Anticuerpos anti-C5a y métodos para el uso de los anticuerpos.

Un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une a un polipéptido C5a libre, en el que el C5a libre es un polipéptido humano

(C5ah) que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, y en el que el anticuerpo o fragmento de unión a antígeno del mismo se une al polipéptido C5ah libre in vitro con una KD que es menor que 1,25 x 10-9 M según se mide mediante resonancia de plasmón superficial (RPS) en presencia de un exceso molar de C5 de ser humano natural no escindido, y donde el anticuerpo o fragmento de unión a antígeno del mismo comprende:

I. (a) un polipéptido de cadena ligera que comprende:

(i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; o

(ii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y

(b) un polipéptido de cadena pesada que comprende:

(i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30; o

(ii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47;

II. (a) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27;

(b) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada SEC ID Nº: 36 un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33;

(c) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27;

(d) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 25;

(e) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21;

(f) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33;

(g) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33;

(h) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45;

(i) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 44;

(j) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49;

(k) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45; o (1) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 36 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49; o

III.

(a) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45;

(b) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49; o

Tipo: Patente Internacional (Tratado de Cooperación de Patentes). Resumen de patente/invención. Número de Solicitud: PCT/US2011/034672.

Solicitante: ALEXION PHARMACEUTICALS, INC..

Inventor/es: TAMBURINI, PAUL, P., ROTHER, RUSSELL, P., SHERIDAN,DOUGLAS L, ZHANG,YUCHUN.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/18 (contra materiales animales o humanos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento de problemas inmunológicos... > A61P37/06 (Inmunosupresores, p. ej. medicamentos para el tratamiento del rechazo en injertos)
google+ twitter facebookPin it
Ilustración 1 de Anticuerpos anti-C5a y métodos para el uso de los anticuerpos.
Ilustración 2 de Anticuerpos anti-C5a y métodos para el uso de los anticuerpos.
Ilustración 3 de Anticuerpos anti-C5a y métodos para el uso de los anticuerpos.
Ilustración 4 de Anticuerpos anti-C5a y métodos para el uso de los anticuerpos.
Ver la galería de la patente con 20 ilustraciones.
Anticuerpos anti-C5a y métodos para el uso de los anticuerpos.

Texto extraído del PDF original:

DESCRIPCIÓN

Anticuerpos anti-C5a y métodos para el uso de los anticuerpos Referencia cruzada a solicitudes relacionadas Esta solicitud reivindica prioridad para y el beneficio de la patente provisional de los Estados Unidos con números de serie de solicitud: 61/330.260, presentada el 30 de abril de 2010, y 61/471.465, presentada el 4 de abril de 2011.

Campo técnico El campo de la presente invención es la medicina, la inmunología, la biología molecular, y la química de proteínas. Antecedentes El sistema del complemento actúa junto con otros sistemas inmunológicos del organismo para defenderse contra la intrusión de patógenos celulares y virales. Hay al menos 25 proteínas de complemento, que se encuentran como una colección compleja de proteínas plasmáticas y cofactores de membrana. Las proteínas plasmáticas componen aproximadamente un 10% de las globulinas del suero de vertebrados. Los componentes del complemento logran sus funciones defensivas inmunitarias mediante la interacción en una serie de intrincadas pero precisas escisiones enzimáticas y eventos de unión a membrana. La cascada del complemento resultante conduce a la producción de productos con funciones opsonizantes, inmunorregulatorias, y líticas. Un resumen conciso de las actividades biológicas asociadas con la activación del complemento se proporciona, por ejemplo, en el Manual Merck, 16ª Edición.

La cascada del complemento progresa vía la ruta clásica, la ruta alternativa, o la ruta de lectinas. Estas rutas comparten muchos componentes, y aunque difieren en sus etapas iniciales, convergen y comparten los mismos componentes del “complemento terminales” (C5 a C9) responsables de la activación y destrucción de células diana.

La ruta clásica (RC) se inicia típicamente mediante reconocimiento de anticuerpos de, y la unión a, un sitio antigénico en una célula diana. La ruta alternativa (RA) puede ser independiente de anticuerpos, y puede iniciarse por ciertas moléculas en la superficie de patógenos. De forma adicional, la ruta de lectinas se inicia típicamente con la unión de lectinas de unión a manosa (LUM) a sustratos de alta manosa. Estas rutas convergen en el punto donde el componente del complemento C3 es escindido por una proteasa activa para producir C3a y C3b. Otras rutas que activan el ataque del complemento pueden actuar más tarde en la secuencia de eventos conduciendo a varios aspectos de la función del complemento. C3a es una anafilotoxina. C3b se une a bacterias y a otras células, así como a ciertos virus y complejos inmunitarios, y los marca para eliminarlos de la circulación. (en este rol, C3b se conoce como opsonina). La función opsonizante de C3b se considera generalmente que es la acción anti infectiva más importante del sistema del complemento. Los pacientes con lesiones genéticas que bloquean la función de C3b son propensos a la infección por una amplia diversidad de organismos patógenos, aunque se encuentra que pacientes con lesiones más tardías en la secuencia de cascada del complemento, es decir, pacientes con lesiones que bloquean las funciones de C5, son más propensos solamente a la infección por Neisseria, y solo algo más propensos.

C3b también forma un complejo con otros componentes propios de cada ruta para formar la convertasa de C5 clásica o alternativa, la cual escinde C5 en C5a y C5b. C3 es así referida como la proteína central en la secuencia de reacción del complemento dado que es esencial para las rutas alternativa y clásica. Esta propiedad de C3b es regulada por la proteasa sérica Factor I, la cual actúa en C3b para producir iC3b. Aunque iC3b todavía es funcional como opsonina, no puede formar una convertasa de C5 activa. C5 es una beta globulina de 190 kDa encontrada en suero normal a una concentración de aproximadamente 75 µg/ml (0,4 µM). C5 está glucosilada, con aproximadamente 1,5 a 3 por ciento de su masa atribuida a carbohidratos. C5 madura es un heterodímero de una cadena alfa de 999 aminoácidos y 115 kDa, que está unida por una unión disulfuro a una cadena beta de 655 aminoácidos y 75 kDa. C5 se sintetiza como una proteína precursora de cadena simple producto de un gen de copia simple (Haviland et al. (1991) J Immunol 146: 362-368). La secuencia de ADNc del transcrito de este gen predice un precursor pro-C5 secretado de 1658 aminoácidos junto con una secuencia líder de 18 aminoácidos (véase, por ejemplo, la Patente de Estados Unidos Nº 6.355.245).

El precursor pro-C5 se escinde después de los aminoácidos 655 y 659, para producir la cadena beta como un fragmento amino terminal (restos aminoacídicos + 1 a 655 de la secuencia anterior) y la cadena alfa como un fragmento carboxilo terminal (restos aminoacídicos 660 a 1658 de la secuencia anterior), con cuatro aminoácidos (restos aminoacídicos 656-659 de la secuencia anterior) suprimidos entre las dos.

C5a se escinde de la cadena alfa de C5 mediante la convertasa de C5 alternativa o clásica como un fragmento amino terminal que comprende los primeros 74 aminoácidos de la cadena alfa (es decir, los restos aminoacídicos 660-733 de la secuencia anterior). Aproximadamente un 20 por ciento de la masa de 11 kDa de C5a se atribuye a carbohidratos. El sitio de escisión para la acción de la convertasa está en, o inmediatamente adyacente a, el resto aminoacídico 733 de la secuencia anterior. Un compuesto que se uniese a, o adyacente a, este sitio de escisión, tendría el potencial de bloquear el acceso de las enzimas convertasas de C5 al sitio de escisión y de esta forma actuar como un inhibidor del complemento. C5 puede también puede activarse por un medio distinto a la actividad de la convertasa de C5. La digestión limitada con tripsina (véase, por ejemplo, Minta y Man (1997) J Immunol 119: 1597-1602 y Wetsel y Kolb (1982) J Immunol 128: 2209-2216), trombina y tratamiento ácido (Yamamoto y Gewurz (1978) J Immunol 120: 2008 y Damerau et al.

(1989) Molec Immunol 26: 1133-1142) puede también escindir C5 y producir C5b activa. La escisión de C5 libera C5a, una potente anafilotoxina y factor quimiotáctico, y C5b el que a través de una serie de interacciones proteicas lleva a la formación del complejo del complemento terminal lítico, C5b-9. C5a y C5b-9 también tienen propiedades de activación de células pleiotrópicas, mediante la amplificación de la liberación de factores inflamatorios aguas abajo, tales como enzimas hidrolíticas, especies reactivas de oxígeno, metabolitos de ácido araquidónico y diversas citoquinas. C5b se combina con C6, C7 y C8 para formar el complejo C5b-8 en la superficie de la célula diana, tras la unión de varias moléculas de C9, el complejo de ataque de la membrana (MAC, C5b-9, complejo del complemento terminal-- CCT) se forma. Cuando un número suficiente de MAC se inserta dentro de las membranas de las células diana, las aperturas que crean (poros MAC) median una rápida lisis osmótica de las células diana. Concentraciones más bajas, no líticas de MAC pueden producir otros efectos. En particular, la inserción en la membrana de un número pequeño de los de complejos de C5b-9 dentro de células endoteliales y plaquetas puede provocar una activación celular nociva. En algunos casos la activación puede preceder a la lisis celular.

Como se menciona arriba, C3a y C5a son anafilotoxinas. Estos componentes del complemento activados pueden desencadenar la desgranulación de mastocitos, lo que libera histamina de basófilos y mastocitos, y otros mediadores de inflamación, resultando en la contracción del músculo liso, la permeabilidad vascular aumentada, la activación del leucocito, y otros fenómenos inflamatorios incluyendo la proliferación celular resultando en hipercelularidad. C5a también actúa como un péptido quimiotáctico que sirve para atraer granulocitos proinflamatorios al sitio de activación del complemento. Los receptores de C5a se encuentran en las superficies de las células epiteliales bronquiales y alveolares y de las células del músculo liso bronquial. Los receptores de C5a también se encontraron en eosinófilos, mastocitos, monocitos, neutrófilos, y linfocitos activados. El documento EP 0245 993 A2 divulga anticuerpos monoclonales que se unen a C5a. Larric: et al (Infection and Immunity, American Society for Microbiology, USA, Vol. 55, Nº 8, 1987, páginas 1867-1872) divulga la caracterización de anticuerpos monoclonales murinos que reconocen epítopos neutralizantes en C5a de ser humano. Sumario La divulgación se refiere a, entre otros, la generación por los inventores de una serie de anticuerpos monoclonales humanizados que se unen específicamente a la proteína C5a libre (es decir, C5a que se escindió proteolíticamente a partir de la proteína C5), pero no a los fragmentos de las proteínas parálogas C4a libre o C3a libre [en el presente documento los anticuerpos reciben frecuentemente el nombre de anticuerpos anti-C5a o anticuerpos anti neoepítopo de C5a]. Como se describe en el presente documento y se ejemplifica en los ejemplos de trabajo, los anticuerpos anti-C5a generados muestran una alta afinidad por C5a libre. Por ejemplo, todos los anticuerpos anti-C5a humanizados descritos en el presente documento se unen a C5a libre con una KD que es menor que 1,25 nanomolar. Muchos de los anticuerpos se unen a C5a libre (por ejemplo, C5a de ser humano libre) con una KD que es menor que 300 picomolar; varios de estos anticuerpos se unen a C5a libre con una KD que es menor que 100 picomolar. Además, los anticuerpos anti-C5a humanizados descritos en el presente documento también inhiben la señalización mediada por C5a. Propiedades adicionales, estructurales y funcionales, de los anticuerpos descritos en el presente documento, se detallan a continuación y se ejemplifican en los ejemplos de trabajo. Los inventores también han demostrado, usando un modelo animal de artritis reumatoide (AR) y un anticuerpo anti- C5a de ratón sustituto con propiedades similares al anticuerpo humanizado equivalente, la eficacia de los anticuerpos anti-C5a en el tratamiento de la AR. En los ejemplos de trabajo también se muestran experimentos demostrando los efectos terapéuticos positivos de un anticuerpo anti-C5a humanizado en un modelo animal de neutropenia inducida por C5a de ser humano. Por consiguiente, los inventores creen que los anticuerpos anti-C5a, o los fragmentos de unión a antígeno de los mismos, descritos en el presente documento, son útiles en multitud de métodos diagnósticos y terapéuticos relacionados con trastornos en los que la señalización mediada por C5a contribuye a la patogénesis. Por ejemplo, los inventores hacen valer que los anticuerpos humanizados anti-C5a descritos en el presente documento son útiles para el tratamiento o la prevención de la AR y otros trastornos asociados al complemento incluyendo, pero sin limitación: síndrome urémico hemolítico atípico (SUHa), degeneración macular relacionada con la edad (DME), septicemia, quemadura (por ejemplo, quemadura severa), síndrome antifosfolípido (SAF), síndrome de dificultad respiratoria agudo (SDRA), dolor relacionado con inflamación, asma, nefritis lúpica, retardo del crecimiento intrauterino (RCIU), síndrome HELLP (acrónimo de hemolytic anemia, elevated liver enzymes and low platelet count: anemia hemolítica, enzimas hepáticas elevadas y recuento bajo de plaquetas), síndrome de Goodpasture, y enfermedad pulmonar obstructiva crónica (EPOC). Trastornos suplementarios que son particularmente susceptibles de ser tratados con un anticuerpo anti-C5a humanizado, o fragmento de unión a antígeno del mismo, se conocen en la técnica y se enumeran en el presente documento.

Los anticuerpos anti-C5a humanizados descritos en el presente documento presentan un número de ventajas, por ejemplo, sobre agentes que se unen a, e inhiben la escisión de, la longitud completa de C5 madura. Como estos agentes, los anticuerpos anti-C5a (y los fragmentos de unión a antígeno de los mismos) descritos en el presente documento son capaces de inhibir los efectos anafilotóxicos aguas abajo de la activación de C5 como la mediada a través del fragmento C5a de C5. Es decir, los anticuerpos anti-C5a descritos en el presente documento pueden inhibir la respuesta inflamatoria mediada por C5a, la que es conocida por desempeñar una parte integral en la patogénesis de trastornos asociados al complemento tales como, pero sin limitación, septicemia, AR, y asma. Sin embargo, como la concentración de C5 en suero de ser humano es de aproximadamente 0,37 µM (Rawal y Pangburn (2001) J Immunol 166(4): 2635-2642), el uso de altas concentraciones y/o la frecuente administración de anticuerpos anti C5 es a menudo necesaria para inhibir de forma eficaz C5, y de tal manera inhibir la respuesta inflamatoria mediada por C5a en un ser humano. A diferencia de C5, C5a está presente en sangre a muy bajas concentraciones y a menudo se restringe a áreas específicas de la activación del complemento local tales como, por ejemplo, los pulmones en pacientes asmáticos, las articulaciones de pacientes con AR, o los drusen en los ojos de los pacientes con DME. Por lo tanto, los anticuerpos anti-C5a descritos en el presente documento pueden administrase (por ejemplo, administrarse localmente en sitios de activación del complemento) a un ser humano a una dosis mucho más baja y/o menos frecuentemente que, por ejemplo, un anticuerpo anti C5, y proporcionar de manera eficaz la misma o mayor inhibición de C5a en un ser humano. La capacidad para administrar una dosis menor del anticuerpo anti-C5a, en comparación con la dosis necesaria de un anticuerpo anti C5, también permite vías de administración suplementarias tales como, por ejemplo, administración subcutánea, administración intramuscular, administración intrapulmonar, y administración a través del uso de microesferas biológicamente degradables. Una menor concentración del antígeno C5a contra C5 también favorece una vida media más prolongada del anticuerpo anti-C5a comparado con, por ejemplo, la vida media de un anticuerpo terapéutico que se dirige contra el complemento terminal, debido a su reducida contribución a la eliminación de anticuerpo mediada por antígeno.

Además, los anticuerpos anti-C5a descritos en el presente documento se pueden distinguir de agentes terapéuticos que inhiben el complemento terminal (tales como inhibidores de C5) por su perfil de seguridad. Una consecuencia notable de la inhibición de componentes del complemento terminal tales como C5, C5b, C6, C7, C8 o C9, es la protección disminuida del sistema inmunitario del hospedador contra las bacterias encapsuladas que el complemento terminal habitualmente lisa, por ejemplo, Neisseria meningitides y Neisseria gonorrhoeae. Véase, por ejemplo, Haeney et al (1980) Clin Exp Immunol 40: 16-24 y Brodsky (2009) Blood 113(26): 6522-6527. Como los anticuerpos anti-C5a inhiben la respuesta inflamatoria mediada por C5a, pero no impiden la formación del complejo del complemento terminal que lisa las bacterias encapsuladas, los pacientes que reciben un anticuerpo terapéutico anti-C5a descrito en el presente documento no requerirían una vacunación protectiva, por ejemplo, una vacunación contra Neisseria meningitides y Neisseria gonorrhoeae. Por consiguiente, se proporcionan un anticuerpo aislado o un fragmento de unión a antígeno del mismo que se une a un polipéptido C5a libre, donde C5a libre es un polipéptido de ser humano (C5ah) que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, y donde el anticuerpo o fragmento de unión a anticuerpo del mismo se une al polipéptido C5ah libre in vitro con una KD que es menor que 1,25 x 10-9 M según se mide por resonancia de plasmones superficiales (RPS) en presencia de un exceso molar de C5 de ser humano natural no escindida, y donde el anticuerpo o fragmento de unión a antígeno del mismo comprenden: I.

