Anticuerpos anti-CXCR4 para el tratamiento del VIH.

Anticuerpo anti-CXCR4 aislado, o uno de sus fragmentos funcionales, siendo dicho fragmento funcional seleccionado de entre los fragmentos Fv, Fab,

(Fab')2, Fab', scFv, scFv-Fc y diacuerpos, caracterizado por que comprende:

- una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 1, 2 y 3; y una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 4, 5 y 6; o

- una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 1, 2 y 30; y una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID nº 31, 32 y 33.

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/EP2010/055863.

Solicitante: PIERRE FABRE MEDICAMENT.

Nacionalidad solicitante: Francia.

Dirección: 45, PLACE ABEL GANCE 92100 BOULOGNE-BILLANCOURT FRANCIA.

Inventor/es: KLINGUER-HAMOUR,CHRISTINE.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/28 (contra receptores, antígenos celulares de superficie o determinantes celulares de superficie)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Antiinfecciosos, es decir antibióticos, antisépticos,... > A61P31/18 (para el VIH)

PDF original: ES-2534313_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Anticuerpos anti-CXCR4 para el tratamiento del VIH.

La presente invención se refiere a nuevos anticuerpos, en particular anticuerpos monoclonales murinos, híbridos y humanizados, que pueden unirse específicamente a los receptores de quimiocinas (CXCR), así como la secuencias de aminoácidos y de ácidos nucleicos que codifican dichos anticuerpos. Desde un aspecto, la Invención se refiere a nuevos anticuerpos, y sus fragmentos funcionales, que pueden unirse específicamente al CXCR4 y que presentan una potente actividad contra la infección por el virus de la inmunodeflclencla humana (VIH). La Invención también comprende la utilización de dichos anticuerpos, y sus fragmentos funcionales como un medicamento para el tratamiento preventivo y/o terapéutico de la infección por VIH.

Las quimiocinas son pequeños péptidos segregados, que controlan la migración de los leucocitos a lo largo de un gradiente químico de ligando, conocido como gradiente de quimiocinas, especialmente durante las reacciones inmunitarias (Zlotnick A. et al., 2). Se dividen en dos subfamilias principales, CC y CXC, en base a la posición de sus restos de cisteína del terminal NH2, y se unen a receptores acoplados a la proteína G, cuyos dos principales subfamilias se denominan CCR y CXCR. Más de 5 quimiocinas humanas y 18 receptores de quimiocinas se han descubierto hasta el momento.

Algunos miembros de la familia de receptores de la qulmloclna actúan como correceptores con el receptor primario CD4 para permitir la entrada de varias cepas del VIH de tipo 1 en las células, siendo los correceptores principales CCR5 y CXCR4. El VIH-1 de X4 trópico de linfocitos T utiliza el CD4 y el CXCR4 para la entrada en las células, mientras que el VIH-1 de R5 trópico de macrófagos utiliza el CD4 y el CCR5. Las cepas dual-trópicas pueden utilizar el CXCR4 y el CCR5 como correceptores. Los CCR3, CCE2, CCR8, CXCR6, CXCR7, CX3CR1, de entre otros receptores de la quimiocina, pueden actuar como correceptores por un subconjunto más restringido de cepas de VIH.

El SDF-1, el ligando natural de CXCR4 así como los llgandos CCL3, CCL4, CCL4-L1, y CCL5 para CCR5 pueden inhibir la infección y la fusión celular por varias cepas de VIH-1. Estos descubrimientos han estimulado el desarrollo de tratamientos anti-VIH que dianizan los receptores de la qulmloclna que condujeron a la aprobación del maravlroc (CELSENTRI®), un antagonista de moléculas pequeñas del CCR5 en combinación con otros agentes antl-VIH-1 en pacientes infectados por el VIH-1 CCR5-trópico. Sin embargo, el maraviroc no es utilizado ni en pacientes infectados por el VIH-1 dual-trópico ni en pacientes infectados por el VIH-1 CXCR4-trópico (VIDAL 29). Por lo tanto existe una necesidad médica evidente de extender este tipo de terapia en los pacientes infectados por el VIH X4-trópico y dual-trópico identificando los antagonistas de CXCR4 que pueden inhibir la replicación de VIH X4-trópico.

El receptor 4 de quimiocinas (también conocido como fusina, CD184, LESTR o HUMSTR) existe como dos isoformas que comprenden 352 o 36 aminoácidos. El resto ASN11 está glucosilado, el resto Tyr21 se modifica por adición de un grupo sulfato y Cys 19 y 186 se unen con un puente disulfuro en la parte extracelular del receptor (Juárez J. et al., 24).

