueden modificarse diversas condiciones de fermentación. Por ejemplo, para mejorar el ensamblaje y plegamiento apropiados de los polipéptidos de anticuerpo secretados, pueden usarse vectores adicionales que sobreexpresan proteínas chaperonas, tales como proteínas Dsb (DsbA, DsbB, DsbC, DsbD y/o DsbG) o FkpA (una peptidilprolil cis,trans- isomerasa con actividad de chaperona) para cotransformar las célula huéspedes procariotas. Las proteínas chaperonas han demostrado facilitar el plegamiento apropiado y la solubilidad de proteínas heterólogas producidas en células hospedadoras bacterianas. Chen et al. (1999) J Bio Chem 274: 19601-19605; Georgiou et al., patente de Estados Unidos n.º 6.083.715; Georgiou et al., patente de Estados Unidos n.º 6.027.888; Bothmann y Pluckthun (2000) J. Biol. Chem. 275: 17100-17105; Ramm y Pluckthun (2000) J. Biol. Chem. 275: 17106-17113; Arie et al. (2001) Mol. Microbiol. 39: 199-210. Para minimizar la proteólisis de proteínas heterólogas expresadas (especialmente aquellas que son proteolíticamente sensibles), ciertas cepas hospedadoras deficientes para enzimas proteolíticas pueden usarse para la presente invención. Por ejemplo, cepas de células hospedadoras pueden modificarse para efectuar una o varias mutaciones genéticas en los genes que codifican proteasas bacterianas conocidas tales como Proteasa III, OmpT, DegP, Tsp, Proteasa I, Proteasa Mi, Proteasa V, Proteasa VI y combinaciones de las mismas. Algunas cepas de E. coli deficientes en proteasa están disponibles y se describen en, por ejemplo, los documentos Joly et al. (1998), más

arriba; Georgiou et al., patente de Estados Unidos n.º 5.264.365; Georgiou et al., patente de Estados Unidos n.º 5.508.192; Hara et al., Microbial Drug Resistance, 2: 63-72 (1996). Tal como se describe en el presente documento, pueden usarse cepas de E. coli deficientes para enzimas proteolíticas y transformadas con plásmidos que sobreexpresan una o más proteínas chaperonas como células hospedadoras en sistemas de expresión.

b. Células hospedadoras eucariotas Medios disponibles en el mercado tales como F10 de Ham (Sigma), medio mínimo esencial (MEM, Sigma), RPMI- 1640 (Sigma) y Medio Eagle modificado por Dulbecco (DMEM, Sigma) son adecuados para cultivar células hospedadoras. Además, cualquiera de los medios descritos en los documentos Ham et al., Meth. Enzymol. 58: 44 (1979), Barnes et al., Anal. Biochem. 102: 255 (1980), las patentes de Estados Unidos n.º 4.767.704; 4.687.866; 4.560.655; 5.122.469; 5.712.163; o 6.048.728 puede usarse como medio de cultivo para las células hospedadoras. Cualquiera de estos medios puede suplementarse según sea necesario con hormonas y/u otros factores de crecimiento (tales como insulina, transferrina, o factor de crecimiento epidérmico), sales (tales como cloruros de X, en donde X es sodio, calcio, magnesio; y fosfatos), tampones (tales como HEPES), nucleótidos (tales como adenosina y timidina), antibióticos (tales como el fármaco GENTAMYCIN.TM.), elementos traza (definidos como compuestos inorgánicos habitualmente presentes a concentraciones finales en el intervalo micromolar) y glucosa o una fuente de energía equivalente. También pueden incluirse cualesquiera otros suplementos necesarios a concentraciones apropiadas que serían conocidas por los expertos en la materia. Las condiciones de cultivo, tales como temperatura, pH y similares, son aquellas usadas previamente con la célula hospedadora seleccionada para expresión y será evidente para el experto en la materia. PURIFICACIÓN DE ANTICUERPOS

Formas de anticuerpos anti-Factor D, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) pueden recuperarse de medio de cultivo o de lisados de células hospedadoras. Si están unidos a la membrana, pueden liberarse de la membrana usando una solución detergente adecuada (por ejemplo Triton-X 100) o mediante escisión enzimática. Las células empleadas en la expresión de anticuerpo anti-Factor D pueden romperse mediante diversos medios físicos o químicas, tales como ciclos de congelación-descongelación, sonicación, rotura mecánica, o agentes de lisado de células. Puede desearse purificar un anticuerpo anti-Factor D a partir de proteínas o polipéptidos de células recombinantes. Los siguientes procedimientos son ejemplares de procedimientos de purificación adecuados: mediante fraccionamiento en una columna de intercambio iónico; precipitación con etanol; HPLC de fase inversa; cromatografía en sílice o en una resina de intercambio catiónico tal como DEAE; cromatoenfoque; SDS-PAGE; precipitación con sulfato de amonio; filtración en gel usando, por ejemplo, Sephadex G-75; columnas de proteína A Sefarosa para eliminar contaminantes tales como IgG; y columnas quelantes de metales para unir formas marcadas con epítopo del anticuerpo anti-Factor D. Diversos métodos de purificación de proteínas pueden emplearse y dichos métodos son conocidos en la técnica y descritos por ejemplo en el documento Deutscher, Methods in Enzymology, 182 (1990); Scopes, Protein Purification: Principles and Practice, Springer-Verlag, Nueva York (1982). La etapa o etapas de purificación seleccionadas dependerán, por ejemplo, de la naturaleza del proceso de producción usado y el anticuerpo anti-Factor D particular producido. Cuando se usan técnicas recombinantes, el anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, pueden producirse de forma intracelular, en el espacio periplásmico, o secretarse directamente al medio. Si el anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, se produce de forma intracelular, como primera etapa, los restos particulados, células hospedadoras o fragmentos lisados, pueden eliminarse, por ejemplo, mediante centrifugado o ultrafiltración. El documento Carter et al., Bio/Technology 10: 163-167 (1992) describe un procedimiento para aislar anticuerpos que son secretados al espacio periplásmico de E. coli. En resumen, la pasta celular se descongela en presencia de acetato sódico (pH 3,5), EDTA y fluoruro de fenilmetilsulfonilo (PMSF) durante aproximadamente 30 minutos. Los restos celulares pueden eliminarse mediante centrifugado. Cuando el anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, es secretado al medio, los sobrenadantes de dichos sistemas de expresión son concentrados generalmente en primer lugar usando un filtro de concentración de proteínas disponible en el mercado, por ejemplo, una unidad de ultrafiltración de Amicon o Millipore Pellicon. Un inhibidor de proteasa tal como PMSF puede estar incluida en cualquiera de las etapas anteriores para inhibir la proteólisis y pueden estar incluidos antibióticos para prevenir el crecimiento de contaminantes adventicios. La composición de anticuerpo preparada a partir de las células puede purificarse usando, por ejemplo, cromatografía de hidroxiapatita, electroforesis en gel, diálisis y cromatografía por afinidad, con la cromatografía por afinidad siendo una técnica de purificación. La idoneidad de la proteína A como ligando de afinidad depende de la especie y el isotipo de cualquier dominio Fc de inmunoglobulina que está presente en el anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo. La proteína A puede usarse para purificar anticuerpos que se basan en cadenas pesadas de IgG1, IgG2 o IgG4 humanas (Lindmark et al., J. Immunol Meth.

62: 1-13 (1983)). La proteína G se recomienda para todos los isotipos de ratón y para IgG3 humana (Guss et al., EMBO J. 5: 1567-1575 (1986)). La matriz a la que se fija el ligando de afinidad es generalmente agarosa, pero otras matrices están disponibles. Las matrices mecánicamente estables tales como vidrio de poro controlado o poli(estirenodivinil)benceno permiten caudales más rápidos y tiempos de procesamiento más cortos que pueden conseguirse con agarosa. Cuando el anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, comprende un dominio CH3, la resina Bakerbond ABXTM (J. T. Baker, Phillipsburg, N.J.) es útil para purificación. Otras técnicas para purificación de proteínas tales como fraccionamiento en una columna de intercambio iónico, precipitación con etanol, HPLC de fase inversa, cromatografía en sílice, cromatografía en heparina, cromatografía en SEPHAROSE™ en una resina de intercambio aniónico o catiónico (tales como columna de ácido poliaspártico), cromatoenfoque, SDS-PAGE y precipitación con sulfato de amonio también están disponibles dependiendo del anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, a recuperar. Después de cualquier etapa o etapas de purificación preliminares, la mezcla que comprende el anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, de interés y contaminantes pueden someterse a cromatografía de interacción hidrófoba a pH bajo usando un tampón de elución a un pH entre aproximadamente 2,5-4,5, preferentemente realizada a bajas concentraciones de sal (por ejemplo, sal de aproximadamente 0-0,25 M). FORMULACIONES FARMACÉUTICAS

Las formulaciones terapéuticas del polipéptido o anticuerpo, o fragmento de anticuerpo del mismo (por ejemplo fragmento de unión al antígeno), o variante de anticuerpo del mismo, pueden prepararse para almacenamiento como formulaciones liofilizadas o soluciones acuosas mezclando el polipéptido que tiene el grado de pureza deseado con vehículos, excipientes o estabilizantes “farmacéuticamente aceptables” normalmente empleados en la técnica (todos los cuales se denominan “excipientes”). Por ejemplo, agentes tamponantes, agentes estabilizantes, conservantes, agentes que otorgan isotonicidad, detergentes no iónicos, antioxidantes y otros aditivos diversos. (Véase Remington's Pharmaceutical Sciences, 16ª edición A. Osol, Ed. (1980))). Dichos aditivos deben ser no tóxicos para los receptores a las dosis y concentraciones empleadas. Los agentes tamponantes ayudan a mantener el pH en el intervalo que se aproxima a las condiciones fisiológicas.