(a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; o (ii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y (b) un polipéptido de cadena pesada que comprende: (i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30; o (ii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47; II.

(a) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27; (b) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 36 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33; (c) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27; (d) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 25; (e) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27; (f) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 40 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33; (g) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33; (h) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45; (i) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 44; (j) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49; (k) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45; o (l) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 36 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49; o III.

(a) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45; (b) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 40 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49; o (c) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47.

En una realización el anticuerpo aislado o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: (i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30.

En otra realización, el anticuerpo aislado o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47.

En otra realización, el anticuerpo aislado o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: (i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30. En otra realización, el anticuerpo aislado o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47. Así, se describe un anticuerpo aislado, o fragmentos de unión a antígeno del mismo, que se une a C5a libre. El anticuerpo o fragmento de unión a antígeno del mismo se puede unir a C5a libre de ser humano (C5ah; por ejemplo, una proteína C5a de ser humano que comprende, o consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 1). En algunos aspectos de la divulgación, los anticuerpos pueden unirse a una forma desarginada de C5a libre, por ejemplo, la forma desarginada de C5a de ser humano que comprende, o consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 2. El anticuerpo puede unirse a un neoepítopo de C5a libre, cuyo epítopo no está presente en C5 no escindida o está presente solamente en una fracción minoritaria de C5 no escindida total.

Aunque la divulgación de ninguna manera se limita a ninguna teoría particular o mecanismo de acción, en algunos aspectos de la divulgación, el anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se une a C5a libre (por ejemplo, C5ah libre) y puede también unirse a una subpoblación de C5 procesada no escindida (por ejemplo, C5 plasmática) que constituye menos que el 10 (por ejemplo, menor de 9,5, 9, 8,5, 8, 7,5, 7, 6,5, 6, 5,5, 5, 4,5, 4, 3,5, 3, 2,5, 2, 1,5, 1, 0,5, 0,4, 0,3, 0,2, o menor de 0,1) % de la población total de C5 de longitud completa en una muestra (por ejemplo, una muestra de sangre o plasma o una muestra que comprende C5 de longitud completa recombinante), cuya subpoblación está, en su totalidad o en parte, desnaturalizada de tal manera que un neoepítopo de C5a de otra manera ocluido, al que se une el anticuerpo anti-C5a o un fragmento, está expuesto. Así, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede, en algunos aspectos de la divulgación, unirse a C5a libre, pero no a la proteína C5 no escindida del 90% o más de la población de C5 natural no escindida. En algunos aspectos de divulgación, la anteriormente descrita subpoblación de C5 parcialmente o totalmente desnaturalizada está inactiva o tiene una actividad reducida (por ejemplo, un % menor de 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, 5 de la actividad de la proteína C5 de longitud completa y completamente funcional) en cualquier número de ensayos adecuados útiles para probar la actividad de C5, por ejemplo, un ensayo hemolítico o un ensayo CH50eq (véase más abajo). Los métodos adecuados para probar la actividad de la subpoblación minoritaria a la que el anticuerpo anti-C5a, descrito en el presente documento, puede unirse, se conoce en la técnica y se describe en el presente documento. En algunos aspectos de la divulgación, ninguno de los anticuerpos anti-C5a o fragmentos de unión a antígeno del mismo descritos en el presente documento inhibe la actividad de C5 en un ensayo de hemólisis in vitro o en un ensayo CH50eq in vitro incluso en la presencia de un exceso de al menos, igual a, o mayor que 5 (por ejemplo, 5,6, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, o 200) veces del anticuerpo anti-C5a o el fragmento de unión a antígeno del mismo respecto a C5 no escindida (por ejemplo, C5 nativa no escindida). En algunos aspectos de la divulgación, ninguno de los anticuerpos anti-C5a o fragmentos de unión a antígeno del mismo descritos en el presente documento inhibe la actividad C5 en un ensayo de hemólisis in vitro o en un ensayo CH50eq in vitro incluso en presencia de un exceso de aproximadamente entre 5 veces a 200 veces (por ejemplo, entre aproximadamente 5 veces y 100 veces, entre aproximadamente 10 veces y 100 veces, entre aproximadamente 20 veces y 100 veces, o entre aproximadamente 10 veces y 150 veces) del anticuerpo anti-C5a o fragmento de unión a antígeno del mismo respecto a C5 natural no escindida. La inhibición, por ejemplo, en lo que concierne a la actividad de C5, incluye al menos el 5 (por ejemplo, al menos el 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, o 60) % de disminución en la actividad de C5 natural no escindida en, por ejemplo, un ensayo hemolítico o un ensayo H50eq en comparación con el efecto de un anticuerpo de control (o fragmento de unión a antígeno del mismo) en condiciones similares y a una concentración equimolar. Inhibición sustancial, como se usa en el presente documento, se refiere a la inhibición de una dada actividad (por ejemplo, de la actividad de C5) de al menos el 40 (por ejemplo, al menos de 45, 50, 55,60, 65, 70, 75, 80, 85, 90, o 95 o mayor) %. En algunas realizaciones, la C5 se obtiene a partir de plasma (por ejemplo, purificada a partir de, o presente en, plasma, por ejemplo plasma de ser humano). En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo se une a una proteína C5a (por ejemplo, una proteína C5a de ser humano) con una KD que es menor que 2 nM. En algunos aspectos, el anticuerpo o fragmento de unión a antígeno del mismo se une a proteína una C5a con una KD que es menor que 1 nM [también denominado en el presente documento como “afinidad subnanomolar”]. En algunos aspectos de la divulgación, el anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se une a C5a libre con una afinidad subnanomolar [por ejemplo, una KD que es menor que, o igual a 9,9 x 10-10 (por ejemplo, menor que o igual a 9 x 10-10, 8 x 10-10, 7 x 10-10, 6 x 10-10, 5 x 10-10, 4 x 10-10, 3 x 10-10, 2,5 x 10-10, 2 x 10-10, 1 x 10- 10, 8,0 x 10-11, 7,0 x 10-11, 6,0 x 10-11, 5,0 x 10-11, 4,0 x 10-11, o 3,0 x 10-11) M ] en presencia de un exceso molar de C5 natural no escindida (por ejemplo, C5 purificada y/o recombinante). En algún aspecto de la divulgación, cualquiera de los anticuerpos anti C5 o fragmentos de unión a antígeno del mismo descritos en el presente documento, tienen al menos unas 100 (por ejemplo, al menos 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 225, 250, 275, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, o 10000) veces mayor afinidad (por ejemplo, representado por sus KD) por C5a libre que por proteína C5 natural no escindida. Así, en otro aspecto, la divulgación presenta un anticuerpo o fragmento de unión a antígeno del mismo que (a) se une a C5a libre (por ejemplo, C5ah) con una afinidad subnanomolar y (b) se une a C5a libre con una afinidad que es al menos 100 (por ejemplo, al menos 110,120, 130, 140, 150, 160,170,180, 190, 200, 225, 250, 275, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, o 10000) veces más grande que su afinidad correspondiente por la proteína C5 natural no escindida. Por ejemplo, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento pueden, en algunas realizaciones, unirse a C5ah libre con una KD de 100 nM y a al menos una subpoblación de proteína C5 de ser humano no escindida con una KD que es al menos 100 veces mayor (por ejemplo, al menos de 10 nM). En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une a un polipéptido de C5a de ser humano libre que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, en el que el anticuerpo o fragmento de unión a antígeno del mismo se une al polipéptido C5a de ser humano con una KD que es menor que 1,25 x 10-9 M en presencia de un exceso molar (por ejemplo, un exceso molar de 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, o 500 veces) de C5 de ser humano natural no escindida sobre C5a de ser humano (C5ah). En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo se une a un polipéptido C5ah libre con una afinidad subnanomolar (por ejemplo, cualquiera de las KD subnanomolares enumeradas en el presente documento) en presencia de al menos, o mayor que, un exceso 2 veces molar, pero no mayor o menor que 500 (por ejemplo, 500, 450, 400, 350, 300, 250, 200, 150, 100, 90, 80, 70, 60, 50, 40, 30, 25, 20, o 15) veces de exceso molar de C5 natural no escindida sobre C5ah libre. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo se une a un polipéptido C5ah libre con una afinidad subnanomolar (por ejemplo, cualquiera de las KD subnanomolares enumeradas en el presente documento) en la presencia de entre 2 veces y 20 veces de exceso molar de C5 natural no escindida sobre C5ah libre. En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo se une a un polipéptido C5ah libre con una afinidad subnanomolar (por ejemplo, cualquiera de las KD subnanomolares enumeradas en el presente documento) en presencia de entre 10 veces y 20 veces de exceso molar de C5 natural no escindida sobre C5ah libre. En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo se une a un polipéptido C5ah libre con una afinidad subnanomolar (por ejemplo, cualquiera de las KD subnanomolares enumeradas en el presente documento) en la presencia de entre 5 veces y 15 veces de exceso molar de C5 natural no escindida sobre C5ah libre. En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo se une a un polipéptido C5ah libre con una afinidad subnanomolar (por ejemplo, cualquiera de las KD subnanomolares enumeradas en el presente documento) en presencia de al menos 2 veces, pero no mayor que un exceso molar de 20 veces de C5 natural no escindida sobre C5ah libre. Dichas mediciones pueden ser mediciones in vitro utilizando, por ejemplo, técnicas estándar de determinación de la afinidad, muchas de las cuales son enumeradas y/o descritas en el presente documento. En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une a un polipéptido C5a de ser humano que tiene una secuencia de aminoácidos representada en SEC ID Nº: 1, en el que el anticuerpo o fragmento de unión a antígeno del mismo se une al polipéptido C5a de ser humano con una KD que es menor que 1,25 x 10-9 M y en el que el anticuerpo o fragmento de unión a antígeno del mismo no inhibe sustancialmente, en comparación con una cantidad equimolar de un anticuerpo de control o fragmento de unión a antígeno del mismo, la actividad de C5 incuso en presencia de menos que, o igual a, un exceso molar de 10 veces del anticuerpo anti-C5a o fragmento de unión a antígeno del mismo a C5 natural no escindida.

En algunos aspectos de la divulgación de cualquiera de los anticuerpos anti-C5a o fragmentos de unión a antígeno de los mismos descritos en el presente documento, los anticuerpos o fragmento de unión a antígeno del mismo se unen a C5a de ser humano libre y reacciona de forma cruzada con C5a libre de al menos una especie de mamífero que no es ser humano. Por ejemplo, en algunos aspectos de la divulgación, una anticuerpo anti-C5a (o fragmento de unión a antígeno del mismo) se une a C5a libre de ser humano (por ejemplo, con afinidad subnanomolar) y también se une a C5a libre de un primate que no es ser humano (por ejemplo, mono cinomolgo, mono rhesus, simio, babuino, chimpancé, orangután, o gorila), un roedor (por ejemplo, ratón, rata, hámster, cobaya, o conejo), vaca, cabra, burro, cerdo, perro, gato o caballo. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah libre con una KD de menos que o igual a 9,9 x 10-10 (por ejemplo, menos que o igual a 9 x 10-10, 8 x 10-10, 7 x 10-10, 6 x 10-10, 5 x 1010, 4 x 10-10, 3 x 10-10, 2,5 x 10-10, 2 x 1010, 1 x 10-10, 8,0 x 10-11, 7,0 x 10-11 6,0 x 10-11, 5,0 x 10-11, 4,0 x 10-11, o 3,0 x 10-11) M y también se une a C5a libre de mono cinomolgo (u otra especie de primate que no es ser humano), en el que la afinidad (por ejemplo, representada por su KD) por C5a de ser humano es de no más que 500 (por ejemplo, no más que 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 200, 250, 300, 350, 400, 450, o 475) veces mayor que la afinidad por C5a de mono cinomolgo (u otra especie de primate que no sea ser humano). Por ejemplo, en algunos aspectos de la divulgación, el anticuerpo anti-C5a se une a C5ah libre con una afinidad que no es más que 50 veces mayor que la afinidad correspondiente del anticuerpo por C5a de primate que no es ser humano (por ejemplo, una KD por C5ah libre de 100 nM y una KD por C5a de primate que no es ser humano de no más que 5 nM). En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento, se une a C5ah libre con una KD de menos que o igual a 9,9 x 10-10 (por ejemplo, menos que o igual a 9 x 1010, 8 x 10-10, 7 x 10-10, 6 x 10-10, 5 x 10-10, 4 x 10-10, 3 x 1010, 2,5 x 10-10, 2 x 10-10, 1 x 10-10, 8,0 x 10-11, 7,0 x 10-11, 6,0 x 10-11, 5,0 x 10-11, 4,0 x 10-11, o 3,0 x 10-11) M y también se une a C5a de un roedor (por ejemplo, ratón, rata o conejo), en el que la afinidad (por ejemplo, representada por su KD) por C5a de ser humano es de no más que 1000 (por ejemplo, no más que 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 200, 250, 300, 350, 400, 450, 475, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, o 975) veces mayor que la afinidad por C5a de roedor.

En algunos aspectos de la divulgación, cualquiera de los anticuerpos anti-C5a o fragmentos de unión a antígeno de los mismos descritos en el presente documento se unen con afinidad subnanomolar a C5a de ser humano y a C5a de un mamífero que no es ser humano (por ejemplo un roedor o un primate que no es ser humano tal como mono cinomolgo). Un anticuerpo o fragmento de unión a antígeno del mismo puede, en algunos aspectos de la divulgación, unirse a C5a de ser humano y a C5a de un primate que no es ser humano con igual afinidad (por ejemplo, una KD equivalente). Por ejemplo, la divulgación presenta un anticuerpo o fragmento de unión a antígeno del mismo que se une C5a de ser humano libre con afinidad subnanomolar [por ejemplo, una KD de menos que o igual a 9,9 x 10-10 (por ejemplo, menor que o igual a 9 x 10-10, 8 x 10-10, 7 x 10-10, 6 x 10-10, 5 x 10-10, 4 x 10-10, 3 x 10-10, 2,5 x 10-10, 2 x 10-10, 1 x 10- , 8,0 x 10-11, 7,0 x 10-11, 6,0 x 10-11, 5,0 x 10-11, 4,0 x 10-11, o 3,0 x 10-11) M ] y su reactividad cruzada con C5a libre de mono cinomolgo (u otro primate que no es ser humano), uniéndose el anticuerpo o fragmento de unión a antígeno del mismo a C5a de mono cinomolgo (u otro primate que no es ser humano) con una KD de menos que 10 x 10-9, 9 x 10-9, 8 x 10-9, 7 x 10-9, 6 x 10-9, 5 x 10-9, 4 x 10-9, 3 x 10-9, 2 x 10-9, 1 x 10-9, 9,9 x 10-10 (por ejemplo, menor que 9 x 10-10, 8 x 10-10, 7 x 10-10, 6 x 10-10, 5 x 10-10, 4 x 10-10, 3 x 10-10, 2,5 x 10-10, 2 x 10-10, 1 x 10-10, o 8,0 x 10-11) M], en el que la afinidad para C5a de ser humano es de no más que 500 (por ejemplo, no más que 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 200, 250, 300, 350, 400, 450, o 475) veces mayor que la afinidad por C5a de mono cinomolgo (o un primate que no es ser humano) (por ejemplo, KD para C5a de ser humano de 100 nM y una KD por C5a de un primate que no es ser humano de no más que 50 nM). Los métodos adecuados para determinar la afinidad de un anticuerpo o fragmento de unión a antígeno del mismo para un dado antígeno se conocen en la técnica y se describe y ejemplifica en el presente documento. En algunos aspectos de la divulgación, el anticuerpo anti-C5a que reacciona de forma cruzada o fragmento de unión a antígeno del mismo, inhibe funcionalmente C5ah libre y C5a de un mamífero que no es ser humano a las cuales este se une. Por ejemplo, un anticuerpo inhibe en al menos 70% (por ejemplo, al menos 75, 80, 85, 90, o 95 o mayor) la activación de neutrófilos de ser humano dependiente de C5a de ser humano en una proporción molar de 1:1 (sitio de unión a antígeno:C5a) e inhibe en al menos 70% (por ejemplo, al menos 75, 80, 85, 90, o 95 o mayor) la activación de neutrófilos dependiente de C5a de mamífero que no es ser humano (siendo los neutrófilos de la misma especie que la C5a de mamífero que no es ser humano a la que el anticuerpo se une) en una proporción molar de 1:1 (sitio de unión a antígeno:C5a).