Este receptor es expresado por diferentes tipos de tejidos normales, naturales, linfocitos T sin memoria, linfocitos T reguladores, linfocitos B, neutrófilos, células endoteliales, monocitos primarios, dendrocitos, linfocitos citolíticos naturales, células madre hematopoyéticas CD34+ y a un bajo nivel en el corazón, colon, hígado, riñones y cerebro. CXCR4 desempeña una función clave en el tráfico de leucocitos, linfopoyesis y mielopoyesis de linfocitos B.

El ligando único del receptor CXCR4 descrito hasta el momento es el Factor-1 derivado de células del estroma (SDF-1) o CXCL2. SDF-1 se segrega en gran cantidad en el ganglio linfático, la médula ósea, el hígado, el pulmón y en menor medida por los riñones, el cerebro y la piel. CXCR4 también es reconocido por una quimiocina antagónica, la proteína II inflamatoria de macrófagos víricos (vMIP-ll) codificada por el herpesvirus humano tipo III.

Como se ha mencionado anteriormente, el receptor CXCR4 es el correceptor principal para los aislados de VIH-1 linfocitos T-trópico (virus X4). La interferencia con este receptor debería inhibir la replicación de los virus X4 de una manera muy eficaz.

Uno de los aspectos inventivos de la presente invención es el de generar anticuerpos monoclonal de ratón (Mabs) que inhiben la replicación del VIH. La invención comprende un Mab 515H7 de CXCR4 (o sus fragmentos) que puede unirse a los homodímeros de CXCR4, y que presenta unas actividades potentes contra la infección por VIH. La invención comprende asimismo un Mab 31 aE5 de CXCR4 (o sus fragmentos) que puede unirse a los homodímeros de CXCR4, y que presenta unas actividades potentes contra la infección por VIH.

Inesperadamente, se han conseguido generar anticuerpos monoclonales que pueden unirse a CXCR4 pero también producir cambios de configuración de los homodímeros y/o heterodímeros CXCR4 y pueden inhibir la replicación del aislado primario de VIH-1 X4 en las PBMC. Más específicamente, los anticuerpos de la invención pueden asimismo inhibir la replicación del aislado primario de VIH-1 X4/R5.

Preferentemente, el compuesto CXCR4 es una de las dos ¡soformas CXCR4 humanas seleccionadas de entre el grupo que consiste en:

- la ¡soforma b del receptor 4 de qulmlocinas (motivo C-X-C) [Homo sapiens] que tiene la secuencia representada con el número de registro del Genbank NP_3458 (SEC ID n° 27):

MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGN

GLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFL

CKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWI

PALLLTIPDFIFANVSEADDRYICDRFYPNDLWVWFQFQHIMVGLILPGIVILSC

YCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFE

NTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKG

KRGGHSSVSTESESSSFHSS;

- la ¡soforma a del receptor 4 de qulmiocinas (motivo C-X-C) [Homo sapiens] que tiene la secuencia representada con el número de registro de Genbank NP_1854 SEC ID n° 28):

MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGI

VGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFG EP 2 424 897 B1 3 5 1 15 2 25 3 35 4 45 5 55 NFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVG VWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVI LSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGC EFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILS KGKRGGHSSVSTESESSSFHSS;

una variante de corte y empalme de la transcripción alternativa o una variante natural de la misma que tiene por lo menos 95% de identidad con una de estas ¡soformas boa que tienen la SEC ID n° 27 o 28, y

un fragmento de la misma que puede ser reconocido específicamente por su factor-1 derivado de células del estroma del ligando natural (SDF-1) y que tiene preferentemente por lo menos 1, 15 y 2 aminoácidos de longitud.

CXCR2 se selecciona de entre el grupo que consiste en:

- el receptor beta de interleucina 8 [Homo sapiens] que tiene la secuencia representada bajo el número de registro de Genbank NP_1548 (SEC ID n° 29):

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIY

ALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKV

NGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKF

ICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSF

GFIVPLUMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLL

ADTLMRTQVIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKI

LAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL;

- una variante de corte y empalme alternativa... [Seguir leyendo]

 


Reivindicaciones:

1. Anticuerpo anti-CXCR4 aislado, o uno de sus fragmentos funcionales, siendo dicho fragmento funcional seleccionado de entre los fragmentos Fv, Fab, (Fab)2, Fab, scFv, scFv-Fc y diacuerpos, caracterizado por que comprende:

- una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID n° 1, 2 y 3; y una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID n° 4, 5 y 6; o

- una cadena ligera que comprende CDR-L1, CDR-L2 y CDR-L3 que comprenden respectivamente la secuencia de aminoácidos SEC ID n° 1, 2 y 3; y una cadena pesada que comprende CDR-H1, CDR-H2 y CDR-H3 que comprenden respectivamente la secuencia de aminoácidos SEC ID n° 31, 32 y 33.