Están presentes preferentemente a una concentración que varía entre aproximadamente 2 mM y aproximadamente 50 mM. Los agentes tamponantes adecuados para uso con la presente invención incluyen ácidos tanto orgánicos como inorgánicos y sales de los mismos tales como tampones de citrato (por ejemplo, mezcla de citrato monosódico-citrato disódico, mezcla de ácido cítrico-citrato trisódico, mezcla de ácido cítrico-citrato monosódico, etc.), tampones de succinato (por ejemplo, mezcla de ácido succínico-succinato monosódico, mezcla de ácido succínico-hidróxido sódico, mezcla de ácido succínico-succinato disódico, etc.), tampones de tartrato (por ejemplo, ácido tartárico-tartrato sódico, mezcla de ácido tartárico-tartrato potásico, mezcla de ácido tartárico-hidróxido sódico, etc.), tampones de fumarato (por ejemplo, mezcla de ácido fumárico-fumarato monosódico, etc.), tampones de fumarato (por ejemplo, mezcla de ácido fumárico-fumarato monosódico, mezcla de ácido fumárico-fumarato disódico, mezcla de fumarato monosódico-fumarato disódico, etc.), tampones de gluconato (por ejemplo, mezcla de ácido glucónico-gluconato sódico, mezcla de ácido glucónico-hidróxido sódico, mezcla de ácido glucónico-gluconato potásico, etc.), tampón de oxalato (por ejemplo, mezcla de ácido oxálico-oxalato sódico, mezcla de ácido oxálico- hidróxido sódico, mezcla de ácido oxálico-oxalato potásico, etc.), tampones de lactato (por ejemplo, mezcla de ácido láctico-lactato sódico, mezcla de ácido láctico-hidróxido sódico, mezcla de ácido láctico-lactato potásico, etc.) y tampones de acetato (por ejemplo, mezcla de ácido acético-acetato sódico, mezcla de ácido acético-hidróxido sódico, etc.). Adicionalmente, pueden mencionarse tampones de fosfato, tampones de histidina y sales de trimetilamina tales como Tris. Pueden añadirse conservantes para retrasar el crecimiento microbiano y pueden añadirse en cantidades que varían entre el 0,2 %-1 % (p/v). Conservantes adecuados para uso con la presente invención incluyen fenol, alcohol bencílico, meta-cresol, metilparabeno, propilparabeno, cloruro de octadecildimetilbencilamonio, haluros de benzalconio (por ejemplo, cloruro, bromuro, yoduro), cloruro de hexametonio, alquilparabenos tales como metil o propilparabeno, catecol, resorcinol, ciclohexanol y 3-pentanol. Pueden añadirse agentes que otorgan isotonicidad algunas veces conocidos como “estabilizantes” para garantizar la isotonicidad de composiciones líquidas de la presente invención e incluyen alcoholes de azúcares polihidroxilados, preferentemente alcoholes de azúcares trihidroxilados o superiores, tales como glicerina, eritritol, arabitol, xilitol, sorbitol y manitol. Los estabilizantes se refieren a una amplia categoría de excipientes cuya función puede variar desde un agente de carga a un aditivo que solubiliza el agente terapéutico o ayuda a prevenir la desnaturalización o adherencia a la pared del recipiente. Los estabilizantes típicos pueden ser alcoholes de azúcares polihidroxilados (enumerados anteriormente); aminoácidos tales como arginina, lisina, glicina, glutamina, asparagina, histidina, alanina, ornitina, L- leucina, 2-fenilalanina, ácido glutámico, treonina, etc., azúcares orgánicos o alcoholes de azúcar, tales como lactosa, trehalosa, estaquiosa, manitol, sorbitol, xilitol, ribitol, mioinositol, galactitol, glicerol y similares, incluyendo ciclitoles tales como inositol; polietilenglicol; polímeros de aminoácidos; agentes reductores que contienen azufre, tales como urea, glutatión, ácido tióctico, tioglicolato sódico, tioglicerol, alfa-monotioglicerol y tiosulfato sódico; polipéptidos de bajo peso molecular (es decir <10 residuos); proteínas tales como albúmina de suero humano, albúmina de suero bovino, gelatina o inmunoglobulinas; polímeros hidrófilos, tales como monosacáridos de polivinilpirrolidona, tales como xilosa, manosa, fructosa, glucosa; disacáridos tales como lactosa, maltosa, sacarosa y trisacáridos tales como rafinosa; polisacáridos tales como dextrano. Los estabilizantes pueden estar presentes en el intervalo de 0,1 a 10.000 partes en peso por parte en peso de proteína activa.

Pueden añadirse tensioactivos no iónicos o detergentes (también conocidos como “agentes humectantes”) para ayudar a solubilizar el agente terapéutico así como para proteger a la proteína terapéutica contra la agregación inducida por agitación, lo que también permite que la formulación se exponga a esfuerzo de cizallamiento superficial sin causar la desnaturalización de la proteína. Los tensioactivos no iónicos adecuados incluyen polisorbatos (20, 80, etc.), polioxámeros (184,188 etc.), Pluronic.RTM. polioles, monoéteres de polioxietilensorbitán (Tween.RTM.-20, Tween.RTM.-80, etc.). Los tensioactivos no iónicos pueden estar presentes en un intervalo de aproximadamente 0,05 mg/ml a aproximadamente 1,0 mg/ml, preferentemente de aproximadamente 0,07 mg/ml a aproximadamente 0,2 mg/ml.

Los excipientes diversos adicionales incluyen agentes de carga, (por ejemplo almidón), agentes quelantes (por ejemplo EDTA), antioxidantes (por ejemplo, ácido ascórbico, metionina, vitamina E) y codisolventes. La formulación en el presente documento también puede contener más de un compuesto activo según sea necesario para la indicación particular que está siendo tratada, preferentemente aquellos con actividades complementarias que no se afectan de forma adversa entre sí. Por ejemplo, puede ser deseable proporcionar adicionalmente un agente inmunosupresor. Dichas moléculas están adecuadamente presentes en combinación en cantidades que son eficaces para el fin pretendido. Los ingredientes activos también pueden estar atrapados en microcápsulas preparadas, por ejemplo, mediante técnicas de coacervación o mediante polimerización interfacial, por ejemplo, microcápsulas de hidroximetilcelulosa o gelatina y microcápsulas de poli-(metacrilato de metilo), respectivamente, en sistemas de administración de fármacos coloidales (por ejemplo, liposomas, microesferas de albúmina, microemulsiones, nanopartículas y nanocápsulas) o en macroemulsiones. Dichas técnicas se desvelan en Remington's Pharmaceutical Sciences, 16ª edición, A. Osal, Ed. (1980). Las formulaciones a usar para administración in vivo deben ser estériles. Esto se consigue fácilmente, por ejemplo, mediante filtración a través de membranas de filtración estériles. Pueden prepararse preparaciones de liberación sostenida. Los ejemplos adecuados de preparaciones de liberación sostenida incluyen matrices semipermeables de polímeros hidrófobos sólidos que contienen el anticuerpo, o variante o fragmento de anticuerpo (por ejemplo fragmento de unión al antígeno) del mismo, matrices que están en forma de artículos conformados, por ejemplo, películas, o microcápsulas. Los ejemplos de matrices de liberación sostenida incluyen poliésteres, hidrogeles (por ejemplo, poli(metacrilato de 2-hidroxietilo), o poli(alcohol vinílico)), polilactidas (patente de Estados Unidos n.º 3.773.919), copolímeros de ácido L-glutámico y L-glutamato de etilo, acetato de etilenvinilo no degradable, copolímeros de ácido láctico-ácido glicólico degradables tales como LUPRON DEPOT™ (microesferas inyectables compuestas por copolímero de ácido láctico-ácido glicólico y acetato de leuprolida) y ácido poli-D-(-)-3- hidroxibutírico. Aunque polímeros tales como acetato de etilenvinilo y ácido láctico-ácido glicólico permiten la liberación de moléculas durante más de 100 días, ciertos hidrogeles liberan proteínas durante periodos de tiempo más cortos. Cuando los anticuerpos encapsulados permanecen en el cuerpo durante un largo periodo, pueden desnaturalizarse o agregarse como resultado de la exposición a la humedad a 37°C dando como resultado una pérdida de actividad biológica y posibles cambios de la inmunogenicidad. Pueden idearse estrategias racionales para estabilización dependiendo del mecanismo implicado. Por ejemplo, si se descubre que el mecanismo de agregación es la formación de enlaces S-S intermoleculares a través de intercambio tio-disulfuro, la estabilización puede conseguirse modificando residuos sulfhidrilo, liofilizando a partir de soluciones ácidas, controlando el contenido de humedad, usando aditivos apropiados y desarrollando composiciones de matrices poliméricas específicas. Los compuestos de la invención para la prevención o el tratamiento de una enfermedad o afección ocular se administran normalmente mediante inyección ocular, intraocular y/o intravítrea y/o inyección yuxtaescleral y/o inyección subtenoniana y/o inyección supercoroidea y/o administración tópica en forma de colirio y/o pomada. Dichos compuestos de la invención pueden administrarse mediante diversas vías, por ejemplo por vía intravítrea como un dispositivo y/o un depósito que permite la liberación lenta del compuesto al interior del humor vítreo, incluyendo los descritos en referencias tales como Intraocular Drug Delivery, Jaffe, Jaffe, Ashton y Pearson, editores, Taylor & Francis (Marzo de 2006). En un ejemplo, un dispositivo puede estar en forma de una minibomba y/o una matriz y/o un sistema de difusión pasiva y/o células encapsuladas que liberan el compuesto durante un periodo de tiempo prolongado (Intraocular Drug Delivery, Jaffe, Jaffe, Ashton y Pearson, editores, Taylor & Francis (Marzo de 2006). También pueden usarse otros métodos de administración, que incluyen aunque no se limitan a, administración tópica, parenteral, subcutánea, intraperitoneal, intrapulmonar, intranasal e intralesional. Las infusiones parenterales incluyen administración intramuscular, intravenosa, intraarterial, intraperitoneal o subcutánea. Las formulaciones para administración ocular, intraocular o intravítrea pueden prepararse mediante métodos y usando ingredientes conocidos en la técnica. Un requisito principal para un tratamiento eficiente es la apropiada penetración a través del ojo. A diferencia de enfermedad de la parte frontal del ojo, donde los fármacos pueden administrarse por vía tópica, las enfermedades retinianas requieren un enfoque más específico del sitio. Los colirios y las pomadas raramente penetran en la parte posterior del ojo y la barrera hematoocular obstaculiza la penetración de fármacos administrados por vía sistémica al interior del tejido ocular. Por consiguiente, habitualmente el método de elección para la administración de fármacos para tratar una enfermedad retiniana, tal como DMAE y NVC, es inyección intravítrea directa. Las inyecciones intravítreas se repiten habitualmente a intervalos que dependen de la afección del paciente y las propiedades y semivida del fármaco administrado. Para penetración intraocular (por ejemplo intravítrea), habitualmente se prefieren moléculas de tamaño más pequeño. La eficacia del tratamiento de afecciones oculares asociadas con el complemento, tales como DMAE o NVC, puede medirse mediante diversos criterios de valoración usados habitualmente en la evaluación de enfermedades intraoculares. Por ejemplo, puede valorarse la pérdida de visión. La pérdida de visión puede evaluarse midiendo, aunque sin limitarse a esto, por ejemplo, el cambio medio de la agudeza visual mejor corregida (BCVA) desde el inicio hasta un punto temporal deseado (por ejemplo, en donde la BCVA se basa en un cuadro de agudeza visual de un estudio de retinopatía diabética con tratamiento temprano (RDTT) y evaluación a una distancia de ensayo de 4 metros), midiendo la proporción de sujetos que pierden menos de 15 letras de agudeza visual en un punto temporal deseado en comparación con la situación inicial, midiendo la proporción de sujetos que ganan más de o igual a 15 letras de agudeza visual en un punto temporal deseado en comparación con la situación inicial, midiendo la proporción de sujetos con una agudeza visual Snellen equivalente de 20/2000 o peor en un punto temporal deseado, midiendo el cuestionario de funcionamiento visual NEI, midiendo el tamaño de NVC y la cantidad de fuga de NVC en un punto temporal deseado, por ejemplo, mediante angiografía con fluoresceína, etc. Pueden realizarse valoraciones oculares, por ejemplo, que incluyen, aunque sin limitarse a, por ejemplo, realizar un examen ocular, medir la presión intraocular, valorar la agudeza visual, medir la presión con lámpara de hendidura, valorar la inflamación intraocular, etc. La cantidad de polipéptido terapéutico, anticuerpo, o variante de anticuerpo del mismo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) que será eficaz en el tratamiento de un trastorno o afección particular dependerá de la naturaleza del trastorno o afección y puede determinarse mediante técnicas clínicas convencionales. Cuando sea posible, es deseable determinar la curva de dosis-respuesta y las composiciones farmacéuticas de la invención primero in vitro y a continuación en sistemas de modelos animales útiles antes de probarlas en seres humanos.