En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une a un polipéptido C5ah libre que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, en la que el anticuerpo o fragmento de unión a antígeno del mismo se une al polipéptido C5a de ser humano con una KD que es menor que 1,25 x 10-9 M y en el que el anticuerpo o fragmento de unión a antígeno del mismo se une a C5ah y a C5a de una especie de mamífero que no es ser humano. La especie de mamífero que no es ser humano puede ser, por ejemplo, un primate que no es ser humano tal como mono cinomolgo, mono rhesus, o babuino. En algunos aspectos de la divulgación la especie de mamífero que no es ser humano es un roedor tal como un ratón, rata, conejo, cobaya, gerbo, o hámster. En algún aspecto de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo se une a C5ah con una afinidad no mayor que 100 veces mayor que la afinidad correspondiente por C5a de la especie de mamífero que no es ser humano. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno inhibe al menos el 50% de la activación de neutrófilos de ser humano dependiente de C5a de ser humano en una proporción molar de 1:1 (sitio de unión a antígeno:C5a). En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo se une a C5a libre de un primate que no es ser humano (por ejemplo, un mono cinomolgo o mono rhesus), teniendo la proteína C5a libre una secuencia de aminoácidos que comprende, o consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 179 o SEC ID Nº: 180. Como se describe en los ejemplos de trabajo, los inventores han descubierto también un anticuerpo anti-C5a bivalente, BNJ383, que se une a C5a libre (en este caso C5a de ser humano) con una alta afinidad y, con una afinidad mucho menor, a C5 de ser humano no escindida (C5h), en el que, en una composición (por ejemplo, una solución acuosa) en condiciones fisiológicas de equilibrio, y en presencia de un exceso molar de C5 de ser humano no escindida en comparación con la cantidad molar de los sitios de unión a antígeno de los anticuerpos, al menos el 95% de la pluralidad de anticuerpos une, cada uno, no más de una molécula de C5h. El segundo sitio de unión a antígeno de al menos el 95% de la pluralidad de anticuerpos permanece disponible (por ejemplo, sustancialmente disponible) para unirse a C5a libre. Aunque la divulgación de ninguna manera se liga a ninguna teoría en particular o mecanismos de acción, los inventores creen que el anticuerpo anti-C5a bivalente se une a C5 no escindida de tal manera (por ejemplo, a un epítopo tal) que la obstaculización estérica impide, o al menos inhibe sustancialmente, la unión del segundo sitio de unión a antígeno del anticuerpo anti-C5a a una segunda proteína C5 no escindida, aunque el anticuerpo puede fácilmente acomodar la unión a dos moléculas de C5ah. Así, el anticuerpo, incluso en un exceso molar de C5 no escindida, conserva la capacidad de unirse a C5a libre con alta afinidad y de este modo conserva, incluso en tal exceso molar, la capacidad de inhibir la capacidad proinflamatoria de C5a. Alguien con la habilidad habitual en la materia apreciaría fácilmente y rápidamente los innumerables beneficios terapéuticos de tal anticuerpo anti-C5a. Por ejemplo, como se indica anteriormente, la concentración de C5 circulante en suero de ser humano es muy alta. Así, cuando se introduce en un mamífero, un anticuerpo anti-C5a que es capaz de unirse simultáneamente a dos moléculas de C5 no escindida ser inactivaría rápidamente en exceso molar de C5 y ya no sería capaz de unirse a C5a libre en el evento de activación del complemento. Y, como con los anticuerpos anti-C5, el uso de altas concentraciones y/o la frecuente administración de este tipo de anticuerpos anti- C5a sería necesario para inhibir eficazmente C5a en el evento que se produce. En contraste, el anticuerpo anti-C5a descrito en el presente documento que conserva la habilidad de unirse a C5a libre, incluso en exceso molar de C5 no escindida, puede así administrarse a un ser humano a una dosis mucho menor y/o menos frecuentemente que, por ejemplo, un anticuerpo anti-C5 y proporcionar eficazmente la misma o mayor inhibición que C5a en el ser humano.

Por consiguiente, en el presente documento también se describe un anticuerpo aislado que comprende dos sitios de unión a antígeno, en el que cada sitio de unión a antígeno puede unirse independientemente a C5a libre de ser humano (C5ah) o C5 de ser humano no escindida (C5h), en el que, en una solución acuosa que comprende: (i) una pluralidad de dichos anticuerpos y (ii) un exceso molar de C5h en comparación con la cantidad molar de los sitios de unión a antígeno, en equilibrio y en condiciones fisiológicas, al menos el 95 (por ejemplo, al menos 95,5, 96, 96,5, 97, 97,5, o 97,7) % de dicha pluralidad de anticuerpos une no más de una molécula de C5h, es decir, no más del 5% de los anticuerpos se une a dos moléculas de C5h en equilibrio. En otro aspecto, la divulgación presenta un anticuerpo aislado que comprende dos sitios de unión a antígeno, en el que cada sitio de unión a antígeno puede unirse independientemente a C5a libre de ser humano (C5ah) o C5 de ser humano no escindida (C5h), en el que en equilibrio y en condiciones fisiológicas, en una solución acuosa que comprende: (i) una pluralidad de dichos anticuerpos y (ii) un exceso molar de C5h en comparación con la cantidad molar de los sitios de unión a antígeno (o anticuerpos), al menos el 95% de dicha pluralidad de anticuerpos conserva al menos un sitio de unión a antígeno disponible para unirse a C5ah libre.

En otro aspecto, la divulgación presenta un anticuerpo aislado que comprende dos sitios de unión a antígeno, en el que cada sitio de unión a antígeno puede unirse independientemente a C5a libre de ser humano (C5ah) o C5 de ser humano no escindida (C5h), en el que en equilibrio y en condiciones fisiológicas, en una solución acuosa que comprende: (i) una pluralidad de dichos anticuerpos y (ii) un exceso molar de C5h en comparación a la cantidad molar de los sitios de unión a antígeno (o anticuerpos), cada sitio de unión a antígeno de no más del 5% de dicha pluralidad de anticuerpos se une a una molécula de C5h. En algunos aspectos de la divulgación de cualquiera de los anticuerpos aislados descritos en el presente documento, el exceso molar es al menos un exceso molar de dos veces (por ejemplo, al menos de 2 veces, 3 veces, 4 veces, 5 veces, 6 veces, 7 veces, 8 veces, 9 veces o incluso 10 veces).

En algunos aspectos de la divulgación de cualquiera de los anticuerpos aislados descritos en el presente documento, la condición fisiológica es NaH2PO4 3,9 mM, Na2HPO4 6,1 mM y NaCl 150 mM, a pH 7,0. En algunos aspectos de la divulgación de cualquiera de los anticuerpos aislados descritos en el presente documento, cada sitio de unión a antígeno puede unirse independientemente a C5ah libre con una KD que es menor que 1,25 x 10-9 M. En algunas realizaciones, cada sitio de unión a antígeno puede unirse independientemente a C5ah libre con una afinidad subnanomolar (véase más arriba). En algunas realizaciones de cualquiera de los anticuerpos aislados descritos en el presente documento, el anticuerpo aislado comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45. En algunas realizaciones de cualquiera de los anticuerpos aislados descritos en el presente documento, el anticuerpo aislado comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; (ii) una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; (iii) una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; (iv) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28, (v) una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y (vi) una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47. En algunos aspectos de la divulgación, el anticuerpo aislado puede comprender cualquiera de los conjuntos de cadena ligera CDR descritos en el presente documento, cualquiera de las regiones variables de cadena ligera descritas en el presente documento (por ejemplo, cualquiera de las regiones variables de cadena ligera humanizadas), cualquiera de los conjuntos de cadena pesada CDR descritos en el presente documento, cualquiera de las regiones variables de cadena pesada descritas en el presente documento (por ejemplo, cualquiera de las regiones variables de cadena pesada humanizadas), o cualquiera de las combinaciones adecuadas de los mismos. Véase, por ejemplo, las Tablas 1 o 2.

En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno asociado con el complemento (por ejemplo, un trastorno del complemento asociado con C5a), en el que los métodos incluyen administrar a un ser humano cualquiera de los anticuerpos aislados descritos en el presente documento en una cantidad suficiente para tratar el trastorno asociado al complemento.

En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de trastornos del complemento asociados a C5a, en el que los métodos comprenden administrar al ser humano al menos 0,6 mg (por ejemplo, al menos 0,7, 0,8, 0,9 o 1 mg) de cualquiera de los anticuerpos aislados descritos en el presente documento por kg de peso corporal del ser humano para, de esta manera, unir parcial o completamente y secuestrar niveles de nanogramos de C5a libre durante más de, durante, o al menos durante 12 (por ejemplo, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, o 25) días. En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno del complemento asociado con C5a, en el que los métodos comprenden administrar al ser humano al menos 10 mg de cualquiera de los anticuerpos aislados descritos en el presente documento por kg de peso corporal del humano para de esta manera unir parcial o completamente y secuestrar niveles de nanogramos de C5a libre durante al menos 24 días. En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno del complemento asociado a C5a, en el que el método comprende administrar al ser humano cualquiera de los anticuerpos aislados descritos en el presente documento (o por ejemplo una composición farmacéutica que comprenda cualquiera de los anticuerpos aislados descritos en el presente documento) en una cantidad suficiente para (a) conseguir valores molares de Cmáx iguales a, o de menos que, la concentración fisiológica molar de C5h no escindida y (b) unir parcial o completamente y secuestrar niveles patofisiológicos de C5a libre.

En algunos aspectos de cualquiera de los métodos descritos en el presente documento, un anticuerpo se administra a un sujeto (por ejemplo, un ser humano) en una cantidad suficiente para conseguir un valor molar de la Cmáx que sea sustancialmente menor que la concentración molar fisiológica de C5 no escindida (por ejemplo, C5h).

En algunos aspectos de cualquiera de los métodos descritos en el presente documento, el valor de la Cmáx es, por ejemplo, no mayor que 80 nM (o aproximadamente 0,6 mg/kg). En algunos aspectos, los niveles de la Cmáx no son mayores que 70 (por ejemplo, 60, 50, 40, 30 o 20) nM. En algunos aspectos, el valor de la Cmáx no es mayor que aproximadamente 100 mM.

En algunos aspectos, el valor de la Cmáx es no mayor que 200 nM. En algunos aspectos de cualquiera de los métodos descritos en el presente documento, el valor la Cmáx es, por ejemplo, no mayor que 400 nM (o aproximadamente 3 mg/kg). En algunos aspectos, el valor la Cmáx es no mayor que 400 (por ejemplo, 350, 300, 250, 200, 150, 100, 90, 80, 70, 60, 50, 40, 30, 20 o 10) nM. En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno del complemento asociado a C5a, en el que el método comprende administrar a un ser humano cualquiera de los anticuerpos aislados descritos en el presente documento (o por ejemplo una composición farmacéutica que comprenda cualquiera de los anticuerpos aislados descritos en el presente documento) en una cantidad suficiente para (a) conseguir valores molares de la Cmáx iguales a, menores que, o sustancialmente menores que la concentración fisiológica molar de C5h no escindida y (b) unir parcial o completamente y secuestrar niveles de nanogramo de C5a libre durante al menos 12 días (por ejemplo, al menos 24 días). Los valores adecuados de la Cmáx se describen más arriba. En algunos aspectos de cualquiera de los métodos descritos en el presente documento, el trastorno del complemento asociado a C5a puede ser, por ejemplo, uno elegido entre el grupo consisten en septicemia, síndrome de dificultad respiratoria agudo (SDRA), shock septicémico, síndrome antifosfolípido, síndrome antifosfolípido catastrófico, coagulación intravascular disemina, nefritis lúpica, síndrome de Goodpasture, quemadura o quemadura severa, asma, síndrome HELLP (acrónimo de hemolytic anemia, elevated liver enzymes and low platelet count: anemia Hemolítica, enzimas hepáticas elevadas y recuento bajo de Plaquetas), dolor inducido por inflamación, neutropenia inducida por C5a, degeneración macular relacionada con la edad (DME), enfermedad pulmonar obstructiva crónica y artritis reumatoide. En otro aspecto más, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, en los que cada sitio de unión a antígeno puede independientemente unirse a C5a de ser humano libre (C5ah) o C5 de ser humano no escindida (C5h), y en los que, en la presencia de C5 de ser humano (C5h) y en condiciones fisiológicas, no más del 5% de los anticuerpos de la pluralidad en equilibrio comprende dos sitios de unión a antígeno unidos simultáneamente a C5h no escindida. En algunos aspectos de cualquiera de las composiciones descritas en el presente documento, el porcentaje de la pluralidad de cualquier configuración de unión particular puede evaluarse usando cromatografía líquida de alto rendimiento (HPLC). En algunos aspectos la divulgación, las condiciones fisiológicas en la que los anticuerpos se evalúan comprenden las siguientes condiciones: incubación de C5h (por ejemplo, un exceso molar (por ejemplo, un exceso molar de 2 veces) de C5h) con la pluralidad de anticuerpos a 4 ºC durante 84 horas en una solución acuosa que comprende NaH2PO4 3,9 mM, Na2HPO4 6,1 mM y NaCl 150 mM, a pH 7,0. Para los propósitos de esta divulgación, la solución obtenida a las 84 horas a 4 ºC se considera que está en equilibrio. En algunos aspectos de cualquiera de las composiciones descritas en el presente documento, no más que el 5% de los anticuerpos de la pluralidad comprenden dos sitios de unión a antígeno unidos simultáneamente a C5h no escindida en condiciones fisiológicas y en presencia de un exceso molar de al menos 2 veces de C5h respecto al anticuerpo. En algunos aspectos de cualquiera de las composiciones descritas en el presente documento, no más el 5% de los anticuerpos de la pluralidad comprenden dos sitios de unión a antígeno unidos simultáneamente a moléculas C5h no escindida según se evalúa usando HPLC después de la incubación de la pluralidad de los anticuerpos con C5h a 4 ºC durante 84 horas en una solución acuosa que comprende NaH2PO4 3,9 mM, Na2BPO4 6,1 mM y NaCl 150 mM, a pH 7,0. En otro aspecto, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, que comprende cada anticuerpo de la pluralidad dos sitios de unión a antígeno, en los que cada sitio de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o C5 de ser humano no escindida (C5h), en el que no más que el 5% de los anticuerpos de la pluralidad comprenden dos sitios de unión a antígeno unidos simultáneamente a C5h no escindida según se evalúa (por ejemplo, usando HPLC) después de la incubación de la pluralidad de anticuerpos con C5h a 4 ºC durante 84 horas en una solución acuosa que comprende NaH2PO4 3,9 mM, Na2HPO4 6,1 mM y NaCl 150 mM, a pH 7,0.

En otro aspecto más, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, cada anticuerpo de la pluralidad comprende un primer sitio de unión a antígeno y un segundo sitio de unión a antígeno, en los que cada sitio de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o C5 de ser humano no escindida (C5h), en los que cada sitio de unión a antígeno puede unirse independientemente al polipéptido C5ah libre con una KD que es menor que 1,25 x 10-9 M, y en el que, en presencia de C5 de ser humano (C5h) y como se evalúa (por ejemplo, usando cromatografía líquida de alto rendimiento (HPLC)) en condiciones fisiológicas, los sitios de unión de antígeno de al menos el 95% de la pluralidad de los anticuerpos se ocupa por C5h no escindida en las siguientes configuraciones: (i) el primer sitio de unión a antígeno se une a C5h no escindida y al segundo sitio de unión a antígeno no está unido; o (ii) el primer sitio de unión a antígeno no está unido y el segundo sitio de unión a antígeno se une a C5h no escindida.