2. Anticuerpo según la reivindicación 1, o un fragmento funcional del mismo, caracterizado por que dicho anticuerpo

es:

- un anticuerpo que comprende una cadena ligera que comprende la secuencia de aminoácidos SEC ID n° 7 y una cadena pesada que comprende la secuencia de aminoácidos SEC ID n° 8 o

- un anticuerpo que comprende una cadena ligera que comprende la secuencia de aminoácidos SEC ID n° 34, y una cadena pesada que comprende la secuencia de aminoácidos SEC ID n° 35.

3. Anticuerpo según la reivindicación 1, o un fragmento funcional del mismo, caracterizado por que es un anticuerpo híbrido y por que comprende una cadena pesada de secuencia seleccionada de entre el grupo que consiste en SEC ID n° 56, 57 o 58, y una cadena ligera de secuencia SEC ID n° 59.

4. Anticuerpo según la reivindicación 1, caracterizado por que es un anticuerpo humanizado y por que comprende una región variable de la cadena pesada de secuencia que consiste en SEC ID n° 64, y una región variable de la cadena ligera de secuencia seleccionada de entre el grupo que consiste en SEC ID n° 65, 66, 82 u 83.

5. Anticuerpo según la reivindicación 1, caracterizado por que es un anticuerpo humanizado y por que comprende un anticuerpo humanizado, o un fragmento funcional del mismo, que comprende una cadena pesada de secuencia seleccionada de entre el grupo que consiste en la SEC ID n° 67, 68 o 69, y una cadena ligera de secuencia seleccionada de entre el grupo que consiste en SEC ID n° 7, 71, 84 u 85.

6. Anticuerpo según la reivindicación 1, caracterizado por que dicho fragmento funcional consiste en un fragmento scFv, comprendiendo dicho scFv la secuencia de aminoácidos SEC ID n° 54.

7. Ácido nucleico aislado, caracterizado por que es un ácido nucleico, ADN o ARN, que codifica un anticuerpo, o uno de sus fragmentos funcionales, según cualquiera de las reivindicaciones 1 a 6.

8. Vector que comprende un ácido nucleico según la reivindicación 7.

9. Célula hospedadora que comprende un vector según la reivindicación 8.

1. Procedimiento para la producción de un anticuerpo, o uno de sus fragmentos funcionales, según cualquiera de las reivindicaciones 1 a 6, caracterizado por que comprende las etapas siguientes:

a) cultivar en un medio y en las condiciones de cultivo adecuadas una célula según la reivindicación 9; y

b) recuperar dichos anticuerpos, o uno de sus fragmentos funcionales, producidos de este modo a partir del medio de cultivo o de dichas células cultivadas.

11. Anticuerpo según las reivindicaciones 1 a 6 para su utilización como un medicamento.

12. Anticuerpo, o uno de sus fragmentos funcionales, según las reivindicaciones 1 a 6, caracterizado por que inhibe la replicación del aislado primario KON de VIH-1 en las PBMC con una IC9 de por lo menos 5 pg/ml, preferentemente por lo menos 1 pg/ml.

13. Composición farmacéutica que comprende como principio activo un compuesto que consiste en un anticuerpo, o uno de sus fragmentos funcionales, según cualquiera de las reivindicaciones 1 a 6 y 12.

14. Composición según la reivindicación 13 destinada a la prevención o al tratamiento de una infección por VIH.

15. Composición según la reivindicación 14, caracterizada por que dicha infección por VIH es una infección por VIH

X4-trópico, y/o una infección por VIH X4/R5-trópico.

16. Composición según las reivindicaciones 13 a 15, caracterizada por que comprende por lo menos un segundo compuesto anti-VIH seleccionado de entre el grupo que consiste en fármacos antirretrovirales, tales como

inhibidores de la proteasa de VIH (Pl), inhibidores nucleosídicos/nucleotídicos de la transcriptasa inversa de VIH (NRTI/NtRTI), inhibidores no nucleosídicos de la transcriptasa inversa de VIH (NNRTI), inhibidores de entrada de VIH, inhibidores de la integrasa de VIH.

17. Composición según la reivindicación 15 o 16, caracterizada por que dicho por lo menos segundo compuesto anti- 1 VIH es el Maraviroc.

18. Procedimiento para el cribado y/o la identificación de moléculas como agentes antivirales antagonistas de CXCR4, que comprende las etapas siguientes:

a) seleccionar las células que expresan el CXCR4,

b) incubar dichas células con un anticuerpo, o un de sus fragmentos funcionales o derivados, según las reivindicaciones 1 a 6 o 12, y

c) evaluar las moléculas sometidas a ensayo respecto a su Inhibición potencial de la unión entre el anticuerpo, o uno de sus fragmentos funcionales o derivados, al CXCR4, y

d) seleccionar las moléculas con capacidad para dicha Inhibición.