Una solución acuosa de polipéptido terapéutico, anticuerpo, o variante de anticuerpo del mismo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno), puede administrarse mediante inyección subcutánea. Como alternativa, una solución acuosa de polipéptido terapéutico, anticuerpo, o variante de anticuerpo del mismo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) puede administrarse mediante inyección intravítrea. Cada dosis puede variar entre aproximadamente 0,5 µg y aproximadamente 50 µg por kilogramo de peso corporal, o más preferentemente, de aproximadamente 3 µg a aproximadamente 30 µg por kilogramo de peso corporal. El programa de dosificación para administración subcutánea puede variar de una vez al mes a diariamente dependiendo de una serie de factores clínicos, incluyendo el tipo de enfermedad, la gravedad de la enfermedad y la sensibilidad del sujeto al agente terapéutico. Los siguientes ejemplos se ofrecen para fines ilustrativos solamente y no pretenden limitar el alcance de la presente invención en modo alguno.

ARTÍCULOS DE FABRICACIÓN Y KITS En el presente documento se describe un artículo de fabricación que contiene materiales útiles para el tratamiento, la prevención y/o el diagnóstico de afecciones diana de los anticuerpos de la invención, o variantes de los mismos o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno): Por ejemplo, en el presente documento se describe un artículo de fabricación que contiene materiales útiles para el tratamiento, la prevención y/o el diagnóstico de trastornos asociados al complemento. El artículo de fabricación comprende un recipiente y una etiqueta o inserto en el envase en o asociado al recipiente. Los recipientes adecuados incluyen, por ejemplo, frascos, viales, jeringas, etc. Los recipientes pueden estar formados de diversos materiales tales como vidrio o plástico. El recipiente contiene una composición que es eficaz para tratar, prevenir y/o diagnosticar la afección asociada al complemento y puede tener un orificio de acceso estéril (por ejemplo el recipiente puede ser una bolsa de solución intravenosa o un vial que tiene un tapón perforable mediante una aguja de inyección hipodérmica). Al menos un agente activo en la composición es un anticuerpo anti-Factor D, o fragmento del mismo (por ejemplo fragmento de unión al antígeno). La etiqueta o inserto en el envase indica que la composición es útil para el tratamiento, la prevención y/o el diagnóstico de una afección particular. Inserto en el envase se refiere a instrucciones incluidas normalmente en envases comerciales de productos terapéuticos que contienen información sobre las indicaciones, el uso, la posología, la administración, contraindicaciones y/o advertencias relativas al uso de dichos productos terapéuticos. Tal como se describe en el presente documento, la etiqueta o el inserto en el envase indica que la composición se usa para tratar trastornos asociados al complemento, tales como, por ejemplo, cualquiera de las afecciones enumeradas anteriormente, incluyendo trastornos oculares por ejemplo degeneración macular asociada a la edad (DMAE). La etiqueta o el inserto en el envase comprenderán adicionalmente instrucciones para administrar la composición de anticuerpo al paciente.

Adicionalmente, el artículo de fabricación puede comprender además un segundo recipiente que comprende un tampón farmacéuticamente aceptable, tal como agua para inyección bacteriostática (BWFI), solución salina tamponada con fosfato, solución de Ringer y solución de dextrosa. Puede incluir además otros materiales deseables desde un punto de vista comercial y del usuario, incluyendo otros tampones, diluyentes, filtros, agujas y jeringas.

También se proporcionan kits que son útiles para diversos fines, por ejemplo, para el tratamiento, la prevención y/o el diagnóstico de trastornos asociados al complemento, para ensayos de hemólisis asociada al complemento, para purificación o inmunoprecipitación de polipéptido del Factor D a partir de células. Para aislamiento y purificación de polipéptido del Factor D, el kit puede contener un anticuerpo anti-Factor D acoplado a perlas (por ejemplo, perlas de sefarosa). Pueden proporcionarse kits que contienen los anticuerpos para detección y cuantificación del polipéptido del Factor D in vitro, por ejemplo, en un ELISA o una transferencia de Western. Como con el artículo de fabricación, el kit comprende un recipiente y una etiqueta o inserto en el envase en o asociado al recipiente. El recipiente contiene una composición que comprende al menos un anticuerpo anti-Factor, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) de la invención. Pueden estar incluidos recipientes adicionales que contienen, por ejemplo, diluyentes y tampones, anticuerpos de control. La etiqueta o inserto en el envase puede proporcionar una descripción de la composición así como instrucciones para el uso in vitro o de detección pretendido. La etiqueta o inserto en el envase puede proporcionar instrucciones para la administración (por ejemplo el anticuerpo, o fragmento de anticuerpo del mismo (por ejemplo fragmento de unión al antígeno) a un sujeto. USOS PARA EL ANTICUERPO HUMANIZADO

Los anticuerpos humanizados, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) o variante de los mismos, de la presente invención son útiles en ensayos de diagnóstico, por ejemplo, para detectar la expresión de una diana de interés en células, tejidos o suero específicos. Para aplicaciones de diagnóstico, el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), normalmente estará marcado con un resto detectable. Están disponibles numerosas marcas. Las técnicas para cuantificar un cambio de la fluorescencia se han descrito anteriormente. El sustrato quimioluminiscente se vuelve electrónicamente excitado mediante una reacción química y puede emitir luz que puede medirse (usando un quimioluminómetro, por ejemplo) o dona energía a un aceptor fluorescente. Los ejemplos de marcas enzimáticas incluyen luciferasea (por ejemplo, luciferasa de luciérnaga y luciferasa bacteriana; patente de Estados Unidos n.º 4.737.456), luciferina, 2,3-dihidroftalazinedionas, malato deshidrogenasa, ureasa, peroxidasa tal como peroxidasa de rábano picante (HRPO), fosfatasa alcalina, beta-galactosidasa, glucoamilasa, lisozima, sacárido oxidasas (por ejemplo, glucosa oxidasa, galactosa oxidasa y glucosa-6-fosfato deshidrogenasa), oxidasas heterocíclicas (tales como uricasa y xantina oxidasa), lactoperoxidasa, microperoxidasa y similares. Técnicas para conjugar enzimas a anticuerpos se describen en O'Sullivan et al., Methods for the Preparation of Enzyme-Antibody Conjugates for Use in Enzyme Immunoassay, en Methods in Enzym. (Ed. J. Langone & H. Van Vunakis), Academic press, Nueva York, 73: 147-166 (1981). Algunas veces, la marca está conjugada indirectamente con el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno). El experto en la materia será consciente de diversas técnicas para conseguir esto. Por ejemplo, el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), puede conjugarse con biotina y cualquiera de las tres amplias categorías de marcas mencionadas anteriormente puede conjugarse con avidina, o viceversa. La biotina se une selectivamente a avidina y por lo tanto, la marca puede conjugarse con el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), de esta manera indirecta. Como alternativa, para conseguir conjugación indirecta de la marca con el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), se conjuga con un pequeño hapteno (por ejemplo digloxina) y uno de los diferentes tipos de marcas mencionados anteriormente se conjuga con un anticuerpo anti-hapteno, o variante de anticuerpo del mismo (por ejemplo anticuerpo anti-digloxina) o fragmento del mismo (por ejemplo fragmento de unión al antígeno). Por lo tanto, la conjugación indirecta de la marca con el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), puede conseguirse. El anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), no necesita estar marcado y la presencia del mismo puede detectarse usando un anticuerpo marcado que se une al anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno). Los anticuerpos, o variantes de anticuerpo de los mismos, o fragmento de los mismos (por ejemplo fragmento de unión al antígeno) de la presente invención pueden emplearse en cualquier método de ensayo conocido, tal como ensayos de unión competitiva, ensayos sándwich directos e indirectos y ensayos de inmunoprecipitación. Zola, Monoclonal Antibodies: A Manual of Techniques, págs. 147-158 (CRC Press, Inc. 1987). Los ensayos de unión competitiva se basan en la capacidad de un patrón marcado para competir con la muestra de ensayo por la unión con una cantidad limitada de anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno). La cantidad de diana en la muestra de ensayo es inversamente proporcional a la cantidad de patrón que se une a los anticuerpos. Para facilitar la determinación de la cantidad de patrón que se une, los anticuerpos generalmente se insolubilizan antes o después de la competición. Como resultado, el patrón y la muestra de ensayo que se unen a los anticuerpos pueden separarse convenientemente del patrón y la muestra de ensayo que quedan sin unirse.