En otro aspecto más, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, en el que cada sitio de unión a antígeno se puede unir independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), y en el que, en la presencia de C5 de ser humano (C5h) como se evalúa (por ejemplo, usando cromatografía líquida de alto rendimiento (HPLC)) bajo condiciones fisiológicas, al menos el 95% de los anticuerpos de la pluralidad comprenden al menos un sitio de unión a antígeno capaz de unirse a C5ah libre. En algunos aspectos de cualquiera de las composiciones descritas en el presente documento, la pluralidad de los anticuerpos se evalúa en la presencia de al menos 2 veces de exceso molar de C5h:anticuerpo. En algunos aspectos de cualquiera de las composiciones descritas en el presente documento, la pluralidad de anticuerpos se evalúa en la presencia de al menos 2 veces de exceso molar de C5h:sitios de unión a antígeno. En otro aspecto más, la divulgación presenta un anticuerpo aislado que comprende dos sitios de unión a antígeno, en el que los anticuerpos se unen a C5a libre o a C5 no escindida, y en el que uno de los sitios de unión a antígeno del anticuerpo permanece disponible para unir C5a libre en la presencia de un exceso molar (por ejemplo, al menos o mayor que 2 veces, 5 veces, 10 veces, 15 veces, o incluso un exceso molar de 20 veces) de C5 no escindida. En algunos aspectos de la divulgación, los sitios de unión a antígeno tienen la misma especificidad, (por ejemplo, los CDR de cada uno de los dos sitios de unión a antígeno comparten secuencias de aminoácidos idénticas). En algunas realizaciones, C5a libre es C5a de ser humano. En algunos aspectos de la divulgación el anticuerpo reacciona de forma cruzada entre C5a de ser humano y C5a de una especie de mamífero que no es ser humano. El anticuerpo puede, en algunos aspectos, unirse a C5a libre con una afinidad subnanomolar. En algunos aspectos la divulgación, el anticuerpo tiene una afinidad por C5a que es al menos 100 veces mayor que su correspondiente afinidad por C5 no escindida.

En otro aspecto, la divulgación presenta un anticuerpo aislado que comprende dos sitios de unión a antígeno, en el que cada sitio de unión antígeno se une independientemente a C5a de ser humano libre (C5ah) o C5 de ser humano no escindida (C5h), y en el que, a cualquier concentración de C5h no escindida (por ejemplo, en un exceso molar de C5h no escindida sobre C5ah), al menos uno de los sitios de unión a antígeno del anticuerpo permanece disponible para unirse a C5ah libre (por ejemplo, en condiciones fisiológicas de ser humano, por ejemplo, en sangre de ser humano o suero). En otro aspecto más, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, en la que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, en la que cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o C5 de ser humano no escindida (C5h), y en la que, en una proporción molar de 1:1 (anticuerpo:C5h), no más que, o menos que, 5 (por ejemplo, no más que, o no menos que 4,9, 4,8, 4,7, 4,6, 4,5, 4,4, 4,3, 4,2, 4,1, 4,0, 3,9, 3,8, 3,7, 3,6, 3,5, 3,4, 3,3, 3,2, 3,1, 3,0, 2,9, 2,8, 2,7, 2,6, 2,5, 2,4, 2,3, 2,2, 2,1, 2,0, 1,9, 1,8, 1,7, 1,6, 1,5, 1,4, 1,3, 1,2, 1,1, o 1) % de los anticuerpos de la pluralidad comprende dos sitios de unión a antígeno unidos simultáneamente a C5h no escindida. En algunos aspectos de la divulgación, cada sitio de unión a antígeno puede unirse independientemente C5ah libre con una KD que es menor que 1,25 x 10-9 M (o, por ejemplo, con afinidad subnanomolar). En otro aspecto, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, en la que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, donde cada uno de los sitios de unión a antígeno se puede unir independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), y donde, en presencia de los niveles fisiológicos de C5h no escindida, los anticuerpos de la pluralidad unen parcialmente o completamente y secuestran niveles de nanogramo de C5a libre durante más que, durante, o durante al menos 12 (por ejemplo, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 o 25) días cuando se administra a un ser humano a dosis de 1 mg/kg o mayores.

En otro aspecto más, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, en la que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, donde que cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), y donde, en presencia de niveles fisiológicos de C5h no escindida, los anticuerpos de la pluralidad unen parcialmente o completamente y secuestran niveles de nanogramo de C5a libre durante más que, durante, o al menos durante 12 (por ejemplo, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 o 25) días cuando se administra a un ser humano a dosis de 10 mg/kg o mayores. En otro aspecto más, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, en la que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, donde cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), y donde, en presencia de niveles fisiológicos de C5h no escindida, los anticuerpos de la pluralidad unen parcialmente o completamente y secuestran niveles de nanogramo de C5a libre durante más que, durante, o al menos durante 12 (por ejemplo, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 o 25) días cuando se administra a dosis consiguiendo valores molares de la Cmáx sustancialmente menores que la concentración molar fisiológica de C5h no escindida.

En otro aspecto, la divulgación presenta una composición que comprende una pluralidad de anticuerpos aislados, en la que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, donde cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o C5 de ser humano no escindida (C5h), y donde, en presencia de niveles fisiológicos de C5h no escindida, los anticuerpos de la pluralidad unen parcialmente o completamente y secuestran niveles patofisiólogicos de C5a libre cuando se administran a dosis que alcanzan valores molares de la Cmáx sustancialmente menores que la concentración fisiológica molar de C5h no escindida.

En otro aspecto, la divulgación presenta un anticuerpo aislado que comprende un primer sitio de unión a antígeno y un segundo sitio de unión a antígeno, en el que cada sitio de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), y en el que, cuando ambos sitios de unión a antígeno están completamente ocupados (y, por ejemplo, en condiciones fisiológicas de ser humano, por ejemplo, en sangre de ser humano o suero), las siguientes configuraciones de unión son posibles: (i) el primer sitio de unión a antígeno une C5ah libre y el segundo sitio de unión a antígeno une C5h no escindida; (ii) el primer sitio de unión a antígeno une C5ah libre y el segundo sitio de unión a antígeno une C5ah libre; o (iii) el primer sitio de unión a antígeno une C5h no escindida y el segundo sitio de unión a antígeno une C5ah libre. En otro aspecto más, la divulgación presenta un anticuerpo aislado que comprende un primer sitio de unión a antígeno y un segundo sitio de unión a antígeno, en el que cada sitio de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), en el que cada sitio de unión a antígeno puede unirse independientemente a C5ah libre con una KD que es menor que 1,25 x 10-9 M (o, por ejemplo, con afinidad subnanomolar), y en el que, en una solución fisiológica que contiene una pluralidad de anticuerpos, al menos el 95% de los anticuerpos está en las siguientes configuraciones: (i) el primer sitio de unión a antígeno une C5ah libre y el segundo sitio de unión a antígeno une C5h no escindida; (ii) el primer sitio de unión a antígeno une C5ah libre y el segundo sitio de unión a antígeno une C5ah libre; (iii) el primer sitio de unión a antígeno une C5h no escindida y el segundo sitio de unión a antígeno une C5ah libre; (iv) el primer sitio de unión a antígeno une C5h no escindida y el segundo sitio de unión a antígeno está no unido; (v) el primer sitio de unión a antígeno une C5ah y el segundo sitio de unión a antígeno está no unido; (vi) el primer sitio de unión a antígeno está no unido y el segundo sitio de unión a antígeno une C5ah no escindida; (vii) el primer sitio de unión a antígeno está no unido y el segundo sitio de unión a antígeno une C5ah; y (viii) el primer sitio de unión a antígeno está no unido y el segundo sitio de unión a antígeno está no unido. En otro aspecto, la divulgación presenta un anticuerpo aislado que comprende dos sitios de unión a antígeno, en el que cada sitio de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), y en el que, en exceso molar de C5h no escindida sobre C5ah, el anticuerpo inhibe en al menos el 50% la activación de neutrófilos de ser humano dependiente de C5ah en una proporción molar de 1:1 (sitio de unión a antígeno:C5ah).

En algunos aspectos de cualquiera de los anticuerpos descritos en el presente documento, las configuraciones son posibles en condiciones fisiológicas de ser humano con proteínas C5a y C5 de ser humano naturales, completamente plegadas. En algunos aspectos de cualquiera de los anticuerpos descritos en el presente documento, el anticuerpo se une a C5ah libre con una KD que es menor que 1,25 x 10-9 M (o, por ejemplo, con afinidad subnanomolar). En un aspecto más, la divulgación presenta un anticuerpo que (a) se une a C5a libre (por ejemplo, C5ah) con una afinidad subnanomolar y (b) se une a C5a libre con una afinidad que es de al menos 100 (por ejemplo, al menos 110, 120, 130,140,150, 160, 170, 180, 190, 200, 225, 250, 275, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, o 10000) veces mayor que su correspondiente afinidad por la proteína C5 no escindida. En una composición fisiológica que comprende una pluralidad de los anticuerpos, para al menos el 95% de los anticuerpos, solamente un sitio de unión a antígeno del anticuerpo se une a la proteína C5 no escindida, mientras que el segundo sitio de unión a antígeno permanece disponible para unirse a C5a libre. (La C5ah puede tener la secuencia de aminoácidos representada en SEC ID Nº: 1).

En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno del complemento asociado a C5a, comprendiendo el método administrar al ser humano una composición que comprende una pluralidad de anticuerpos aislados, donde cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, donde cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), donde al menos 1 mg de los anticuerpos por kg de peso corporal del ser humano se administra al ser humano, y donde la administración de los anticuerpos es eficaz para unir parcialmente o completamente y secuestrar niveles de nanogramo de C5a libre durante al menos 12 días. En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno asociado al complemento (por ejemplo, un trastorno del complemento asociado a C5a), comprendiendo el método administrar al ser humano una composición que comprende una pluralidad de anticuerpos aislados, en el que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, en el que cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o C5 de ser humano no escindida (C5h), en el que al menos 10 mg de los anticuerpos por kg de peso corporal del ser humano se administra al ser humano, y en el que la administración de los anticuerpos es eficaz para unir parcialmente o completamente y secuestrar niveles de nanogramo de C5a libre durante al menos 24 días.

En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno asociado al complemento (por ejemplo, un trastorno del complemento asociado a C5a), comprendiendo el método administrar al ser humano una composición que comprende una pluralidad de anticuerpos aislados, en el que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, en el que cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), en el que los anticuerpos se administran a una dosis suficiente para: (a) conseguir valores molares de la Cmáx sustancialmente menores que la concentración fisiológica molar de C5h no escindida y (b) unir parcialmente o completamente y secuestrar niveles de nanogramo de C5a libre durante al menos 12 días.

En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno asociado al complemento (por ejemplo, un trastorno del complemento asociado a C5a), comprendiendo el método administrar al ser humano una composición que comprende una pluralidad de anticuerpos aislados, en el que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, en el que cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), en el que los anticuerpos se administran a una dosis suficiente para: (a) conseguir valores molares de la Cmáx sustancialmente menores que la concentración fisiológica molar de C5h no escindida y (b) unir parcialmente o completamente y secuestrar niveles de nanogramo de C5a libre durante al menos 24 días. En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno asociado al complemento (por ejemplo, un trastorno del complemento asociado a C5a), comprendiendo el método administrar al ser humano una composición que comprende una pluralidad de anticuerpos aislados, en el que cada anticuerpo de la pluralidad comprende dos sitios de unión a antígeno, en el que cada uno de los sitios de unión a antígeno puede unirse independientemente a C5a de ser humano libre (C5ah) o a C5 de ser humano no escindida (C5h), en el que los anticuerpos se administran a una dosis suficiente para: (a) conseguir valores molares de la Cmáx sustancialmente menores que la concentración fisiológica molar de C5h no escindida y (b) unir parcialmente o completamente y secuestrar niveles patofisiológicos de C5a libre. Se entiende que cualquiera de las composiciones (por ejemplo, que comprende una pluralidad de anticuerpos) o anticuerpos aislados (por ejemplo, que retengan, en presencia de C5 o exceso molar de C5, un brazo Fab libre capaz de unirse a C5a libre) descrito en el presente documento pueden: (a) formularse como composiciones farmacéuticas de acuerdo con la divulgación, (b) incluirse en kits terapéuticos (descritos en el presente documento), o (c) incluirse en las jeringas precargardas descritas en el presente documento. Como se describe en los ejemplos de trabajo proporcionados en el presente documento, los inventores han descubierto también un anticuerpo, BNJ383 (véase más abajo), que no solamente se une con alta afinidad (afinidad subnanomolar) a C5ah libre, sino que también, a concentraciones en exceso de C5 no escindida, inhibe la formación del complejo del complemento terminal (CCT) en una manera dependiente de dosis. Sin embargo, incluso a concentraciones del anticuerpo anti-C5a en un exceso mayor que 6,5 veces de C5, la inhibición del CCT no es completa. Aunque la divulgación no se limita en ningún caso a ninguna teoría en particular o mecanismo de acción, el anticuerpo podría inhibir la formación del CCT por la unión a al menos una fracción de C5 no escindida e impedir su escisión y/o de otra manera impedir la asociación satisfactoria de C5 con componentes adicionales del CCT. Los inventores apreciaron que tal anticuerpo es útil para tratar trastornos asociados al complemento, por ejemplo, en los cuales C5a juega un papel significante y el CCT conteniendo C5b puede desempeñar un papel menos sustancial. Dichos trastornos pueden incluir, por ejemplo, septicemia, síndrome de dificultad respiratoria agudo (SDRA), shock septicémico, síndrome antifosfolípido, síndrome antifosfolípido catastrófico, coagulación intravascular diseminada, nefritis lúpica, síndrome de Goodpasture, quemadura o quemadura severa, asma, síndrome HELLP (acrónimo de hemolytic anemia, elevated liver enzymes and low platelet count: anemia hemolítica, enzimas hepáticas elevadas y recuento de plaquetas bajo), dolor inducido por inflamación, neutropenia mediada por C5a, degeneración macular relacionada con la edad (DME), enfermedad pulmonar obstructiva crónica y artritis reumatoide.

Los inventores también aprecian que el uso de tal anticuerpo anti-C5a para tratar estas condiciones, entre otros, puede proporcionar un perfil de seguridad incluso más beneficioso en comparación con el uso de fármacos inhibidores del complemento terminal. Como se señala anteriormente, una consecuencia notable de inhibir componentes de complemento terminal, tales como C5,, C5b, C6, C7, C8 o C9 es la disminución de la protección por el sistema inmunitario del hospedador contra las bacterias encapsuladas que el complemento terminal habitualmente lisa - por ejemplo, Neisseria meningitides y Neisseria gonorrhoeae. Como los anticuerpos anti-C5a descritos en esta sección inhiben la respuesta inflamatoria mediada por C5a, pero no inhiben completamente la formación del complejo del complemento terminal que lisa esas bacterias encapsuladas, los pacientes que reciben un anticuerpo terapéutico anti-C5a descrito en el presente documento podrían no necesitar una vacunación protectora, por ejemplo, una vacunación contra Neisseria meningitides y Neisseria gonorrhoeae. La inhibición parcial del CCT, aunque no la anulación absoluta de la respuesta antimicrobiana del complemento terminal, podría de hecho reducir la inflamación inducida por CCT como daños de tejido. Se cree que la inhibición parcial del CCT en combinación con la inhibición de C5a, hace del anticuerpo anti-C5a un componente antiinflamatorio incluso más potente.

Por consiguiente, en otro aspecto, la divulgación presenta un anticuerpo o fragmento de unión a antígeno del mismo que se une a C5a libre, en el que C5a libre es C5a de ser humano que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, en el que el anticuerpo inhibe la unión de C5a al receptor de C5a, y en el que el anticuerpo inhibe parcialmente la formación del complejo del complemento terminal (CCT). La inhibición parcial por un anticuerpo anti-C5a o fragmento de unión del mismo descrito en el presente documento, puede ser, por ejemplo, una actividad del complemento que es, en presencia del anticuerpo, hasta, o no mayor que, el 80 (por ejemplo, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, o 25) % de la actividad del complemento en ausencia del anticuerpo o fragmento de unión a antígeno del mismo. En algunas realizaciones, el anticuerpo o fragmento de unión a antígeno del mismo se une a C5a libre (por ejemplo C5ah libre) con una afinidad subnanomolar. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo tiene una afinidad por C5a libre que es al menos 100 veces mayor que la afinidad correspondiente del anticuerpo o fragmento de unión a antígeno para C5 no escindida. En algunas realizaciones, el anticuerpo o fragmento de unión a antígeno del mismo inhibe en al menos el 50% la formación del CCT a concentraciones que exceden los 200 (por ejemplo, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 320, 340, 360, 380, o 400 o más) µg/ml según se mide usando un ensayo de CH50eq. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo inhibe en al menos el 50% la activación de la ruta del complemento clásica a concentraciones que exceden los 200 (por ejemplo, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 320, 340, 360, 380, o 400 o más) µg/ml según se mide usando el Kit Wieslab Classical Pathway Complement como se describe en los ejemplos de trabajo. En otro aspecto, la divulgación presenta un método para tratar a un ser humano aquejado de un trastorno asociado al complemento (por ejemplo, un trastorno del complemento asociado a C5a o un trastorno inflamatorio asociado al complemento). El método incluye administrar a un ser humano una cantidad eficaz de un anticuerpo o fragmento de unión a antígeno del mismo que inhibe la unión de C5a al receptor C5a, y en el que el anticuerpo inhibe parcialmente la formación del complejo del complemento terminal (CCT). Véase más arriba. El trastorno puede ser cualquiera de aquellos que se conocen en la técnica o que se describen en el presente documento.