Los ensayos sándwich implican el uso de dos anticuerpos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) cada uno capaz de unirse a una parte inmunógena diferente, o epítopo, o a la proteína a detectar. En un ensayo sándwich, a la muestra de ensayo a analizar se le une un primer anticuerpo que está inmovilizado en un soporte sólido y seguidamente un segundo anticuerpo se une a la muestra de ensayo, formando de este modo un complejo de tres partes insoluble. Véase por ejemplo, patente de Estados Unidos n.º 4.376.110. El segundo anticuerpo puede estar, a su vez, marcado con un resto detectable (ensayos sándwich directos) o puede medirse usando un anticuerpo anti-inmunoglobulina que está marcado con un resto detectable (ensayo sándwich indirecto). Por ejemplo, un tipo de ensayo sándwich es un ensayo ELISA, en cuyo caso el resto detectable es una enzima Para inmunohistoquímica, la muestra tumoral puede ser fresca o congelada o puede estar incluida en parafina y fijada con un conservante tal como formalina, por ejemplo. Los anticuerpos, o variantes de anticuerpo de los mismos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) también pueden usarse para ensayos de diagnóstico in vivo. Generalmente, el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), está marcado con un radionúclido (tal como 111 In, 99 Tc, 14 C, 131 I, 3. H, 32 P o 35 S) de modo que el tumor pueda localizarse usando immunoescintiografía. Por ejemplo, un anticuerpo anti-IgE de alta afinidad de la presente invención puede usarse para detectar la cantidad de IgE presente en, por ejemplo, los pulmones de un paciente asmático.

El anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), de la presente invención puede proporcionarse en un kit, es decir, combinación de reactivos envasada en cantidades predeterminadas con instrucciones para realizar el ensayo de diagnóstico. Cuando el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), está marcado con una enzima, el kit puede incluir sustratos y cofactores requeridos por la enzima (por ejemplo, un precursor de sustrato que proporciona el cromóforo o fluoróforo detectable). Además, pueden incluirse otros aditivos tales como estabilizantes, tampones (por ejemplo, un tampón de bloqueo o tampón de lisis) y similares. Las cantidades relativas de los diversos reactivos pueden modificarse ampliamente para proporcionar concentraciones en solución de los reactivos que sustancialmente optimizan la sensibilidad del ensayo. Particularmente, los reactivos pueden estar provistos como polvos secos, habitualmente liofilizados, incluyendo excipientes que en disolución proporcionarán una solución de reactivo que tiene la concentración apropiada. USOS IN VIVO PARA EL ANTICUERPO

Se contempla que los anticuerpos, o anticuerpos de los mismos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) de la presente invención pueden usarse para tratar a un mamífero. Descrito en el presente documento, el anticuerpo, o anticuerpo del mismo, se administra a un mamífero no humano para los fines de obtener datos preclínicos, por ejemplo. Los mamíferos no humanos ejemplares a tratar incluyen primates no humanos, perros, gatos, roedores y otros mamíferos en los que se realizan estudios preclínicos. Dichos mamíferos pueden ser modelos animales establecidos para una enfermedad a tratar con el anticuerpo, o anticuerpo del mismo, o pueden usarse para estudiar la toxicidad del anticuerpo de interés. Pueden realizarse estudios de aumento a escala de la dosis en el mamífero. El anticuerpo, o variante del mismo, o fragmento del mismo (por ejemplo fragmento de unión al antígeno) o polipéptido se administra mediante cualquier medio adecuado, incluyendo administración parenteral, subcutánea, intraperitoneal, intrapulmonar e intranasal, y, si se desea para tratamiento inmunosupresor local, intralesional. Las infusiones parenterales incluyen administración intramuscular, intravenosa, intraarterial, intraperitoneal o subcutánea. Además, el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), es administrado adecuadamente mediante infusión de pulsos, particularmente con dosis decrecientes del anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno). Preferentemente la dosis se administra mediante inyecciones, de la forma más preferente inyecciones intravenosas o subcutáneas, dependiendo en parte de si la administración es breve o crónica.

Para la prevención o el tratamiento de una enfermedad, la dosificación apropiada del anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), o polipéptido dependerá del tipo de enfermedad a tratar, la gravedad y evolución de la enfermedad, de si el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), se administra para fines preventivos o terapéuticos, de la terapia previa, de los antecedentes médicos del paciente y de la respuesta al anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno) y la discreción del facultativo a cargo.

Dependiendo del tipo y la gravedad de la enfermedad, aproximadamente 0,1 mg/kg a 150 mg/kg (por ejemplo, 0,1- 20 mg/kg) de anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), es una dosificación candidata inicial para administración al paciente, ya sea, por ejemplo, mediante una o más administraciones independientes, o mediante infusión continua. Una dosificación diaria típica podría variar entre aproximadamente 1 mg/kg y 100 mg/kg o más, dependiendo de los factores mencionados anteriormente. Para administraciones repetidas durante varios días o más, dependiendo de la afección, el tratamiento es sostenido hasta que se produce una supresión deseada de los síntomas de la enfermedad. Sin embargo, otros regímenes de dosificación pueden ser útiles. La evaluación de esta terapia es monitorizada fácilmente mediante técnicas y ensayos convencionales. Un régimen de dosificación ejemplar se desvela en el documento WO 94/04188. Las composiciones de anticuerpos pueden formularse, dosificarse y administrarse de una manera coherente con las buenas prácticas médicas. Los factores a considerar en este contexto incluyen el trastorno particular que está siendo tratado, el mamífero particular que está siendo tratado, la afección clínica del paciente individual, la causa del trastorno, el punto de administración del agente, la vía de administración, la programación de la administración y otros factores conocidos por los facultativos médicos. La “cantidad terapéuticamente eficaz” del anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), a administrar estará regida por dichas consideraciones y es la cantidad mínima necesaria para prevenir, mejorar o tratar una enfermedad o trastorno. No es necesario, aunque es opcional, que el anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), se formule con uno o más agentes usados actualmente para prevenir o tratar el trastorno en cuestión. La cantidad eficaz de dichos otros agentes depende de la cantidad de anticuerpo, o variante de anticuerpo del mismo o fragmento del mismo (por ejemplo fragmento de unión al antígeno), presente en la formulación, el tipo de trastorno o tratamiento y otros factores descritos anteriormente. Estos se usan generalmente a las mismas dosificaciones y con las vías de administración tal como se han usado en el presente documento anteriormente o aproximadamente del 1 al 99 % de las dosificaciones empleadas hasta el momento. Los anticuerpos, o variantes de anticuerpo de los mismos, o fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) de la presente invención que reconocen al Factor D como su diana pueden usarse para tratar trastornos mediados por el complemento. Estos trastornos están asociados con activación excesiva o incontrolada del complemento. Estos incluyen: activación del complemento durante operaciones de bypass cardiopulmonar; activación del complemento debido a isquemia-reperfusión después de infarto de miocardio agudo, aneurisma, apoplejía, choque hemorrágico, lesión por aplastamiento, fallo multiorgánico, choque hipovolémico e isquemia intestinal. Estos trastornos también pueden incluir una enfermedad o afección que es una afección inflamatoria tal como quemaduras graves, endotoxemia, choque séptico, síndrome de dificultad respiratoria del adulto, hemodiálisis; choque anafiláctico, asma grave, angioedema, enfermedad de Crohn, anemia de células falciformes, glomerulonefritis posestreptocócica y pancreatitis. El trastorno puede ser el resultado de una reacción adversa a un fármaco, alergia a un fármaco, síndrome de fuga vascular inducido por IL-2 o alergia a medios de contraste radiográfico. También incluye una enfermedad autoinmunitaria tal como lupus eritematoso sistémico, miastenia grave, artritis reumatoide, enfermedad de Alzheimer y esclerosis múltiple. La activación del complemento también está asociada con rechazo del trasplante. Recientemente ha habido una fuerte correlación mostrada entre la activación del complemento y enfermedades oculares tales como degeneración macular asociada a la edad, retinopatía diabética y otras retinopatías asociadas a isquemia, neovascularización coroidea (NVC), uveitis, edema macular diabético, miopía patológica, enfermedad de von Hippel-Lindau, histoplasmosis del ojo, oclusión de la vena central de la retina (OVCR), neovascularización corneal y neovascularización retiniana. Ejemplos Los siguientes ejemplos se ofrecen a modo de ilustración y no a modo de limitación. Se usaron reactivos disponibles en el mercado mencionados en los ejemplos de acuerdo con las instrucciones del fabricante a menos que se indique lo contrario. La fuente de aquellas células identificadas en los siguientes ejemplos y en toda la memoria descriptiva, mediante números de entrada en la ATCC es la American Type Culture Collection (Colección Americana de Cultivos Tipo), 10801 University Boulevard, Manassas, VA 20110-2209.

Ejemplo 1: Modificación de Abs Anti-Factor D Para identificar anticuerpos anti-Factor D modificados y variantes de los mismos y fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno) que tendrían características deseables desde el punto de vista comercial tales como homogeneidad durante la fabricación y la producción o para fines de caracterización analítica, se usó un enfoque de mutagénesis dirigida para generar anticuerpos anti-Factor D humanizados modificados y variantes de los mismos y fragmentos de los mismos (por ejemplo fragmentos de unión al antígeno). En primer lugar, los dominios de cadena pesada y cadena ligera variables del clon n.º 111 de Fab anti-Factor D humanizado (SEC ID Nº: 2 y SEC ID Nº: 1, respectivamente) se subclonaron en un plásmido de expresión. En segundo lugar, oligonucleótidos que codifican mutaciones individuales se hibridaron con el plásmido de expresión resultante para introducir las mutaciones dirigidas.

Inicialmente, los dominios de cadena pesada y cadena ligera variables del clon n.º 111 de Fab anti-Factor D humanizado se subclonaron en el plásmido pAEP1 (pAEP1 es un plásmido para la expresión de anticuerpos Fab en E.coli.), con la subclonación dando como resultado la introducción de una valina (V) en la posición 104 (de acuerdo con la numeración de Kabat, véase la figura 10) del dominio de cadena ligera variable.

La subclonación del dominio de cadena ligera variable del clon n.º 111 de Fab anti-Factor D humanizado en pAEP1 implicaba el ligamiento de dos fragmentos de ADN. El primer fragmento era el vector pAEP1 en el que el pequeño fragmento EcoRV/Kpnl se había eliminado. El segundo fragmento era un fragmento de PCR EcoRV-Kpnl de aproximadamente 300 pares de bases generado a partir del plásmido de cadena ligera para el clon n.º 111 de Fab anti-Factor D humanizado, usando los siguientes cebadores: 5'-TTTCCCTTTGATATCCAGGTGACCCAGTCTCCATCCT-3' (SEC ID Nº: 67) 5'-TTTCCCTTTGGTACCCTGGCCAAACGTGTACGGCAAAGAATC-3' (SEC ID Nº: 68).

La subclonación del dominio de cadena ligera variable del clon n.º 111 anti-Factor D humanizado en pAEP1 introdujo una valina (V) en la posición 104 dado que la posición 104 está 2 aminoácidos aguas abajo de los sitios de endonucleasa de restricción, EcoRV y Kpnl, que se usaron para insertar el dominio de cadena ligera variable del clon n.º 111 anti-Factor D humanizado en pAEP1 y por lo tanto en la cadena principal del plásmido pAEP1. Este plásmido intermedio resultante se denomina en el presente documento como “pAEP1-283-VL”.

La subclonación del dominio de cadena pesada variable del clon n.º 111 anti-Factor D humanizado en pAEP1-238- VL implicaba el ligamiento de dos fragmentos de ADN. El primer fragmento era el vector pAEP1-238-VL en el que el pequeño fragmento BsiWI/PspOMI había sido eliminado. El segundo fragmento era un fragmento de PCR BsiWI- PspOMI de aproximadamente 364 pares de bases generados a partir del plásmido de cadena pesada para el clon n.º 111 de Fab anti-Factor D humanizado, usando los siguientes cebadores: 5'-TTTGGGTTTCGTACGCTCAGGTCCAGCTGGTGCAATCTGGG-3' (SEC ID Nº: 69) 5'-TTTGGGTTTGGGCCCTTGGTGGAGGCTGAGGAGACGGTGACCAGGGT-3' (SEC ID Nº: 70).

Este ligamiento de los dos fragmentos de ADN dio como resultado el plásmido para la variante 238 del anticuerpo Fab anti-Factor D humanizado (denominada también en el presente documento como “238”; el plásmido se denomina en el presente documento como “p238”). Después de la subclonación de los dominios de cadena ligera y pesada variables de anti-Factor D n.º 111 humanizado, se usó mutagénesis dirigida por PCR para mutar la glutamina (Q) en la posición 1 (de acuerdo con la numeración de Kabat, véase la figura 1) de la cadena pesada variable de la variante 238 del anticuerpo Fab anti- Factor D humanizado a un glutamato (E), dando como resultado la variante 238-1 del anticuerpo Fab anti-Factor D humanizado (también denominada en el presente documento como “238-1”). La construcción del plásmido para la variante 238-1 del anticuerpo Fab anti-Factor D humanizado (el plásmido se denomina en el presente documento como “p238-1”) implicaba el ligamiento de dos fragmentos de ADN. El primer fragmento era el vector p238 en el que el fragmento pequeño BsiWI/PspOMI había sido eliminado. El segundo fragmento era un fragmento BsiWI-PspOMI PCR de aproximadamente 364 pares de bases generado a partir del plásmido p238, usando los siguientes cebadores: 5'-TTTGGGTTTCGTACGCTGAAGTCCAGCTGGTGCAATCTGGG-3' (SEC ID Nº: 71) 5'-TTTGGGTTTGGGCCCTTGGTGGAGGCTGAGGAGACGGTGACCAGGGT-3' (SEC ID Nº: 72).

Este ligamiento de los dos fragmentos de ADN dio como resultado el plásmido para la variante 238-1 del anticuerpo Fab anti-Factor D humanizado (también denominado en el presente documento como “238-1”; el plásmido se denomina en el presente documento como “p238-1”), que incluía la mutación dirigida de la posición 1 a un glutamato (E). Se descubrió que esta mutación inhibe la conversión parcial de la glutamina (Q) en la variante 238-1 del anticuerpo Fab anti-Factor D humanizado en piroglutamato (Amphlett, G. et al., Pharm. Biotechnol., 9: 1-140 (1996)). Puede usarse mutagénesis dirigida por PCR adicional para mutar residuos de metionina (M o Met) o triptófano (W o Trp) para prevenir la oxidación o para mutar residuos de asparagina (N o Asn) para prevenir la desamidación. Para prevenir la formación de variantes oxidadas de los anticuerpos anti-Factor D humanizados, metioninas (M o Met), por ejemplo en la posición 33 de la cadena ligera pueden mutarse a (L o Leu) que es el más similar en tamaño e hidrofobicidad a metionina, pero carece de un azufre para oxidación, o como alternativa mutarse a isoleucina (I o Ile) (Amphlett, G. et al., Pharm. Biotechnol., 9: 1-140 (1996)). Para prevenir la formación de variantes desamidadas de los anticuerpos anti-Factor D humanizados, asparaginas (N o Asn), por ejemplo en la posición 34 y 52 de la cadena ligera o la posición 99 o 100 de la cadena pesada pueden mutarse a glutamina (Q o Gin) que es la más similar químicamente a asparagina (N o Asn), o mutarse a alanina (A o Ala) o serina (S o Ser) que son sustituciones comunes en esas posiciones en otros anticuerpos (Amphlett, G. et al., Pharm. Biotechnol., 9: 1-140 (1996)).

Las figuras 1-2 muestran las secuencias del dominio de cadena ligera variable y el dominio de cadena pesada variable para la variante 238 del anticuerpo Fab anti-Factor D humanizado (SEC ID Nº: 6 y 18, respectivamente) y la variante 238-1 del anticuerpo Fab anti-Factor D humanizado (SEC ID Nº: 7 y 19, respectivamente). La figura 4 y la figura 6 muestran las secuencias de cadena ligera y cadena pesada (SEC ID Nº: 47 y 54, respectivamente) para la variante 238 del anticuerpo Fab anti-Factor D humanizado. La figura 8 y la figura 10 muestran las secuencias de cadena ligera y cadena pesada (SEC ID Nº: 61 y 63, respectivamente) para la variante 238-1 del anticuerpo Fab anti-Factor D humanizado. Los datos de BiaCore mostraban afinidad de la variante 238 del anticuerpo Fab anti-Factor D humanizado por el Factor D humano así como adicional de versión de mAb de longitud completa anti-Factor D humanizado del clon n.º 111 (mAb de longitud completa anti-Factor D humanizado 234) (denominado en el presente documento como “234” o “mAb de longitud completa anti-Factor D 234” o “MAb de longitud completa anti-Factor D humanizado 234”) (Tabla 2). Las variantes de anticuerpo Fab anti-Factor D humanizadas 238 y 238-1 también se pusieron a prueba en el ensayo de inhibición hemolítica (figura 11) para valorar la inhibición de la ruta alternativa (véase el ejemplo 3). Ejemplo 2: ensayo de hemólisis AP

La función biológica de Abs anti-Factor D modificados se determinó usando un ensayo de inhibición hemolítica usando suero humano empobrecido en C1q y análisis de BiaCore (véase el ejemplo 3 a continuación). El ensayo hemolítico se realizó de la siguiente manera.

Para determinar la actividad de la ruta alternativa, eritrocitos de conejo (Er, Colorado Serum) se lavaron 3x en GVB y se resuspendieron a 2 x 109/ml. inhibidores (50 µl) y 20 µl de la suspensión Er se mezclaron 1:1 con GVB/EGTA 0,1 M /MgCl2 0,1 M. la activación del complemento se inició mediante la adición de suero humano empobrecido en C1q (para evitar cualquier activación del complemento a través de la ruta clásica) (CompTech; 30 µl diluido 1:3 en GVB). Después de una incubación de 30 minutos a temperatura ambiente, se añadieron 200 µl de GVB/EDTA 10 mM para detener la reacción y las muestras se centrifugaron durante 5 min a 500 g. La hemólisis se determinó en 200 µl de sobrenadante midiendo la absorbancia a 412 nm. Los datos se expresaron como el % de hemólisis inducida en ausencia del inhibidor. La figura 11 muestra la inhibición del clon n.º 111 de Fab anti-Factor D humanizado (CI50 = 4,7 ± 0,6 nM), Fab 238 anti-Factor D modificado (CI50 = 6,4 ± 0,6 nM) y Fab 238-1 anti-Factor D modificado (CI50 = 3,5 ± 0,5 nM) en hemólisis por la ruta alternativa usando ensayo de hemólisis de glóbulos rojos de conejo usando suero humano empobrecido en C1 q como fuente del complemento. Los controles fueron Factor H (“fH humano”) (de CompTech) y anticuerpos anti-glucoproteína 120 ("xgp120").

Ejemplo 3: Análisis cinético de Fab anti-Factor D humano mediante BiaCore Se determinaron las constantes cinética y de afinidad para la unión del Factor D humano (Advanced Research, Inc.) a Fab 238 anti-Factor D modificado inmovilizado (denominado en el presente documento como “238”; véase el Ejemplo 1) mediante mediciones de resonancia del plasmón superficial en instrumentos BiaCore 3000 y BiaCore A100. Para los valores en la tabla 2 que se enumeran como resultado de “BiaCore 3000/BiaCore A100”, se realizaron experimentos independientes en cada instrumento, los datos de los experimentos independientes se analizaron para obtener constantes cinéticas y las constantes cinéticas se promediaron para obtener los valores mostrados en la tabla 2. Como alternativa, pueden medirse constantes cinéticas y de afinidad para la unión del Factor D humano inmovilizando el Factor D humano y midiendo la unión del mAb o Fab, pueden medirse usando diferentes condiciones de regeneración (por ejemplo que comprenden MgCl2 4 M) y/o pueden medirse usando diferentes tampones de unión (por ejemplo que comprenden PBS). La versión de mAb de longitud completa anti- Factor D humanizado del clon n.º 111 (denominada en el presente documento como “234” o “mAb de longitud completa anti-Factor D 234” o “mAb de longitud completa anti-Factor D humanizado 234”) también se analizó.