En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une a un polipéptido de C5a de ser humano que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, pero que no se une a la cadena alfa de C5 natural no escindida, donde el anticuerpo o fragmento de unión a antígeno del mismo se une al polipéptido C5a de ser humano con una KD que es menor que 1,25 x 10-9 M.

En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une a un polipéptido de C5a de ser humano que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, pero que no se une a la cadena alfa de C5 natural no escindida, donde el anticuerpo inhibe en al menos el 50% la activación de neutrófilos de ser humano dependiente de C5a de ser humano en una proporción molar de 1:1 (sitio de unión a antígeno:C5a). En algunos aspectos de la divulgación, el anticuerpo inhibe en al menos el 50% de la migración de neutrófilos de ser humano dependiente de C5a de ser humano en un ensayo en el que se usa 0,4 nM del anticuerpo para inhibir la actividad de activación de neutrófilos de 2 nM de C5a de ser humano como se describe en el Ejemplo 5. En algunos aspectos de la divulgación, el anticuerpo no comprende el emparejamiento de CDR ejemplar 3 descrito en la Tabla 1. En algunos aspectos de la divulgación, el anticuerpo no es BNJ371.

En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une al polipéptido C5a de ser humano que tiene la secuencia de aminoácidos representada en SEC ID Nº: 2.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende: una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende: una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende: una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30 En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende: una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 67; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende: una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 o SEC ID Nº: 36. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27 o SEC ID Nº: 33. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 36 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada SEC ID Nº: 33. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 o SEC ID Nº: 17.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27 o SEC ID Nº: 25.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 25.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 o SEC ID Nº: 40. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27 o SEC ID Nº: 33. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 40 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en cualquiera de SEC ID Nº: 45, SEC ID Nº: 44, o SEC ID Nº: 49.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 44.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 o SEC ID Nº: 36. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45 o SEC ID Nº: 49. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 36 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 o SEC ID Nº: 40. En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45 o SEC ID Nº: 49.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45.

En algunas realizaciones, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 40 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49.

En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah con una KD que es menor que 7 x 10-10 M. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah con una KD que es menor que 5 x 10-10 M.

En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah con una KD que es menor que 3 x 10-10 M. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah con una KD que es menor que 2,5 x 10-10 M. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah con una KD que es menor que 1,5 x 10-10 M.

En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah con una KD que es menor que 1,0 x 10-10 M. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah con una KD que es menor que 8,0 x 10-11 M.

En algunos aspectos de la divulgación, un anticuerpo inhibe al menos el 70 (por ejemplo, al menos 75, 80, 85, 90, o 95 o mayor) % la activación de neutrófilos de ser humano dependiente de C5a de ser humano en una proporción molar de 1:1 (sitio de unión a antígeno: C5a). En algunos aspectos, el anticuerpo no comprende el emparejamiento de CDR ejemplar 3 representado en la Tabla 1. En algunos aspectos, el anticuerpo no es BNJ371.

En otro aspecto más, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que comprende un conjunto de CDR de cadena ligera como se indica en la Tabla 3 o la Tabla 7. Por ejemplo, el anticuerpo aislado o fragmento de unión a antígeno del mismo de la divulgación puede comprender un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 140; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 96; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 142; (ii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 156; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 157; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 158; (iii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 164; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 165; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 166; (iv) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 172; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 173; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 174; (v) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 84; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 85; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 86; (vi) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 92; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 89; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 93; (vii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 88; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 89; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 90; (viii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 95; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 96; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 97; (ix) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 99; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 100; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 101; (x) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 84; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 85; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 103; (xi) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 105; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 106; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 107; (xii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 92; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 89; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 108; (xiii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 110; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 111; o (xiv) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 113. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo que comprende el conjunto de CDR de cadena ligera también comprende un polipéptido de cadena pesada que comprende cualquiera de los conjuntos de CDR de cadena pesada como se indica en la Tabla 8.

En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que comprende un conjunto de CDR de cadena pesada como se indica en la Tabla 3 o la Tabla 8. Por ejemplo, en algunos aspectos de la divulgación un anticuerpo aislado o fragmentos de unión a antígenos del mismo descrito en el presente documento comprende un polipéptido de cadena pesada que comprende: (i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 144; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (ii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 67; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30; (iii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 160; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 161; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 162; (iv) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 168; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 169; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 170; (v) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 176; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 177; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 178; (vi) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 116; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (vii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 119; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 120; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 121; (viii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 123; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (ix) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 124; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (x) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 119; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 126; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 127; (xi) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 129; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 131; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 132; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 133; (xiii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47; o (xiv) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 136; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 137; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 138. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo que comprende el conjunto de CDR de cadena pesada también comprende un polipéptido de cadena ligera que comprende cualquiera de los conjuntos de CDR de cadena ligera como se indica en la Tabla 7.

En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que comprende un conjunto de CDR de cadena ligera de la Tabla 7 y su conjunto afín de CDR de cadena pesada como se indica en la Tabla 8. En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que comprende un conjunto de CDR de cadena ligera y cadena pesada emparejadas como se indica en la Tabla 3 o la Tabla 9. Por ejemplo, el algunos aspectos de la divulgación un anticuerpo aislado, o fragmento de unión a antígeno del mismo, descrito en el presente documento comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 140; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 96; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 142; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 144; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (ii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 67; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30; (iii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 156; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 157; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 158; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 160; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 161; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 162; (iv) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 164; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 165; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 166; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 168; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 169; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 170; (v) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 172; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 173; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 174; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 176; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 177; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 178; (vi) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 88; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 89; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 90; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 119; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 120; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 121; (vii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 105; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 106; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 107; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 124; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (viii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 84; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 85; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 86; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 116; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (ix) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 110; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 111; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 136; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 137; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 138; (x) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 113; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47; (xi) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 99; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 100; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 101; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 119; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 126; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 127; (xii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 95; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 96; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 97; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 144; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xiii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 140; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 96; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 142; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 123; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xiv) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 105; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 106; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 107; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 123; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xv) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 92; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 89; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 108; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 144; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xvi) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 92; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 89; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 93; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 123; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xvii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 92; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 89; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 93; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 144; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xviii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 84; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 85; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 103; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 129; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xix) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 95; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 96; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 97; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 123; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; (xx) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 84; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 85; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 103; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 115; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 144; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 117; o (xxi) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 113; una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 131; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 132; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 133.

En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo comprende un conjunto de CDR de cadena ligera y un conjunto de CDR de cadena pesada emparejados como se indica en la Tabla 3. En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo comprende un conjunto de CDR de cadena ligera y un conjunto de CDR de cadena pesada emparejados según se indica en la Tabla 2. Por ejemplo, la divulgación presenta un anticuerpo que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; (ii) una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y (iii) una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; (iv) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; (v) una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y (vi) una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47.

En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo comprende una región variable de cadena ligera que se indica en la Tabla 2, cuya cadena ligera se empareja con cualquiera de las regiones variables de cadena pesada que se indican en la Tabla 2. Por ejemplo, la divulgación presenta un anticuerpo (o un fragmento de unión a antígeno del mismo) que comprende: (a) una región variable de cadena ligera que tiene una secuencia de aminoácidos que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y (b) una región variable de cadena pesada que tiene una secuencia de aminoácidos que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45.

En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo descrito en el presente documento comprende: (i) una región marco conservada de región variable de cadena pesada 1 que comprende la secuencia de aminoácidos representada en SEC ID Nº: 68 o SEC ID Nº: 69; (ii) una región marco conservada de región variable de cadena pesada 2 que comprende la secuencia de aminoácidos representada en SEC ID Nº: 70 o SEC ID Nº: 71; y una región marco conservada de región variable de cadena pesada 3 que comprende la secuencia de aminoácidos representada en cualquiera de las SEC ID Nº:72 a 74. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo comprende una región marco conservada de región variable de cadena pesada 4 que comprende la secuencia de aminoácidos representada en SEC ID Nº: 75. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo comprende una región variable de cadena pesada que comprende la secuencia de aminoácidos representada en cualquiera de SEC ID Nº: 76 a 80. La cadena pesada del anticuerpo puede comprender cualquiera de los conjuntos de CDR de cadena pesada descritos en el presente documento. La región variable de cadena pesada puede emparejarse, en algunas realizaciones, con el polipéptido de región variable que comprende la secuencia de aminoácidos representada en SEC ID Nº: 16.

En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo se une a una proteína C5a que no es de ser humano. Por ejemplo, el anticuerpo o fragmento de unión a antígeno del mismo puede unirse a la proteína C5a de ratón y/o la proteína C5a de ratón desarginada. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo puede unirse a C5a de ratón (y/o C5a de ratón desarginada) y comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 54; (ii) una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 55; (iii) una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 56: (iv) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 62; (v) una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 63; y (vi) una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 64. En algunos aspectos de la divulgación, el anticuerpo anti-C5a de ratón puede comprender un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 59; y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 66.

En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento inhibe la interacción entre C5a y un receptor de C5a. El receptor de C5a puede ser, por ejemplo, C5aR1 o C5L2. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento no inhibe sustancialmente la hemólisis mediada por complemento de glóbulos rojos in vitro y/o in vivo. En algunos aspectos de la divulgación, un anticuerpo (y por consiguiente cualquier fragmento de unión a antígeno del mismo) es un anticuerpo monoclonal, un anticuerpo humanizado, o un anticuerpo completamente de ser humano. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento se selecciona del grupo que consiste en un anticuerpo recombinante, un anticuerpo monocatenario, un diacuerpo, un intracuerpo, un anticuerpo quimerizado o quimérico, un anticuerpo de ser humano desinmunizado, un fragmento Fv, un fragmento Fd, un fragmento Fab, unos fragmentos Fab' y un fragmento F(ab')2. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento es multiespecífico (por ejemplo, biespecífico) en el que el anticuerpo o fragmento se une a al menos dos epítopos diferentes. Los dos epítopos diferentes pueden ser, por ejemplo, dos epítopos diferentes de la misma proteína (por ejemplo, C5a) o el anticuerpo puede unirse a un primer epítopo de una primera proteína (por ejemplo, C5a) y a un segundo epítopo de una segunda proteína. En algunos aspectos de la divulgación, un anticuerpo aislado o fragmento de unión a antígeno del mismo descrito en el presente documento comprende un resto heterólogo. El resto heterólogo puede ser, por ejemplo, un azúcar. Por ejemplo, el anticuerpo o fragmento de unión a antígeno del mismo puede estar glucosilado. El resto heterólogo puede ser, por ejemplo, un marcador detectable tal como, pero sin limitación, un marcador fluorescente, un marcador luminiscente, un marcador de metal pesado, un marcador radioactivo, o un marcador enzimático. En algunos aspectos de la divulgación, un anticuerpo anti-C5a aislado y fragmento de unión a antígeno del mismo descrito en el presente documento se modifica con un resto que mejora la estabilización y/o retención del anticuerpo en circulación. Por ejemplo, la modificación puede ser pegilación o hesilación. En otra realización, el anticuerpo anti- C5a puede contener una región constante alterada que tiene reducida (o no) la función efectora, en comparación con la función efectora de su correspondiente región constante no alterada. En algunas realizaciones, el anticuerpo anti-C5a contiene una región constante alterada que tiene entre aproximadamente 0 a aproximadamente 20% de la función efectora de la región constante no alterada. Las realizaciones ejemplares de tales anticuerpos con función efectora disminuida se describen en el presente documento. En otro aspecto, la divulgación presenta un anticuerpo aislado o fragmento de unión a antígeno del mismo que bloquea de forma cruzada la unión de cualquiera de los anticuerpos anteriores.

En otro aspecto más, la divulgación presenta una composición farmacéutica que comprende uno o más de cualquiera de los anticuerpos aislados o fragmentos de unión a antígeno del mismo descrito en el presente documento y un vehículo, diluyente y/o excipiente farmacéuticamente aceptable.

En otro aspecto, la divulgación presenta: (i) un ácido nucleico que codifica uno o más de cualquiera de los anticuerpos o fragmentos de unión a antígeno del mismo descritos en el presente documento; (ii) un vector que comprende el ácido nucleico; (iii) un vector de expresión que comprende el ácido nucleico; y/o (iv) una célula que comprende el vector o el vector de expresión. En otro aspecto, la divulgación presenta un método para producir un polipéptido (tal como cualquiera de los anticuerpos o fragmentos de unión a antígeno de los mismos descritos en el presente documento). El método comprende el cultivo de la célula que se menciona anteriormente (que comprende el vector de expresión) en condiciones y durante un tiempo suficiente para permitir la expresión en la célula del anticuerpo o fragmento de unión a antígeno codificado por el ácido nucleico en el vector. El método también puede incluir aislar el anticuerpo o fragmento de unión a antígeno a partir de la célula o a partir del medio en el cual la célula se cultiva.

En otro aspecto, la divulgación presenta un ácido nucleico aislado que codifica cualquiera de las secuencias de aminoácidos descritas en el presente documento o un polipéptido que tiene una secuencia de aminoácidos que comprende, o consiste en, cualquiera de las secuencias de aminoácidos indicadas en el presente documento. El ácido nucleico puede incluirse en un vector, por ejemplo, un vector de expresión, y/o puede presentarse en una célula. En otro aspecto más, la divulgación presenta un kit terapéutico que comprende: (i) uno o más de los anticuerpos aislados o fragmentos de unión a antígeno descritos en el presente documento (por ejemplo, uno o más de cualquiera de los anticuerpos humanizados o fragmentos de unión a antígeno de los mismos descritos en el presente documento); y (ii) los medios para la administración del anticuerpo o fragmento de unión a antígeno a un sujeto. Los medios pueden ser adecuados para, por ejemplo, administración subcutánea, administración intraocular, o administración intraarticular del anticuerpo o fragmento de unión a antígeno del mismo al sujeto. Los medios pueden ser, por ejemplo, una jeringa, una jeringa de dos cañones, o dos jeringas distintas incorporadas para su uso en la administración de un anticuerpo terapéutico o fragmento de unión a antígeno del mismo, mientras se extrae fluido de la rodilla (por ejemplo, para análisis) en una forma de empuje y tracción. En algunos aspectos de la divulgación, el medio es para la administración ocular y comprende un parche transescleral o una lente de contacto, cada uno de los cuales comprende el fragmento de unión a anticuerpo del mismo. En algunos aspectos de la divulgación, el medio es adecuado para administración intrapulmonar. Por ejemplo, el medio puede ser un inhalador o un nebulizador. En algunos aspectos de la divulgación, el medio es una jeringa precargada tal como un dispositivo de pluma. La jeringa precargada puede contener, por ejemplo, al menos una forma de dosificación unitaria farmacéutica de uno o más de los anticuerpos o fragmentos de unión a antígeno de los mismos proporcionados en el presente documento. En algunos aspectos de la divulgación, los kits terapéuticos descritos en el presente documento pueden contener al menos un agente activo adicional para su uso en el tratamiento de trastornos asociados al complemento en un sujeto. El agente activo adicional puede ser, por ejemplo, cualquiera de los agentes adicionales descritos en el presente documento. En otro aspecto más, la divulgación presenta un método para tatar o prevenir un trastorno asociado al complemento.

El método incluye administrar a un ser humano en necesidad del mismo un anticuerpo terapéutico o fragmento de unión a antígeno del mismo descrito en el presente documento, en una cantidad suficiente para tratar un trastorno asociado al complemento que aflija a un ser humano. El método también puede incluir la identificación del sujeto como que tiene un trastorno asociado al complemento. El trastorno asociado al complemento puede ser, por ejemplo, un trastorno inflamatorio asociado al complemento, síndrome urémico hemolítico atípico, degeneración macular relacionada con la edad, artritis reumatoide, septicemia, o síndrome antifosfolípido. En algunas realizaciones, el trastorno asociado al complemento es un trastorno pulmonar asociado al complemento. Por ejemplo, el trastorno pulmonar asociado al complemento puede ser, por ejemplo, asma o enfermedad pulmonar obstructiva crónica. Otros trastornos asociados al complemento, susceptibles de tratamiento o prevención según se indica en el método, se describen en el presente documento. El modo de administración, que puede variar dependiendo del tipo de trastorno asociado al complemento a tratar, puede ser, por ejemplo, administración intravenosa, administración intrapulmonar, administración intraocular, administración subcutánea; o administración intraarticular. En algunos aspectos de la divulgación, el anticuerpo o fragmento de unión a antígeno del mismo se administra al ser humano en una cantidad y con una frecuencia suficiente para mantener un nivel reducido de la actividad sistémica de C5a durante la duración del tratamiento. En algunos aspectos de la divulgación, los métodos pueden incluir después de la administración, la monitorización del ser humano para una mejora de uno o más síntomas del trastorno asociado al complemento. En algunos aspectos de la divulgación, los métodos pueden incluir administrar al ser humano uno o más agentes terapéuticos adicionales. En otro aspecto más, la divulgación presenta un artículo de fabricación, que comprende: (i) un envase con una etiqueta y (ii) una composición que comprende un anticuerpo o fragmento de unión a antígeno del mismo descrito en el presente documento. La etiqueta puede indicar que la composición es para administrarse a un ser humano que tiene, se sospecha que tiene, o en riesgo de desarrollar, un trastorno asociado al complemento. El artículo de manufactura puede también incluir uno o más agentes activos adicionales. El término “anticuerpo”, cuando se usa a lo largo del presente documento, se refiere a una molécula de anticuerpo completa o intacta (por ejemplo, IgM, IgG, IgA, IgD, o IgE) que se genera mediante cualquiera de una variedad de métodos que se conocen en la técnica y se describen en el presente documento. El término “anticuerpo” incluye un anticuerpo policlonal, un anticuerpo monoclonal, un anticuerpo quimerizado o quimérico, un anticuerpo humanizado, un anticuerpo de ser humano desinmunizado, y un anticuerpo completamente de ser humano. El anticuerpo se puede hacer en, o derivar de, cualquiera de una variedad de especies, por ejemplo, mamíferos tales como seres humanos, primates que no son seres humanos (por ejemplo, monos, babuinos, o chimpancés), caballos, ganado, cerdos, oveja, cabras, perros, gatos, conejos, cobayas, gerbos, hámsteres, ratas, y ratones. El anticuerpo puede ser un anticuerpo purificado o recombinante. Como se usan en el presente documento, las expresiones “fragmento de anticuerpo”, “fragmento de unión a antígeno”, o expresiones similares, se refieren a un fragmento o a un anticuerpo que conserva la capacidad de unirse a un antígeno (por ejemplo, un epítopo presente en C5a, pero no está presente en la cadena alfa de la proteína C5 natural no escindida), por ejemplo, un anticuerpo monocatenario (scFV, del inglés single chain Fv), un fragmento Fd, un fragmento Fab, un fragmento Fab', o un fragmento F(ab')2. Un scFv es una cadena polipeptídica sencilla que incluye las regiones variables de cadena pesada y de cadena ligera del anticuerpo a partir del cual el scFv deriva. Además, diacuerpos (Poljak (1994) Structure 2(12):1121-1123; Hudson et al. (1999) J Immunol Methods 23(1-2):177-189), minicuerpos, triacuerpos (Schoonooghe et al. (2009) BMC Biotechnol 9:70), anticuerpos de dominio (también conocidos como "inmunoglobulinas de cadena pesada" o camélidos; Holt et al. (2003) Trends Biotechnol 21(11):484-490); e intracuerpos (Huston et al. (2001) Hum Antibodies 10(3-4):127-142; Wheeler et al. (2003) Mol Ther 8(3):355-366; Stocks (2004) Drug Discov Today 9(22): 960-966) se incluyen en la definición de fragmentos de anticuerpo y pueden incorporarse en las composiciones, y usarse en los métodos, descritos en el presente documento. A menos que se defina de otro modo, todos los términos técnicos y científicos que se utilizan en el presente documento tienen el mismo significado según se entiende comúnmente por alguien con la experiencia habitual en la materia a la que esta divulgación pertenece. En caso de conflicto, regirá el presente documento, incluidas las definiciones. Los métodos y materiales preferentes se describen a continuación, aunque métodos y materiales similares o equivalentes a aquellos descritos en el presente documento pueden también utilizarse en la práctica o prueba de los métodos y composiciones que se divulgan ahora. Todas las publicaciones, solicitudes de patente, patentes y otras referencias que se mencionan en el presente documento se incorporan como referencia en su totalidad.

Otras características y ventajas de la presente divulgación, por ejemplo, los métodos para el tratamiento en un sujeto de los trastornos asociados al complemento, serán evidentes a partir de la siguiente descripción, los ejemplos, y a partir de las reivindicaciones.

Breve descripción de los dibujos La Figura 1 es un diagrama de Venn representando el grado se solapamiento de los epítopos en C5a de ser humano vinculados con un conjunto seleccionado de anticuerpos murinos anti-C5a de ser humano: 5an101ME, 5an180ME, 5an048ME, 5an179ME, y 5an178ME.

La Figura 2 es un gráfico de líneas representando el antagonismo de la señalización mediada por C5a in vitro utilizando un ensayo de activación de neutrófilos. El eje Y representa la medición de la densidad óptica (DO) de un sustrato cromogénico en función de la liberación de mieloperoxidasa por neutrófilos de ser humano recién aislados. El eje X representa la concentración del anticuerpo incubado con las células. Se identifican los anticuerpos humanizados probados - BNJ367, BNJ369, BNJ371, BNJ378, BNJ381, BNJ383, y un anticuerpo anti-C5 humanizado - en la leyenda del recuadro.

La Figura 3 es un gráfico de líneas representando el efecto de varios anticuerpos terapéuticos sobre la inflamación de articulaciones en un modelo murino de artritis reumatoide. El eje Y representa el espesor en milímetros de la articulación de la rodilla inicialmente inflamada. El eje X representa los días después de la aparición de la enfermedad. Los anticuerpos terapéuticos probados - 5an195ME (un anticuerpo de ratón anti-C5a de ratón) y un anticuerpo de control con la misma región Fc que el anticuerpo anti-C5a - se identifican en la leyenda del recuadro. La Figura 4 es un gráfico de líneas representando el efecto de varios anticuerpos terapéuticos sobre la severidad de la enfermedad en su conjunto, en un modelo murino de artritis reumatoide. El eje Y representa el índice de artritis. El eje X representa los días después de la aparición de la enfermedad. Los anticuerpos terapéuticos probados - 5an195ME (un anticuerpo de ratón anti-C5a de ratón) y un anticuerpo de control con la misma región Fc que el anticuerpo anti-C5a - se identifican en la leyenda del recuadro. La Figura 5 indica una serie de secuencias de región variable de cadena pesada humanizadas. En orden desde arriba hacia abajo: la región variable de cadena pesada del anticuerpo anti-C5a humanizado BNJ345 (SEC ID Nº: 76); la región variable de cadena pesada del anticuerpo anti-C5a humanizado BNJ346 (SEC ID Nº: 77); la región variable de cadena pesada del anticuerpo anti-C5a humanizado BNJ347 (SEC ID Nº: 78); la región variable de cadena pesada del anticuerpo anti-C5a humanizado BNJ354 (SEC ID Nº: 79); y la región variable de cadena pesada del anticuerpo anti-C5a humanizado BNJ350 (SEC ID Nº: 80). El experto en la materia apreciará la delineación entre las regiones marco conservadas de cadena pesada 1, 2, 3 y 4 y las CDR de cadena pesada 1, 2, y 3. Dichas delineaciones como se definen por Kabat et al. (citado posteriormente) se muestran en la figura. "RMC CP1" se refiere a la región marco conservada de la región variable de cadena pesada 1, "RMC CP2" se refiere a la región marco conservada de la región variable de cadena pesada 2, "RMC CP3" se refiere a la región marco conservada de la región variable de cadena pesada 3, y "RMC CP4" se refiere a la región marco conservada de la región variable de cadena pesada 4. "CDR1 CP" se refiere a la región determinante de complementariedad (CDR) de la región variable de cadena pesada 1, "CDR2 CP" se refiere a la CDR2 de la región variable de cadena pesada, y "CDR3 CP" se refiere a la CDR3 de la región variable de cadena pesada.

La Figura 6 es un gráfico de líneas que representa el porcentaje de neutrófilos circulantes en la sangre de ratones después de la administración de C5ah a los ratones. Sobre el eje Y, el recuento de neutrófilos se expresa como un porcentaje de la "medida basal", que es el recuento de neutrófilos a tiempo 0 (o 100% neutrófilos). El eje X representa el tiempo en minutos. Se administró de forma intravenosa a cohortes de ratón un anticuerpo de control [antígeno de protección anti-ántrax 63, isotipo IgG2/G4] ("control"; cinco ratones) o el anticuerpo anti-C5a de ser humano BNJ383 a una de las siguientes dosis: 24 mg/kg (cinco ratones); 12 mg/kg (cinco ratones); 6 mg/kg (cinco ratones); y 3 mg/kg (cinco ratones) y más tarde se les administró C5ah. Véase el Ejemplo 13. No se administró C5a de ser humano a seis ratones “simulados”. La Figura 7 es un gráfico de barras representando el nivel de mieloperoxidasa (MPO) en el plasma de ratones antes y después de la administración de C5a de ser humano a los ratones. El eje Y representa la concentración (ng/ml) de MPO en plasma de ratón. El eje X representa el tiempo en minutos. Se administró de forma intravenosa a cohortes de ratón un anticuerpo de control [antígeno de protección anti-ántrax 63, isotipo IgG2/G4] ("control"; ocho ratones) o el anticuerpo anti-C5a de ser humano BNJ383 a una de las siguientes dosis: 24 mg/kg (cinco ratones); 12 mg/kg (cinco ratones); 6 mg/kg (cinco ratones); y 3 mg/kg (cinco ratones) y más tarde se les administró C5ah. No se administró C5a de ser humano a cuatro ratones “simulados”.

La Figura 8 es un gráfico de líneas representando el cambio en el nivel de C5a de ser humano en el plasma de ratones (a los que se administró C5a de ser humano) en presencia o ausencia de diferentes concentraciones de un anticuerpo anti-C5ah (BNJ383). El eje Y representa la concentración (ng/ml) de C5ah en plasma de ratón. El eje X representa tiempo en minutos. Se administró de forma intravenosa a cohortes de ratón un anticuerpo de control [antígeno de protección anti-ántrax 63, isotipo IgG2/G4] ("control"; seis ratones) o el anticuerpo anti-C5a de ser humano BNJ383 a una de las siguientes dosis: 24 mg/kg (tres ratones); 12 mg/kg (tres ratones); 6 mg/kg (tres ratones); y 3 mg/kg (tres ratones) y más tarde se les administró C5ah. No se administró C5a de ser humano a cuatro ratones “simulados”. La Figura 9 es un gráfico de líneas representando la competición por la unión a C5a de ser humano in vitro. Se incubó el anticuerpo anti-C5a (BNJ383) marcado con rutenio 250 pM con C5ah biotinilada 1 nM, junto con varias concentraciones (por ejemplo, 400, 133, 44,4, 14,8, 4,9, 1,6, y 0,5 nM) de uno de los siguientes: (a) proteína C5a de ser humano desarginada en solución salina tamponada por fosfato, (b) plasma de ser humano, (c) plasma de mono cinomolgo, (d) plasma de Balb/C (ratón), o (e) plasma de DBA/2J (ratón). Con respecto a los componentes plasmáticos (b), (c), (d), y (e), la concentración se refiere a la concentración final aproximada del antígeno C5 en la mezcla de incubación. El eje Y representa unidades de fluorescencia arbitrarias en función de la cantidad de anticuerpo anti-C5a marcado con rutenio detectado. El eje X representa la concentración (nM) del competidor antigénico. La Figura 10 es un gráfico de líneas representando el efecto de varias proteínas inhibitorias del complemento sobre la ruta alternativa (RA) del complemento. El eje Y representa el porcentaje de la actividad de la RA del complemento en comparación con la medida basal (MB; el nivel de la actividad sin un inhibidor del complemento). El eje X representa la concentración de un inhibidor del complemento dado (µM). Se evaluaron los efectos del anticuerpo anti-C5ah, BNJ383, junto con un anticuerpo anti-C5, sobre la actividad de la RA.

La Figura 11 es un gráfico de líneas representando el efecto de varias proteínas inhibitorias del complemento sobre la ruta clásica (RC) del complemento. El eje Y representa el porcentaje de la actividad de la RC del complemento en comparación a la medida basal (MB; el nivel de actividad en ausencia de un inhibidor del complemento). El eje X representa la concentración de un inhibidor del complemento dado (µM). Se evaluaron los efectos del anticuerpo anti-C5ah, BNJ383, junto con un anticuerpo anti-C5, sobre la actividad de la RC. Las Figuras 12A, 12B, 12C, y 12D son una serie de cromatografías representando los tiempos de retención del anticuerpo anti-C5a (BNJ383) y un anticuerpo anti-C5h con y sin proteína C5h. Para todos los paneles, el eje X representa el tiempo de retención en minutos y el eje Y representa las unidades de absorbancia a una longitud de onda de 214 nm. En cada panel, el subpanel incluido representa una vista aumentada de los picos destacados.

La Figura 12A representa el tiempo de retención para BNJ383 sin proteína C5h. La Figura 12B representa el tiempo de retención para el anticuerpo anti-C5 sin proteína C5h. La Figura 12C representa el tiempo de retención para BNJ383 sin C5h (exceso molar de 2,1 veces de C5h sobre BNJ383). De derecha a izquierda, los picos enumerados representan: (a) BNJ383 no formando complejo o C5h; (b) BNJ383 con un sitio de unión a antígeno unido a C5h no escindida; y (c) una fracción minoritaria concordante con una ocupación dual de BNJ383 con C5h no escindida. La Figura 12D representa el tiempo de retención para el anticuerpo anti-C5 con una cantidad equimolar de C5h. De derecha a izquierda, los picos enumerados representan: (a) anticuerpo anti-C5 no formando complejo o C5h; (b) el anticuerpo anti-C5 con un sitio de unión a antígeno unido a C5h no escindida; y (c) el anticuerpo anti-C5 unido a dos moléculas de C5 no escindidas.

La Figura 13 es un gráfico de líneas representando la unión del anticuerpo anti-C5a BNJ383 a C5ah desarginada con C5h utilizando un ELISA. El eje X representa la concentración (ng/ml) del anticuerpo. El eje Y representa la densidad óptica a una longitud de onda de 450 nm. La Figura 14 es un diagrama de dispersión representando la concentración de C5a/C5a desarginada libres presente en el plasma de monos cinomolgos en función de la concentración plasmática del anticuerpo anti-C5a (BNJ383). El eje Y representa la concentración (pg/ml) de C5a/C5a desarginada detectada en muestras de plasma de monos cinomolgos a lo largo del tiempo abarcando desde 1 día hasta 30 días después de la administración intravenosa de BNJ383 a una única dosis de 1 mg/kg, 10 mg/kg, 100 mg/kg, 250 mg/kg, o 400 mg/kg de peso corporal de los animales. El eje X representa la concentración de BNJ383 (µg/ml) en cada una de las muestras. La Figura 15A es un diagrama de dispersión representando el porcentaje de la actividad hemolítica en muestras de suero con respecto a los valores de la medida basal (eje Y) iniciada a través de la ruta clásica en función de la concentración de anticuerpo anti-C5a (BNJ383) en circulación (eje X). La Figura 15B es un diagrama de dispersión representando el porcentaje de formación del complejo del complemento terminal iniciado a través de la ruta clásica en muestras de suero medido por un ensayo CH50eq con respecto a los valores de la medida basal (eje Y) en función de la concentración del anticuerpo anti-C5a (BNJ383) en circulación (eje X).

La Figura 15C es un diagrama de dispersión representando el porcentaje de formación del complejo del complemento terminal iniciado a través de la ruta clásica en muestras de suero medido por un ensayo RCC con respecto a los valores de medida basal (eje Y) en función de la concentración de anticuerpo anti-C5a (BNJ383) en circulación (eje X) Descripción detallada La presente divulgación proporciona anticuerpos y fragmentos de unión a antígenos de los mismos que se unen a C5a libre (por ejemplo, C5a de ser humano libre), composiciones que contienen los anticuerpos o sus fragmentos, y métodos para el uso de cualquiera de los anteriores para tratar o prevenir trastornos asociados al complemento tales como, pero sin limitación, SUHa, degeneración macular (por ejemplo, DME), AR, septicemia, síndrome antifosfolípido, quemadura (por ejemplo, quemadura severa), síndrome de Goodpasture, nefritis lúpica, o un trastorno pulmonar asociado al complemento tal como asma o enfermedad pulmonar obstructiva crónica (EPOC). La divulgación también proporciona anticuerpos anti-C5a (y fragmentos de los mismos) que reaccionan de forma cruzada con C5a libre de ser humano y C5a libre de una especie de mamífero que no es ser humano tal como un primate que no es ser humano (por ejemplo, mono cinomolgo o mono rhesus). Aunque de ninguna manera pretenden ser limitantes, los anticuerpos ejemplares (y fragmentos de unión a antígeno), composiciones (por ejemplo, composiciones farmacéuticas y formulaciones), y métodos para el uso de las composiciones se detallan a continuación y se ejemplifican en los Ejemplos de trabajo.