1. Inmovilización Se inmovilizaron mAb o Fab mediante acoplamiento a amina usando un protocolo convencional suministrado por el fabricante. La densidad del acoplamiento se reguló ajustando la concentración o el pH de las soluciones de mAb o Fab inyectadas de modo que la señal total ara unión de saturación del Factor D humano estaba entre 50 y 150 unidades de resonancia (UR). Después del acoplamiento de la cantidad deseada de mAb o Fab, los grupos funcionales que no reaccionaron en el chip sensor se bloquearon mediante inyección de etanolamina. 2. Análisis cinético

Se llevaron a cabo experimentos de unión inyectando alícuotas de 60 µl de una serie de soluciones del Factor D humano que variaban en concentración de 500 nM a 0,98 nM en incrementos de 2 veces. Todas las muestras se diluyeron en tampón de corrida compuesto por NaCl 150 mM, Tween-20 al 0,01 % y uno de los siguientes componentes de tampón: (a) pH 7,2 (HEPES 10 mM ácido (4-(2-hidroxietil)-1-piperazinaetanosulfónico); (b) pH 6,0 (MES 10 mM ácido (2-[N-Morfolino]etanosulfónico); o pH 5,0 (acetato sódico 10 mM). El caudal era 30 µl/min y la disociación se monitorizó durante 10 minutos para cada concentración del Factor D humano puesta a prueba. La señal (sensorgrama) observada para inyección de la misma solución sobre una célula de referencia (bloqueada con etanolamina) se restó del sensorgrama. Entre sensogramas, la superficie se regeneró mediante inyección de 30 µl de MgCl2 4 M para causar la disociación de cualquier Factor D humano que permanezca unido al anticuerpo inmovilizado. Un sensorgrama de control registrado para inyección de tampón solamente sobre la superficie del chip sensor se restó de los sensogramas del Factor D humano. Estos datos se analizaron mediante regresión no lineal de acuerdo con un modelo de unión de Langmuir 1:1 usando el software BIAevaluation v4.1. Las constantes cinéticas y de afinidad se proporcionan en la Tabla 2 a continuación. La tecnología de BiaCore es limitada y no es capaz de medir con precisión constantes de asociación que son demasiado rápidas (es decir valores de KD más pequeños de aproximadamente 10 pM) (Safsten et al., Anal. Biochem., 353: 181 (2006)).

Tabla 2: Resultados de BiaCore

Fab o Anticuerpo

ka(M-1s-1) kd (s-1)

KD (M)

1,0x10-12 (1,0 pM ± Fab 238 anti-Factor D modificado (pH 7.2; A100) 1,5x108 1,7x10-4 0,05) 1,4x10-12 (1,4 pM ± Fab 238 anti-Factor D modificado (pH 7.2; 3000/A100) 8,4±9x108 1,4±1,7x10-3 0,5) 0,19x10-9 (0,19 nM ± Fab 238 anti-Factor D modificado (pH 6; 3000) 1,9x106 3,6x10-4 0,01) 12,3x10-9 (12,3 nM ± Fab 238 anti-Factor D modificado (pH 5; A100) 1,2x106 0,02 2) mAb de longitud completa anti-Factor D 234 (pH 7.2; 0,7x10-12 (0,7 pM ± 1,9x108 1,3x10-4 A100) 0,04) mAb de longitud completa anti-Factor D 234 (pH 7.2; 1,1X10-12 (1,1 pM ± 9,5±10x108 1,3±1,7x10-3 3000/A100) 0,6) mAb de longitud completa anti-Factor D 234 (pH 6; 08x10-9 (0,08 nM ± 2,8x106 2,2x10-4 3000) 0,01) mAb de longitud completa anti-Factor D 234 (pH 5; 2,2x106 2,0x10-2 9x10-9 (9,0 nM ± 1,0) A100)

Ejemplo 4: ensayo de hemólisis AP con concentraciones de Factor D variables

La función biológica de Abs anti-Factor D modificados, incluyendo Fab 238 anti-Factor D, se determinó usando un ensayo de inhibición hemolítica usando suero humano empobrecido en C1q y análisis BiaCore (véase el ejemplo 2 anterior), en presencia de tres concentraciones en suero del Factor D.

Suero humano empobrecido en C1q (CompTech) así como humor vítreo y tejido de la membrana de Bruch de ojos de pacientes con DMAE (obtenidos a través de una colaboración con el Cole Eye Institute, Cleveland, OH) se analizaron en un ensayo ELISA cuantitativo para el Factor D (véase a continuación). La concentración del Factor D en el suero empobrecido en C1q era 97 nM, mientras que el nivel en el humor vítreo y el tejido de la membrana de Bruch de pacientes de DMAE era 16,2 ± 10,3 nM (media ± DT, n=10).

El ELISA del Factor D cuantitativo se realizó diluyendo anticuerpo policlonal de cabra anti-Factor D del complemento humano (R&D Systems, Minneapolis, MN) a 1 µg/ml en solución salina tamponada con fosfato (PBS) y extendiendo el anticuerpo policlonal anti-Factor D (R&D Systems, Minneapolis, MN) sobre placas de ELISA de 384 pocillos (placas de unión elevada; Greiner Bio One through VWR International, Bridgeport, NJ) durante una incubación de una noche a 4°C. Después de lavar 3 veces con tampón de lavado (PBS / Tween-20 al 0,05 %), las placa se bloquearon durante 1 - 2 h con PBS/albúmina de suero bovino (BSA) al 0,5 %. Ésta y todas las demás incubaciones se realizaron a temperatura ambiente en un agitador orbital. Una curva patrón del Factor D (Complement Technology, Inc., Tyler, Texas) se preparó en PBS/BSA al 0,5 %/Tween-20 al 0,05 % en un intervalo de 15,6-1.000 pg/ml. Muestras de control congeladas pre-diluidas para cuantificar en las regiones alta, media y baja de la curva patrón se descongelaron. Se diluyeron muestras de suero humano empobrecido en C1q y humor vítreo humano y lisado de la membrana de Bruch usando diluyente de ensayo (PBS / BSA al 0,5 % / Tween-20 al 0,5 %). Después de la etapa de bloqueo, las placas se lavaron y las muestras diluidas (suero, humor vítreo y lisados de membrana de Bruch), patrones y controles se añadieron y se incubaron durante 2 horas. Después de la incubación de 2 h, las placas se lavaron y el Factor D unido se detectó durante una incubación de 1 a 2 h con un anticuerpo monoclonal anti-Factor D biotinilado (clon 9G7.1.16, producido en Genentech, diluido a 62,5 ng/ml) seguido por una incubación de 30 min con estreptavidina-peroxidasa de rábano picante (SA-HRP) (Amersham Pharmacia Biotech, Piscataway, NJ), diluida 1/10.000 en diluyente de ensayo. Después de una etapa de lavado final, se añadió tetrametilbencidina (Kirkegaard & Perry Laboratories, Inc., Gaithersburg, MD) y se dejó desarrollar color durante de 5 a 7 min. La reacción se interrumpió mediante la adición de ácido fosfórico 1 M. La densidad óptica se leyó usando un lector de microplacas (450 nm, 650 nm referencia) y las concentraciones de la muestra se calcularon a partir de ajustes de cuatro parámetros de las curvas patrón. Las concentraciones cuantificables mínimas de Factor D en humor vítreo humano y muestras de lisado de membrana de Bruch eran 780 pg/ml (1/50 dilución mínima) y 156 pg/ml (1/10 dilución mínima), respectivamente. Para determinar los valores de CI50 y CI90 para la inhibición de la ruta alternativa del complemento usando concentraciones de Fab 238 anti-Factor D modificado en presencia de Factor D similares a las concentraciones de Factor D observadas en el humor vítreo y tejidos de la membrana de Bruch de ojos de pacientes con DMAE, el ensayo hemolítico se realizó tal como se describe en el ejemplo 2, usando suero empobrecido en C1q al 10 % (Factor D 9,7 nM) o usando suero empobrecido en C1q al 10 % suplementado con Factor D adicional (CompTech) para conseguir concentraciones de Factor D que representan la concentración media (16,2 nM) o media ± 1 DT (26,5 nM) observada en humor vítreo y tejidos de la membrana de Bruch de ojos de pacientes con DMAE. Los datos se expresaron como el % de hemólisis inducida en ausencia del inhibidor (figura 12). Las concentraciones de Fab 238 anti-Factor D que causaban el 50 % y el 90 % de inhibición de la reacción hemolítica (valores de CI50 y CI90, respectivamente) se determinaron para tres experimentos repetidos mediante regresión no lineal de las curvas de inhibición usando un modelo de ajuste de cuatro parámetros (KaleidaGraph, Synergy Software, Reading, PA). Las relaciones molares de los valores de CI50 y CI90 frente a la concentración relativa del Factor D también se calcularon.

Los valores de CI50 y CI90 promedio y las relaciones molares se muestran en la tabla 3.

Tabla 3: CI50 y CI90 para Fab Anti-

Fab Anti-Factor D (238)

Concentración de Factor D

CI50

CI90

(nM)

nM

Relación molar (CI50/fD)

nM

Relación molar (CI90/fD)

9,7 (nM)

4,4 ± 1,5 0,454 14,0 ± 1,0 1,443

16,2(nM)

10,2 ± 0,8 0,630 38,0 ±11,0 2,346

26,5 (nM)

23,9 ± 5,0 0,902 72,6 ± 4,8 2,740

Ejemplo 5: Duración de la inhibición de la activación de la ruta alternativa del complemento Se midió la duración simulada de la inhibición de la activación de la ruta alternativa (AP) del complemento en un ojo humano usando una única inyección intravítrea (IVT) de Fab 238 anti-Factor D a una dosis de 2,5 mg (suponiendo una semivida (t1/2) de Fab 238 anti-Factor D de 11,5 días, basada en una gradación según una escala entre especies a partir del conejo), (Ejemplo 13). Los datos simulados se basan en gradación según una escala a partir de un estudio PK de dosis intravítrea única de Fab 238 en conejo New Zealand White. Para estimar la semivida de Fab 238 anti-Factor D en seres humanos, se calculó la semivida de anti-Factor D 238 en conejos. A doce (12) conejos New Zealand White se les administró una única dosis intravítrea de 1 mg de Fab 238 en cada ojo. Se recogieron muestras de humor vítreo y tejido retiniano de ambos ojos a partir del número especificados de animales en los siguientes puntos temporales; 3 animales a 4, 24 y 96 horas (n=6 muestras en cada uno de estos puntos temporales) y un animal a las 216 horas (n=2 muestras en este punto temporal) y 2 animales a las 240 horas (n=4 muestras en este punto temporal). Las concentraciones de Fab 238 en las matrices oculares se midieron en un ELISA de unión al Factor D.