Anticuerpos anti-C5a y fragmentos de unión a antígeno de los mismos La divulgación proporciona anticuerpos que se unen al componente C5a del complemento. Como se discute más arriba, la proforma de C5, una proteína precursora de 1676 restos aminoacídicos, se procesa mediante una serie de eventos de escisión proteolítica. Los primeros 18 aminoácidos (numerados -18 a -1) constituyen un péptido señal que se escinde de la proteína precursora. La proteína de 1658 aminoácidos restante se escinde en dos lugares para formar las cadenas alfa y beta. El primer evento de escisión tiene lugar entre los restos aminoacídicos 655 y 656. El segundo evento de escisión tiene lugar entre los restos aminoacídicos 659 y 660. Los dos eventos de escisión dan lugar a la formación de tres fragmentos polipeptídicos distintos: (i) un fragmento que comprende los aminoácidos 1 a 655, que se denomina como la cadena beta; (ii) un fragmento que comprende los aminoácidos 660 a 1658, que se denomina la cadena alfa; y (iii) un fragmento tetrapeptídico que consiste en los aminoácidos 656 a 659. Los fragmentos polipeptídicos cadena alfa y cadena beta se conectan entre sí a través de uniones disulfuro y constituyen la proteína C5 madura. La convertasa C5 de la RC o de la RA activa a la C5 madura mediante la escisión de la cadena alfa entre los restos 733 y 734, lo que da lugar a la liberación del fragmento C5a (aminoácidos 660 a 733). La porción restante de C5 madura es el fragmento C5b, que contiene los restos 734 a 1658 de la cadena alfa unida por uniones disulfuro a la cadena beta.

C5a se metaboliza rápidamente in vivo mediante una enzima sérica, la carboxipeptidasa B, a una forma de 73 aminoácidos llamada “C5 desarginada”, la que perdió el resto de arginina carboxiloterminal. Por consiguiente, en algunos aspectos de la divulgación, un anticuerpo que se une a C5a libre también se une a C5a desarginada. En algunos aspectos de la divulgación, un anticuerpo que se une a C5a no se une a C5a desarginada.

En algunos aspectos de la divulgación, el anticuerpo anti-C5a se une a un neoepítopo presente en C5a, es decir, un epítopo que se expone después de la liberación de C5a del fragmento cadena alfa de C5 madura. Es decir, en algunos aspectos, un anticuerpo anti-C5a descrito en el presente documento se une a C5a y/o C5a desarginada, pero no se une a C5 natural (totalmente plegada), no escindida.

Como se describe anteriormente, en algunos aspectos de la divulgación, el anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se puede unir a una subpoblación de C5 procesada, no escindida (por ejemplo, C5 plasmática) constituyendo menos que el 10 (por ejemplo, menos de 9,5, 9, 8,5, 8, 7,5, 7, 6,5, 6, 5,5, 5, 4,5, 4, 3,5, 3, 2,5, 2, 1,5, 1, 0,5, 0,4, 0,3, 0,2, o menos que 0,1) % de la población total de C5 de longitud completa en una muestra (por ejemplo, una muestra de sangre o de plasma o una muestra que comprende C5 de longitud completa recombinante), cuya subpoblación se encuentra desnaturalizada en su totalidad, o en parte, de tal manera que el neoepítopo de C5a, que de otra forma estaría ocluido, se encuentra expuesto. Así, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede, en algunas realizaciones, unirse a C5a libre, pero no al 90% o más de la población de C5 natural no escindida. En algunas realizaciones, la subpoblación parcialmente o totalmente desnaturalizada se encuentra inactiva o tiene una actividad reducida (por ejemplo, menos que el 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, 5% de la actividad de la proteína C5 de longitud completa, completamente funcional) en cualquier número de ensayos adecuados, útiles para probar la actividad de C5, por ejemplo, un ensayo hemolítico o un ensayo CH50eq. Los métodos adecuados para probar la actividad de la subpoblación minoritaria a la cual un anticuerpo anti-C5a descrito en el presente documento puede, en algunas realizaciones, unirse, se conocen en la técnica y se describen en el presente documento. En algunos aspectos de la divulgación, el anticuerpo anti-C5a se une a una proteína C5a de mamífero (por ejemplo, un ser humano). Por ejemplo, el anticuerpo anti-C5a puede unirse a una proteína C5a de ser humano que tiene la siguiente secuencia de aminoácidos: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTE CCVVASQLRANISHKDMQLGR (SEC ID Nº: 1). En algunos aspectos de la divulgación, un anticuerpo anti-C5a puede unirse a la proteína C5a de ser humano desarginada que tiene la siguiente secuencia de aminoácidos: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLG (SEC ID Nº: 2). Un anticuerpo anti-C5a descrito en el presente documento puede unirse a C5 de ser humano de longitud completa y a C5 de ser humano desarginada.

En algunos aspectos de la divulgación, el anticuerpo puede unirse a C5a de ser humano, a un epítopo dentro de, o solapando con, un fragmento estructural de la proteína que tiene la secuencia de aminoácidos: TLQKKIEEIAAKYK (SEC ID Nº: 3); HSVVKKCCYDGAC (SEC ID Nº: 4); VNNDE (SEC ID Nº: 5); TCEQRAAR (SEC ID Nº: 6); ISLG (SEC ID Nº: 7); PRCIKAFTECCVVASQLRANIS (SEC ID Nº: 8); HKDMQLG (SEC ID Nº: 9); o HKDMQLGR (SEC ID Nº: 10), véase, por ejemplo, Cook et al. (2010) Acta Cryst D66:190-197. En algunos aspectos de la divulgación, el anticuerpo puede unirse a C5a en un epítopo dentro de, o solapando con, la secuencia de aminoácidos de un fragmento peptídico de C5a que comprende al menos 2 de los restos de cisteínas emparejados. Por ejemplo, un anticuerpo anti-C5a se puede unir a un fragmento que comprende, o que consiste en, las secuencias de aminoácidos: CCYDGACVNNDETC (SEC ID Nº: 11); CYDGACVNNDETCEQRAARISLGPRCIKAFTEC (SEC ID Nº: 12; y CEQRAARISLGPRCIKAFTECC (SEC ID Nº: 13), donde, en cada uno de los fragmentos peptídicos, los primeros y últimos restos de cisteína se emparejan por uniones disulfuro. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento puede unirse a una proteína C5a de ser humano en un epítopo dentro de, o solapando con, la secuencia de aminoácidos: YDGACVNNDETCEQRAAR (SEC ID Nº: 14) o CYDGACVNNDETCEQRAA (SEC ID Nº: 15). En algunos aspectos de la divulgación, un anticuerpo puede unirse a una proteína C5a de ser humano o fragmento de la misma conteniendo una secuencia de aminoácidos que contiene, o consiste en, al menos 4 (por ejemplo, al menos cuatro, cinco, seis, siete, ocho, nueve, 10, 11, 12, 13, 14, 15, 16, o 17 o más) aminoácidos consecutivos representados en cualquiera de las SEQ ID Nº: 1 a 15. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento se une a un epítopo ternario que comprende dos o más (por ejemplo, al menos dos, tres, o cuatro) regiones peptídicas discontinuas de la proteína C5a, por ejemplo, dos o más regiones peptídicas de C5a discontinuas conectadas juntas por medio de una unión disulfuro.

Los métodos para identificar el epítopo al que un anticuerpo particular (por ejemplo, un anticuerpo anti-C5a) se une se conocen también en la técnica. Por ejemplo, el epítopo de unión dentro de C5a (o C5a desarginada) al que un anticuerpo anti-C5a se une puede identificarse midiendo la unión del anticuerpo a varios (por ejemplo, a tres, a cuatro, a cinco, a seis, a siete, a ocho, a nueve, 10, 15, 20, o 30 o más) fragmentos peptídicos solapantes de una proteína C5a componente del complemento (por ejemplo varios fragmentos solapantes de una proteína C5a de ser humano que tienen la secuencia de aminoácidos representada en SEC ID Nº: 1 o SEC ID Nº: 2). Cada uno de los diferentes péptidos solapantes se une después a un único lugar sobre un soporte sólido, por ejemplo, pocillos distintos de una placa de ensayo multipocillo. A continuación, el anticuerpo anti-C5a se examina poniéndolo en contacto con cada uno de los péptidos en la placa de ensayo durante una cantidad de tiempo y en condiciones que permitan al anticuerpo unirse a su epítopo. El anticuerpo anti-C5a no unido se elimina lavando cada uno de los pocillos. A continuación, se pone en contacto con cada uno de los pocillos, un anticuerpo secundario marcado de forma detectable que se une al anticuerpo anti-C5a, si está presente en un pocillo de la placa, y el anticuerpo secundario no unido de elimina mediante etapas de lavado. La presencia o cantidad de la señal detectable producida por el anticuerpo secundario marcado de forma detectable en un pocillo es una indicación de que el anticuerpo anti-C5a se une al fragmento peptídico particular asociado con el pocillo, véase, por ejemplo, Harlow y Lane (citados anteriormente), Benny K. C. Lo (citado anteriormente), y la patente de Estados Unidos nº de publicación de 20060153836.

También se puede identificar un epítopo particular al que un anticuerpo se une usando técnicas cromatográficas BIAcore (véase, por ejemplo, el manual Pharmacia BIAtechnology Handbook, "Epitope Mapping," Sección 6.3.2 (Mayo 1994); y Johne et al. (1993) J Immunol Methods 160:20191-8). En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento contiene un conjunto específico de regiones determinantes de complementariedad (CDR) de cadena ligera y/o un conjunto específico de CDR de cadena pesada. Por ejemplo, en algunos aspectos de la divulgación un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede comprender un conjunto de CDR de cadena ligera obtenido a partir de un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en una cualquiera de las SEC ID Nº:19, 37, o 42. En lagunas realizaciones, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede comprender un conjunto CDR de cadena pesada obtenido de un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27 o 45. A continuación se describen con más detalle conjuntos de CDR de cadena ligera y pesada ejemplares obtenidos de las regiones variables de cadena ligera y regiones variables de cadena pesada anteriormente mencionadas (véase la Tabla 1).

Las delimitaciones exactas de las CDR, y de las regiones marco conservadas, se han definido de manera diferente según diferentes métodos. En algunos aspectos de la divulgación, las posiciones de las CDR o de las regiones marco conservadas dentro de un dominio variable de cadena ligera o de cadena pesada pueden ser como definen Kabat et al [(1991) "Sequences of Proteins of Immunological Interest" publicación del NIH nº 91-3242, U.S.

Department of Health and Human Services, Bethesda, MD]. En dichos casos, las CDR pueden recibir el nombre de “CDR de Kabat” (por ejemplo, “CDR2L de Kabat" o " CDR1P de Kabat"). En algunos aspectos de la divulgación, las posiciones de las CDR de una región variable de cadena ligera o de cadena pesada puede ser como definen Chothia et al. (1989) Nature 342:877-883. Por consiguiente, estas regiones pueden recibir el nombre de “CDR de Chothia” (por ejemplo, “CDR2L de Chothia” o " CDR3P de Chothia "). En algunos aspectos de la divulgación, las posiciones de las CDR de las regiones variables de cadena ligera o de cadena pesada pueden ser según definen por definición combinada Kabat-Chothia. En dichos aspectos de la divulgación, estas regiones pueden recibir el nombre de “CDR combinadas de Kabat-Chothia”. En algunos aspectos de la divulgación, las posiciones de las CDR y/o de las regiones marco conservadas dentro de un dominio variable de cadena ligera y de cadena pesada pueden ser según definen Honnegger y Plückthun (2001) J Mol Biol 309: 657-670. La identificación de las CDR dentro de una región variable de cadena ligera o de cadena pesada utilizando las definiciones mencionadas anteriormente se conoce bien en la materia de ingeniería de anticuerpos. Por ejemplo, Thomas et al. [(1996) Mol Immunol 33(17/18):1389-1401] ejemplifican la identificación de las delimitaciones de las CDR de cadena ligera y de cadena pesada de acuerdo a las definiciones de Kabat y Chothia.

Por consiguiente, en algunos aspectos de la divulgación un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede comprender un conjunto de CDR de cadena ligera definido por Kabat, uno definido por Chothia, o uno definido por una combinación de Kabat-Chothia, obtenido de un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en una cualquiera de las SEC ID Nº: 19, 37, o 42. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede comprender un conjunto de CDR de cadena pesada definido por Kabat, uno definido por Chothia, o uno definido por una combinación de Kabat-Chothia obtenido de un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27 o 45. En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena ligera que contiene una o más CDR1 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: RASESVDSYGNSFMH (SEC ID Nº: 20); una CDR2 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: RASNLES (SEC ID Nº: 21); y una CDR3 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: QQSNEDPYT (SEC ID Nº: 22). En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena ligera que contiene cada una de las CDR de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: RASESVDSYGNSFMH (SEC ID Nº: 20); una CDR2 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: RASNLES (SEC ID Nº: 21); y una CDR3 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: QQSNEDPYT (SEC ID Nº: 22). Los anticuerpos ejemplares anti-C5a que comprenden dicho dominio variable de cadena ligera incluyen, por ejemplo, los anticuerpos anti-C5a BNJ364, BNJ367, BNJ378, BNJ366, BNJ369, y BNJ383 descritos en el presente documento (véase más abajo; Tabla 2). En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena ligera que contiene una o más de: una CDR1 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: RASESVDSYGNSFMH (SEC ID Nº: 20); una CDR2 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: WASTRES (SEC ID Nº: 38); y una CDR3 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: QQSNEDPYT (SEC ID Nº: 22). En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena ligera que contiene cada una de las CDR1 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: RASESVDSYGNSFMH (SEC ID Nº: 20); una CDR2 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: WASTRES (SEC ID Nº: 38); y una CDR3 de cadena ligera que comprende o que consiste en la siguiente secuencia de aminoácidos: QQSNEDPYT (SEC ID Nº: 22). Los anticuerpos anti-C5a ejemplares que comprende tal dominio variable de cadena ligera incluyen, por ejemplo, los anticuerpos anti-C5a BNJ371 y BNJ381 descritos en el presente documento (véase más abajo; Tabla 2).

En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena pesada que contiene una o más de: una CDR1 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: DYSMD (SEC ID Nº: 28); una CDR2 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: AINPNSGGTNYNQKFKD (SEC ID Nº: 29); y una CDR3 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: SGSYDGYYAMDY (SEC ID Nº: 30). En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena pesada que contiene cada una de CDR1 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: DYSMD (SEC ID Nº: 28); una CDR2 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: AINPNSGGTNYNQKFKD (SEC ID Nº: 29); y una CDR3 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: SGSYDGYYAMDY (SEC ID Nº: 30). Los anticuerpos anti-C5a ejemplares que comprende tal dominio variable de cadena pesada incluyen, por ejemplo, los anticuerpos anti-C5a BNJ364, BNJ367, BNJ371, y BNJ378 descritos en el presente documento (véase más abajo; Tabla 2).

En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena pesada que contiene una o más de: una CDR1 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: DYSMD (SEC ID Nº: 28); una CDR2 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: AIHLNTGYTNYNQKFKG (SEC ID Nº: 46); y una CDR3 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: GFYDGYSPMDY (SEC ID Nº: 47). En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena pesada que contiene cada una de CDR1 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: DYSMD (SEC ID Nº: 28); una CDR2 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: AIHLNTGYTNYNQKFKG (SEC ID Nº: 46); y una CDR3 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: GFYDGYSPMDY (SEC ID Nº: 47). Los anticuerpos anti-C5a ejemplares que comprende dicho dominio variable de cadena pesada incluyen, por ejemplo, los anticuerpos anti-C5a BNJ366, BNJ369, BNJ381, y BNJ383 descritos en el presente documento (véase más abajo; Tabla 2). En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmentos de unión a antígeno del mismo descrito en el presente documento puede contener una región CDR2 de cadena pesada que comprende la secuencia de aminoácidos: AINPNSGGTNYSQKFKD (SEC ID Nº: 67). Por ejemplo, un anticuerpo anti-C5a descrito en el presente documento puede comprender una región variable de cadena pesada que comprende una o más de una CDR1 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: DYSMD (SEC ID Nº: 28); una CDR2 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: AINPNSGGTNYSQKFKD (SEC ID Nº: 67); y una CDR3 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: SGSYDGYYAMDY (SEC ID Nº: 30). En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento comprende una región variable de cadena pesada que contiene cada una de una CDR1 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: DYSMD (SEC ID Nº: 28); una CDR2 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: AINPNSGGTNYSQKFKD (SEC ID Nº: 67); y una CDR3 de cadena pesada que comprende o consiste en la siguiente secuencia de aminoácidos: SGSYDGYYAMDY (SEC ID Nº: 30). Un ejemplo de un anticuerpo anti-C5a descrito en el presente documento, que contiene dicho polipéptido de cadena pesada y que se une a C5a de ser humano con una KD que es menor a 1 nM es el anticuerpo 5an101ME descrito a continuación. En algunas realizaciones, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento contiene uno de los 1 a 4 emparejamientos ejemplares del conjunto de CDR de cadena ligera y del conjunto de CDR de cadena pesada representados en la Tabla 1.