Los datos de concentración-tiempo del humor vítreo de todos los animales se analizaron para estimar estimaciones de parámetros farmacocinéticos usando un enfoque combinado sin estimulación previa con el modelo de entrada de embolada IV (Modelos 201, WinNonlin Pro versión 5.2.1; Pharsight Corporation, Mountain View, CA) para proporcionar una estimación de la semivida terminal (T1/2) de 3,83 días. El coeficiente de reparto retiniano se calculó como la relación de la concentración en el tejido retiniano con respecto al humor vítreo promediada para todos los ojos en todos los puntos temporales y era igual a 0,24. Los parámetros PK para el humor vítreo se sometieron a gradación según una escala para ser humano usando los mismos factores de gradación según una escala observados para. Se supone que el ojo humano tiene un V1 de 4 ml, se supone que la relación de semivida en el ser humano con respecto al conejo es 3, produciendo una estimación de t1/2 en ser humano de 11,5 días. Esto produjo la estimación para la concentración en humor vítreo y concentraciones en tejido retiniano en función del tiempo como:

Concentración en humor vítreo = (Dosis/V1)*exp([-ln(2)/t1/2]*tiempo)

Concentración en tejido retiniano = (Dosis/V1)*exp([-ln(2)/t1/2]*tiempo)*(coeficiente de reparto retiniano)

En la figura 13, se produjo el gráfico para una única dosis ITV de 2,5 mg/ojo y representa el tiempo desde t=0 a t=112 días. IC90 representa la concentración de Fab 238 que produce un efecto inhibidor al 90 % en el ensayo de hemólisis realizado tal como se muestra en el ejemplo 2 y 4 en el que suero humano combinado al 10 % se suplementó a una concentración del Factor D de 16,2 nM. El resultado del ensayo era IC90 = Fab 238 38 nM. Para comparar con las concentraciones en la retina y el humor vítreo, se realizó una conversión molar a masa usando la siguiente ecuación:

CI90 = 38 x 10-9 moles/l

PM de Fab 238 = 50.000 gramos/mol

CI90 (µg/ml) = (38 x 10-9 moles/l) x (50 x 103 gramos/mol) = 1,9 x 10-9 gramos/l, o 1,9 µg/ml

Tal como se muestra en la figura 13, los “días por encima de la IC90” se estimaron como la cantidad de tiempo que se predeciría que la concentración en el humor vítreo o en la retina estaría por encima de 1,9 µg/ml después de una única dosis ITV de 2,5 mg/ojo y se observó como el punto donde el gráfico de las concentraciones en el humor vítreo o en la retina cruza la línea en 1,9 µg/ml. Se estimó que una única inyección IVT de Fab 238 anti-Factor D inhibía la activación del complemento AP en el tejido retiniano durante al menos aproximadamente 74 días y en el humor vítreo durante al menos aproximadamente 97 días. La línea discontinua en la figura 13 muestra la concentración simulada de Fab 238 anti-Factor D en el humor vítreo después de la administración intravítrea. La línea continua en la figura 13 muestra la concentración simulada de Fab 238 anti-Factor D en el tejido retiniano después de la administración intravítrea. La diferencia de la concentración en el humor vítreo y el tejido retiniano se basa en una estimación del coeficiente de reparto en tejido retiniano del 20 %; en otras palabras, el 20 % del fármaco total administrado al humor vítreo tendrá acceso al tejido retiniano Los expertos en la materia reconocerán, o serán capaces de evaluar usando solamente experimentación rutinaria, muchos equivalentes a las realizaciones específicas de la invención descritas en el presente documento. Se pretende que dichos equivalentes están abarcados por las siguientes reivindicaciones.

Aunque la invención anterior se ha descrito con cierto detalle a modo de ilustración y ejemplo para fines de claridad de comprensión, no debe interpretarse que las descripciones y ejemplos limitan el alcance de la invención. Se considera que la memoria descriptiva por escrito anterior es suficiente para permitir a un experto en la materia poner en práctica la invención. El alcance de la presente invención no está limitado por la construcción depositada, dado que la realización depositada se pretende como una única ilustración de ciertos aspectos de la invención. Listado de Secuencias <110> GENENTECH, INC. HUANG, Arthur J. KELLEY, Robert F. LOWMAN, Henry VAN LOOKEREN CAMPAGNE, Menno WINTER, Charles M. <120> ANTICUERPOS ANTI-FACTOR D HUMANIZADOS Y USOS DE LOS MISMOS <130> P4188R1 WO <150> US 61/048.431 <151> 28-04-2008 <150> US 61/048.689 <151> 29-04-2008 <160> 74 <210> 1 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable del clon humanizado n.º 111 <400> 1 <210> 2 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable del clon humanizado n.º 111 <400> 2 <210> 3 <211> 31 <212> PRT <213> Secuencia artificial <220> <223> La secuencia está sintetizada (FR3 de la región marco humana del acepar VH) <400> 3 <210> 4 <211> 32 <212> PRT <213> Secuencia artificial <220> <223> La secuencia está sintetizada (FR3 de la región marco humana del acepar VH) <400> 4 <210> 5 <211> 10 <212> PRT <213> Secuencia artificial <220> <223> La secuencia está sintetizada (FR4 de la región marco humana del acepar VL) <400> 5 <210> 6 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238 <400> 6 <210> 7 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-1 <400> 7 <210> 8 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-2 <400> 8 <210> 9 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-3 <400> 9 <210> 10 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-4 <400> 10 <210> 11 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-5 <400> 11 <210> 12 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-6 <400> 12 <210> 13 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-7 <400> 13 <210> 14 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-8 <400> 14 <210> 15 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-9 <400> 15 <210> 16 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-10 <400> 16 <210> 17 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera variable para Fab anti-Factor D humanizado modificado 238-11 <400> 17 <210> 18 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238 <400> 18 <210> 19 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-1 <400> 19 <210> 20 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-2 <400> 20 <210> 21 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-3 <400> 21 <210> 22 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-4 <400> 22 <210> 23 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-5 <400> 23 <210> 24 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-6 <400> 24 <210> 25 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-7 <400> 25 <210> 26 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-8 <400> 26 <210> 27 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-9 <400> 27 <210> 28 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-10 <400> 28 <210> 29 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada variable para Fab anti-Factor D humanizado modificado 238-11 <400> 29 <210> 30 <211> 11 <212> PRT <213> Secuencia artificial <220> <223> HVR-L1 de n.º 111 y 238 a 238-1, 238-6 a 238-11 <400> 30 <210> 31 <211> 11 <212> PRT <213> Secuencia artificial <220> <223> HVR-L1 para Fab anti-Factor D humanizado modificado 238-2 <400> 31 <210> 32 <211> 11 <212> PRT <213> Secuencia artificial <220> <223> HVR-L1 para Fab anti-Factor D humanizado modificado 238-3 <400> 32 <210> 33 <211> 11 <212> PRT <213> Secuencia artificial <220> <223> HVR-L1 para Fab anti-Factor D humanizado modificado 238-4 <400> 33 <210> 34 <211> 11 <212> PRT <213> Secuencia artificial <220> <223> HVR-L1 para Fab anti-Factor D humanizado modificado 238-5 <400> 34 <210> 35 <211> 7 <212> PRT <213> Secuencia artificial <220> <223> HVR-L2 de n.º 111 y 238 a 238-5 y 238-8 a 238-11 <400> 35 <210> 36 <211> 7 <212> PRT <213> Secuencia artificial <220> <223> HVR-L2 para Fab anti-Factor D humanizado modificado 238-6 <400> 36 <210> 37 <211> 7 <212> PRT <213> Secuencia artificial <220> <223> HVR-L2 para Fab anti-Factor D humanizado modificado 238-7 <400> 37 <210> 38 <211> 9 <212> PRT <213> Secuencia artificial <220> <223> HVR-L3 de n.º 111 y 238 a 238-11 <400> 38 <210> 39 <211> 10 <212> PRT <213> Secuencia artificial <220> <223> HVR-H1 de n.º 111 y 238 a 238-11 <400> 39

ES 2 552 817 T3   <210> 40 <211> 17 <212> PRT <213> Secuencia artificial <220> <223> HVR-H2 de n.º 111 y 238 a 238-11 <400> 40 <210> 41 <211> 6 <212> PRT <213> Secuencia artificial <220> <223> HVR-H3 de n.º 111 y 238 a 238-7 <400> 41 <210> 42 <211> 6 <212> PRT <213> Secuencia artificial <220> <223> HVR-H3 para Fab anti-Factor D humanizado modificado 238-8 <400> 42 <210> 43 <211> 6 <212> PRT <213> Secuencia artificial <220> <223> HVR-H3 para Fab anti-Factor D humanizado modificado 238-9 <400> 43 <210> 44 <211> 6 <212> PRT <213> Secuencia artificial <220> <223> HVR-H3 para Fab anti-Factor D humanizado modificado 238-10

ES 2 552 817 T3   <400> 44 <210> 45 <211> 6 <212> PRT <213> Secuencia artificial <220> <223> HVR-H3 para Fab anti-Factor D humanizado modificado 238-11 <400> 45 <210> 46 <211> 714 <212> ADN <213> Secuencia artificial <220> <223> Dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238 <400> 46 <210> 47 <211> 214

ES 2 552 817 T3   <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238 <400> 47 <210> 48 <211> 23 <212> PRT <213> Secuencia artificial <220> <223> FR1-LC de dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238 <400> 48

ES 2 552 817 T3   <210> 49 <211> 15 <212> PRT <213> Secuencia artificial <220> <223> FR2-LC de dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238 <400> 49 <210> 50 <211> 32 <212> PRT <213> Secuencia artificial <220> <223> FR3-LC de dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238 <400> 50 <210> 51 <211> 10 <212> PRT <213> Secuencia artificial <220> <223> FR4-LC de dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238 <400> 51 <210> 52 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> CL1 de dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238 a 238-1 <400> 52

ES 2 552 817 T3   <210> 53 <211> 741 <212> ADN <213> Secuencia artificial <220> <223> Dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238 <400> 53

ES 2 552 817 T3   <210> 54 <211> 223 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238 <400> 54

ES 2 552 817 T3   <210> 55 <211> 25 <212> PRT <213> Secuencia artificial <220> <223> FR1-HC de dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238 <400> 55 <210> 56 <211> 14 <212> PRT <213> Secuencia artificial <220> <223> FR2-HC de dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238 <400> 56 <210> 57 <211> 32 <212> PRT <213> Secuencia artificial <220> <223> FR3-HC de dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238 <400> 57 <210> 58 <211> 11 <212> PRT <213> Secuencia artificial <220> <223> FR4-HC de dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238 <400> 58 <210> 59 <211> 108 <212> PRT

ES 2 552 817 T3   <213> Secuencia artificial <220> <223> CH1 de dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238 a 238-1 <400> 59 <210> 60 <211> 714 <212> ADN <213> Secuencia artificial <220> <223> Dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238-1 <400> 60

ES 2 552 817 T3   <210> 61 <211> 214 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena ligera para Fab anti-Factor D humanizado modificado 238-1 <400> 61

ES 2 552 817 T3   <210> 62 <211> 741 <212> ADN <213> Secuencia artificial <220> <223> Dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238-1 <400> 62

ES 2 552 817 T3   <210> 63 <211> 223 <212> PRT <213> Secuencia artificial <220> <223> Dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238-1 <400> 63

ES 2 552 817 T3   <210> 64 <211> 25 <212> PRT <213> Secuencia artificial <220> <223> FR1-HC de dominio de cadena pesada para Fab anti-Factor D humanizado modificado 238-1 <400> 64 <210> 65 <211> 107 <212> PRT <213> Secuencia artificial <220> <223> Secuencia consenso VL Kappa I <400> 65

ES 2 552 817 T3   <210> 66 <211> 109 <212> PRT <213> Secuencia artificial <220> <223> Secuencia consenso VH7 subgrupo VII <400> 66 <210> 67 <211> 37 <212> ADN <213> Secuencia artificial

ES 2 552 817 T3   <220> <223> Cebador oligonucleotídico sintetizado para pAEP1-283 VL <400> 67 tttccctttg atatccaggt gacccagtct ccatcct 37 <210> 68 <211> 42 <212> ADN <213> Secuencia artificial <220> <223> Cebador oligonucleotídico sintetizado para pAEPI-238-VL <400> 68 tttccctttg gtaccctggc caaacgtgta cggcaaagaa tc 42 <210> 69 <211> 41 <212> ADN <213> Secuencia artificial <220> <223> Cebador oligonucleotídico sintetizado para p238 <400> 69 tttgggtttc gtacgctcag gtccagctgg tgcaatctgg g 41 <210> 70 <211> 47 <212> ADN <213> Secuencia artificial <220> <223> Cebador oligonucleotídico sintetizado para p238 <400> 70 tttgggtttg ggcccttggt ggaggctgag gagacggtga ccagggt 47 <210> 71 <211> 41 <212> ADN <213> Secuencia artificial <220> <223> Cebador oligonucleotídico sintetizado para p238-1 <400> 71 tttgggtttc gtacgctgaa gtccagctgg tgcaatctgg g 41 <210> 72 <211> 47 <212> ADN <213> Secuencia artificial <220> <223> Cebador oligonucleotídico sintetizado para p238-1 <400> 72 tttgggtttg ggcccttggt ggaggctgag gagacggtga ccagggt 47 <210> 73 <211> 107 <212> PRT <213> Secuencia artificial

ES 2 552 817 T3   <220> <223> Material compuesto de cadena pesada variable de clones de Fab anti-Factor D humanizados <220> <221> Xaa <222> 33-34 <223> Aminoácido desconocido <220> <221> Xaa <222> 52 <223> Aminoácido desconocido <220> <221> Xaa <222> 104 <223> Aminoácido desconocido <400> 73 <210> 74 <211> 115 <212> PRT <213> Secuencia artificial <220> <223> Material compuesto de cadena pesada variable de clones de Fab anti-Factor D humanizados <220> <221> Xaa <222> 1 <223> Aminoácido desconocido <220> <221> Xaa <222> 103 <223> Aminoácido desconocido <220> <221> Xaa <222> 104

ES 2 552 817 T3   <223> Aminoácido desconocido <400> 74

ES 2 552 817 T3  

REIVINDICACIONES

1. Un anticuerpo anti-Factor D que comprende un dominio variable de cadena ligera que tiene al menos el 90 % de identidad de secuencia de aminoácidos con la secuencia de aminoácidos de la SEC ID Nº: 7 y un dominio variable de cadena pesada que tiene al menos el 90 % de identidad de secuencia de aminoácidos con la secuencia de aminoácidos de la SEC ID Nº: 19, en donde (i) el dominio variable de cadena ligera comprende HVR-1 que comprende ITSTDIDDDMN (SEC ID Nº: 30), HVR-2 que comprende GGNTLRP (SEC ID Nº: 35) y HVR-3 que comprende LQSDSLPYT (SEC ID Nº: 38); y (ii) el dominio variable de cadena pesada comprende HVR-1 que comprende GYTFTNYGMN (SEC ID Nº: 39), HVR-2 que comprende WINTYTGETTYADDFKG (SEC ID Nº: 40) y HVR-3 que comprende EGGVNN (SEC ID Nº: 41); y en donde el aminoácido en la posición 1 del dominio variable de cadena pesada es E.

2. El anticuerpo anti-Factor D de la reivindicación 1, en el que el aminoácido en la posición 104 de la secuencia de aminoácidos del dominio variable de cadena ligera es V. 3. El anticuerpo anti-Factor D de las reivindicaciones 1 o 2, en el que el dominio variable de cadena pesada comprende la secuencia de aminoácidos de la SEC ID Nº: 19 y el dominio variable de cadena ligera comprende la secuencia de aminoácidos de la SEC ID Nº: 7. 4. El anticuerpo anti-Factor D de la reivindicación 3, en el que el anticuerpo anti-Factor D comprende una secuencia de cadena pesada de la SEC ID Nº: 63.

5. El anticuerpo anti-Factor D de la reivindicación 3, en el que el anticuerpo anti-Factor D comprende una secuencia de cadena ligera de la SEC ID Nº: 61. 6. El anticuerpo anti-Factor D de la reivindicación 3, en el que el anticuerpo anti-Factor D comprende una secuencia de cadena pesada de la SEC ID Nº: 63 y una secuencia de cadena ligera de la SEC ID Nº: 61.

7. El anticuerpo anti-Factor D de una cualquiera de las reivindicaciones 1 a 6, en el que el Factor D es el Factor D de mamífero. 8. El anticuerpo anti-Factor D de la reivindicación 7, en el que el Factor D es el Factor D humano.

9. Un polinucleótido que codifica el anticuerpo anti-Factor D de una cualquiera de las reivindicaciones 1 a 8. 10. El polinucleótido de la reivindicación 9 que comprende una secuencia de ácido nucleico de la SEC ID Nº: 60 o la SEC ID Nº: 62.

11. Un vector que comprende el polinucleótido de la reivindicación 9 o de la reivindicación 10. 12. Una célula hospedadora que comprende el vector de la reivindicación 11.

13. La célula hospedadora de la reivindicación 12, en donde la célula hospedadora es eucariota. 14. La célula hospedadora de la reivindicación 12, en donde la célula hospedadora es una célula de CHO. 15. Un método de preparación de un anticuerpo anti-Factor D, en donde el método comprende (a) cultivar la célula hospedadora de una cualquiera de las reivindicaciones 12 a 14 en condiciones adecuadas para la expresión del polinucleótido que codifica el anticuerpo y (b) aislar el anticuerpo. 16. El anticuerpo anti-Factor D de una cualquiera de las reivindicaciones 1 a 8, en el que el anticuerpo anti-Factor D es un anticuerpo monoclonal.

17. El anticuerpo anti-Factor D de una cualquiera de las reivindicaciones 1 a 8, en el que el anticuerpo anti-Factor D es un fragmento de anticuerpo seleccionado entre un fragmento Fab, Fab'-SH, Fv, scFv o (Fab')2. 18. Una composición farmacéutica que comprende el anticuerpo anti-Factor D de una cualquiera de las reivindicaciones 1 a 8, 16 y 17,y un diluyente, vehículo o excipiente farmacéuticamente aceptables. 19. El anticuerpo anti-Factor D o la composición de acuerdo con una cualquiera de las reivindicaciones 1 a 8 y 16 a 18, para uso en un método de tratamiento de un trastorno asociado al complemento seleccionado entre el grupo que comprende trastornos inflamatorios o enfermedades oculares.

20. El anticuerpo anti-Factor D o la composición para uso de acuerdo con la reivindicación 19, en donde el trastorno

ES 2 552 817 T3   inflamatorio es una enfermedad autoinmunitaria. 21. El anticuerpo o la composición para uso de acuerdo con la reivindicación 20, en donde la enfermedad autoinmunitaria se selecciona entre el grupo que comprende lupus eritematoso sistémico, miastenia grave, artritis reumatoide, enfermedad de Alzheimer y esclerosis múltiple. 22. El anticuerpo anti-Factor D o la composición para uso de acuerdo con la reivindicación 19, en donde la enfermedad ocular se selecciona entre el grupo que comprende degeneración macular asociada a la edad, retinopatía diabética, neovascularización coroidea (NVC), uveítis, edema macular diabético, miopía patológica, enfermedad de von Hippel-Lindau, histoplasmosis del ojo, oclusión de la vena central de la retina (OVCR), neovascularización corneal y neovascularización retiniana. 23. El anticuerpo para uso de acuerdo con la reivindicación 22, en donde la degeneración macular asociada a la edad se selecciona entre el grupo que comprende DMAE seca intermedia y atrofia geográfica.

ES 2 552 817 T3