Tabla 1. Emparejamientos ejemplares de CDR de cadena pesada y cadena ligera Emparejamientos Cadena ligera Cadena pesada Anticuerpos ejemplares con tales de CDR CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 emparejamientos ejemplares 1 SIN:20 SIN:21 SIN:22 SIN:28 SIN:29 SIN:30 BNJ364, BNJ367, BNJ378 2 SIN:20 SIN:21 SIN:22 SIN:28 SIN:46 SIN:47 BNJ366, BNJ369, BNJ383 3 SIN:20 SIN:38 SIN:22 SIN:28 SIN:29 SIN:30 BNJ371 4 SIN:20 SIN:38 SIN:22 SIN:28 SIN:46 SIN:47 BNJ381 "SIN" se refiere a "SEC ID Nº." Las secuencias de aminoácidos representadas por las SEC ID Nº en la Tabla 1 son como se indica en la Tabla 2.

En algunas realizaciones, el anticuerpo anti-C5a no comprende el emparejamiento de CDR ejemplar 3. En algunas realizaciones, el anticuerpo anti-C5a no es BNJ371. En algunas realizaciones, el polipéptido de cadena ligera de un anticuerpo anti-C5a descrito en el presente documento puede ser un polipéptido de cadena ligera λ (por ejemplo, un polipéptido de cadena ligera λ completamente de ser humano o humanizado). En algunas realizaciones, el polipéptido de cadena ligera de un anticuerpo anti-C5a descrito en el presente documento es un polipéptido de cadena ligera κ (por ejemplo, un polipéptido de cadena ligera completamente de ser humano o humanizado). Las secuencias de aminoácidos de numerosos polipéptidos de cadena ligera (por ejemplo, numerosos polipéptidos de cadena ligera de ser humano) son muy conocidas en la técnica y se indican, por ejemplo, en Kabat et al. (1991), citado anteriormente. Las secuencias de aminoácidos de polipéptidos de cadena ligera ejemplares se indican en la Tabla 2. En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento puede comprender una región constante de cadena ligera. Por ejemplo, la región constante de cadena ligera puede ser una región constante de polipéptido de cadena ligera o una región constante de cadena ligera κ. La secuencia de aminoácidos para diversas λ de ser humano, y regiones constantes de cadena ligera κ se conocen en la técnica y se describen en, por ejemplo, Kabat et al. (1991), citado anteriormente. Las secuencias de aminoácidos ejemplares del polipéptido de cadena ligera κ se indican en la Tabla 2.

El polipéptido de cadena pesada puede comprender una región constante (por ejemplo, una región constante de cadena pesada 1 (CP1), una región constante de cadena pesada 2 (CP2), una región constante de cadena pesada 3 (CP3), una región constante de cadena pesada 4 (CP4), o una combinación de cualquiera de las anteriores). El polipéptido de cadena pesada puede comprender una porción Fc de una molécula de inmunoglobulina. La región Fc puede ser, por ejemplo, una región Fc de una molécula de inmunoglobulina IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgE, o IgD o una combinación de porciones de cada una de éstas. Para ser claros, los anticuerpos anti-C5a descritos en el presente documento pueden ser, por ejemplo, de isotipo IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgE, o IgD. Las secuencias de aminoácidos para diversas regiones constantes de cadena pesada de ser humano se conocen en la técnica y se describen en, por ejemplo, Kabat et al. (1991), citado anteriormente.

En algunas realizaciones, el polipéptido de cadena pesada puede comprender una región constante híbrida, o una porción de la misma, tal como una región constante híbrida G2/G4 (véase por ejemplo, Burton et al. (1992) Adv Immun 51:1-18; Canfield et al. (1991) JExp Med 173:1483-1491; y Mueller et al. (1997) Mol Immunol 34(6):441-452). Por ejemplo (y en conformidad con la numeración Kabat), las regiones constantes de IgGl y IgG4 comprenden los restos G249G250 mientras que la región constante de IgG2 no comprende el resto 249, pero comprende G250. En una región constante híbrida G2/G4 donde la región 249-250 proviene de la secuencia G2, la región constante puede modificarse adicionalmente para introducir un resto de glicina en la posición 249 para producir una fusión G2/G4 que tenga G249/G250. Otros dominios constantes híbridos que comprenden G249/G250 pueden también ser parte de anticuerpos modificados por ingeniería genética en conformidad con la divulgación. Las secuencias de aminoácidos ejemplares del polipéptido de cadena pesada se indican en la Tabla 2.

El anticuerpo anti-C5a puede ser, por ejemplo, uno de los anticuerpos específicos ejemplificados en los ejemplos de trabajo: BNJ364, BNJ367, BNJ378, BNJ366, BNJ369, BNJ383, BNJ371, o BNJ381. Las secuencias de aminoácidos para estos anticuerpos anti-C5a ejemplificados, que pueden usarse en conjunción con cualquiera de los métodos escritos en el presente documento, se indican en la Tabla 2.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento comprende un conjunto de CDR de cadena ligera definida por Chothia o un conjunto de CDR de cadena ligera definida de manera combinada por Kabat y Chothia obtenido a partir de cualquiera de las regiones variables de cadena ligera descritas en las Tablas 2 o 3. En algunos aspectos de la divulgación, un anticuerpo anti-C5a, o fragmento de unión a antígeno del mismo, descrito en el presente documento comprende un conjunto de CDR de cadena pesada definida por Chothia o un conjunto de CDR de cadena pesada definido de manera combinada por Kabat y Chothia obtenidos a partir de cualquiera de las regiones variables de cadena pesada descritas en las Tablas 2 o 3. En aspectos preferentes de la divulgación, un anticuerpo anti-C5a descrito se une a C5a, pero no a C5 de longitud completa natural. En algunos aspectos de la divulgación, un anticuerpo anti-C5a se une a C5a, pero no se une a la cadena alfa de C5 natural no escindida. Como se usa en el presente documento, “C5 no escindida” se refiere a una proteína C5 no escindida en los fragmentos C5a y C5b por una convertasa de C5 de la RA o la RC. Una secuencia de aminoácidos ejemplar para una cadena alfa de C5 de ser humano se indica en Haviland et al. (1991), citado anteriormente.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento no se une a los parálogos de C5 de ser humano tales como C3a de ser humano o C4a de ser humano. La divulgación también presenta anticuerpos que bloquean de forma cruzada la unión de un anticuerpo anti-C5a descrito en el presente documento (por ejemplo, bloquea de forma cruzada cualquiera de BNJ364, BNJ367, BNJ378, BNJ366, BNJ369, BNJ371, BNJ381, o BNJ383). Como se usa en el presente documento, la expresión “anticuerpo de bloqueo cruzado” se refiere a un anticuerpo que reduce la cantidad de unión (o impide la unión) de un anticuerpo anti-C5a a un epítopo en un proteína C5a componente del complemento con respecto a la cantidad de unión del anticuerpo anti-C5a al epítopo en ausencia del anticuerpo de bloqueo cruzado. Los métodos adecuados para determinar si un primer anticuerpo bloquea de forma cruzada la unión de un segundo anticuerpo a un epítopo se conocen en la técnica. Por ejemplo, los anticuerpos de bloqueo cruzado se pueden identificar mediante la comparación de la unión del anticuerpo monoclonal anti-C5a BNJ364 con o sin un anticuerpo de prueba. La unión disminuida del anticuerpo BNJ364 en presencia del anticuerpo de prueba en comparación a la unión del anticuerpo BNJ364 en ausencia del anticuerpo de prueba indica que el anticuerpo de prueba es un anticuerpo de bloqueo cruzado. En algunos aspectos de la divulgación, la unión de un anticuerpo a C5a puede inhibir la actividad biológica de C5a. Los métodos para medir la actividad de C5a incluyen, por ejemplo, ensayos de quimiotaxis, radioinmunoensayos (RIA), o ensayos inmunoespecíficos ligados a enzimas (ELISA) (véase, por ejemplo, Ward y Zvaifler (1971) J Clin Invest 50(3):606-16 y Wurzner et al. (1991) Complement Inflamm 8:328-340). En algunos aspectos de la divulgación, la unión de un anticuerpo o fragmento de unión a antígeno del mismo a C5a puede inhibir la activación de neutrófilos in vitro. Los métodos adecuados para determinar si un anticuerpo anti-C5a inhibe la activación de neutrófilos mediada por C5a in vitro, o hasta qué punto el anticuerpo inhibe la activación, se conocen en la técnica y se ejemplifican en los ejemplos de trabajo más adelante. Por ejemplo, neutrófilos de ser humano obtenidos de donantes sanos se pueden aislar y poner en contacto con C5a de ser humano aislada en presencia o ausencia de un anticuerpo anti-C5a de prueba. La activación de neutrófilos de ser humano dependiente de C5a se puede medir en función de la liberación de las células de mieloperoxidasa (MPO) en presencia de C5a. Una inhibición de la cantidad de MPO liberada a partir de las células en presencia de C5a y el anticuerpo de ensayo, en comparación con la cantidad de MPO liberada de células en presencia de C5a y un anticuerpo de control, indica que el anticuerpo de prueba inhibe la activación de neutrófilos mediada por C5a. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmentos de unión a antígeno del mismo no inhibe (o no inhibe substancialmente) la actividad del componente del complemento C5, en comparación con el nivel de inhibición (si la hay) observado para un correspondiente anticuerpo de control o fragmento de unión a antígeno del mismo (es decir, un anticuerpo que no se une a C5a libre o C5). La actividad de C5 puede medirse en función de su capacidad de efectuar la lisis de las células en los fluidos corporales de un sujeto. La capacidad de C5 de efectuar la lisis de las células, o una reducción de las misma, puede medirse por métodos que se conocen bien en la técnica tales como, por ejemplo, un ensayo hemolítico convencional tal como el ensayo de hemólisis descrito por Kabat y Mayer (eds.), "Experimental Immunochemistry, 2ª Edición," 135-240, Springfield, IL, CC Thomas (1961), páginas 135-139, o una variación convencional de este ensayo tal como el método de hemólisis de eritrocitos de pollo como se describe en, por ejemplo, Hillmen et al. (2004) NEngl J Med 350(6):552. En algunos aspectos de la divulgación, la actividad de C5, o inhibición de la misma, se cuantifica usando un ensayo CH50eq. El ensayo CH50eq es un método para medir la actividad total del complemento clásico en suero. Esta prueba es un ensayo lítico, el cual usa eritrocitos sensibilizados con anticuerpos como el activador de la ruta clásica del complemento y varias diluciones del suero de prueba para determinar la cantidad necesaria para dar una lisis del 50% (CH50). El porcentaje de hemólisis se puede determinar, por ejemplo, usando un espectrofotómetro. El ensayo CH50eq proporciona una medida indirecta de la formación del complejo del complemento terminal (CCT) ya que el CCT por sí mismo es directamente responsable de la hemólisis que se mide.

El ensayo se conoce bien y se practica usualmente por aquellos expertos en la materia. En resumen, para activar la ruta clásica del complemento, muestras de suero no diluidas (por ejemplo, muestras de suero de ser humano) se añaden a pocillos de microensayo que contienen los eritrocitos sensibilizados con anticuerpos para generar de este modo CCT. A continuación, el suero activado se diluye en pocillos de microensayo, los que están recubiertos con un agente de captura (por ejemplo, un anticuerpo que se une a uno o más componentes del CCT). El CCT presente en las muestras activadas se une a los anticuerpos monoclonales que recubren la superficie de los pocillos de microensayo. Los pocillos se lavan y se añade a cada pocillo un reactivo de detección que está marcado de forma detectable y reconoce al CCT unido. El marcador detectable puede ser, por ejemplo, un marcador fluorescente o un marcador enzimático. Los resultados del ensayo se expresan en unidades equivalentes de CH50 por ml (U Eq CH50/ml). Los métodos adicionales para la detección y/o medición de la actividad de C5 in vitro se indican y ejemplifican en los ejemplos de trabajo.

En algunos aspectos de la divulgación, la unión de un anticuerpo a C5a puede inhibir la interacción entre C5a y C5aR1. Los métodos adecuados para la detección y/o medición de la interacción entre C5a y C5aR1 (en presencia y ausencia de un anticuerpo) se conocen en la técnica y se describen en, por ejemplo, Mary y Boulay (1993) Eur J Haematol 51(5):282-287; Kaneko et al. (1995) Immunology 86(1):149-154; Giannini et al. (1995) J Biol Chem 270(32):19166-19172; y la publicación de solicitud de patente de Estados Unidos nº 20060160726. Por ejemplo, la unión de C5a marcada de forma detectable (por ejemplo, marcada de forma radioactiva) a células mononucleares de sangre periférica que expresan C5aR1 se puede evaluar en presencia y ausencia de un anticuerpo. Una disminución en la cantidad de C5a marcada de forma detectable que se une a C5aR1 en presencia del anticuerpo, en comparación a la cantidad de unión en ausencia del anticuerpo, es una indicación de que el anticuerpo inhibe la interacción entre C5a y C5aR1.

En algunos aspectos de la divulgación, la unión de un anticuerpo a C5a puede inhibir la interacción entre C5a y C5L2. Los métodos para la detección y/o medición de la interacción entre C5a y C5L2 se conocen en la técnica y se describen en, por ejemplo, Ward (2009) J Mol Med 87(4):375-378 y Chen et al. (2007) Nature 446(7132):203-207. Los métodos adicionales para evaluar los efectos biológicos de un anticuerpo anti-C5a descrito en el presente documento se ejemplifican en los ejemplos de trabajo más abajo. En algunos aspectos de la divulgación, el anticuerpo anti-C5a se une de forma específica a una proteína C5a componente del complemento de ser humano (por ejemplo, la proteína C5a de ser humano que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1 o SEC ID Nº: 2). Las expresiones “unión específica”, “se une de forma específica”, y expresiones gramaticales similares, según se usan en el presente documento, se refieren a dos moléculas formando un complejo (por ejemplo, un complejo entre un anticuerpo y una proteína C5a componente del complemento) que es relativamente estable en condiciones fisiológicas. Típicamente, la unión se considera específica cuando la constante de asociación (ka) es mayor que 106 M1s-1. Así, un anticuerpo puede unirse de forma específica a una proteína C5a con una ka de al menos (o mayor que) 106 (por ejemplo, de al menos o mayor que 107, 108, 109, 1010, 1011, 1012, 1013, 1014, o 1015 o mayor) M-1s-1. En algunas realizaciones, un anticuerpo anti-C5a descrito en el presente documento tiene una constante de disociación (kd) de menos que o igual a 10-3 (por ejemplo, 8 x 10-4, 5 x 104, 2 x 10-4, 10-4; o 10-5) s-1. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento tiene una KD de menos que 10-8, 10-9, 10-10, 10-11, o 10-12 M. La constante de equilibrio KD es el cociente de las constantes de velocidad cinética - kd/ka. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento tiene una KD de menos que 1,25 x 10-9 M. Los ejemplos de anticuerpos anti-C5a que se unen a C5a con una KD que es menor que 1,25 x 10-9 M incluyen, por ejemplo, a los anticuerpos anti-C5a BNJ364, BNJ367, BNJ371, BNJ378, BNJ366, BNJ369, BNJ381, y BNJ383.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento tiene una KD de menos que 1 x 10-9 M. Los ejemplos de anticuerpos anti-C5a que se unen a C5a con una KD que es menor que 10-9 M incluyen, por ejemplo, a los anticuerpos anti-C5a BNJ364, BNJ367, BNJ378, BNJ366, BNJ369, BNJ381, y BNJ383.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento tiene una KD de menos de 5 x 10-10 M. Los ejemplos de anticuerpos anti-C5a que se unen a C5a con una KD que es menor a 5 x 10- 10 M incluyen, por ejemplo, a los anticuerpos anti-C5a BNJ367, BNJ378, BNJ366, BNJ369, BNJ381, y BNJ383.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento tiene una KD de menos que 2 x 10-10 M. Los ejemplos de anticuerpos anti-C5a que se unen a C5a con una KD que es menor que 2 x 10-10 M incluyen, por ejemplo, a los anticuerpos anti-C5a BNJ367, BNJ366, BNJ369, BNJ381, y BNJ383. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento tiene una KD de menos que 1 x 10-10 M. Los ejemplos de anticuerpos anti-C5a, que se unen a C5a con una KD que es menor que 1 x 10-10 M incluyen, por ejemplo, a los anticuerpos anti-C5a BNJ369, BNJ381, y BNJ383.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento tiene una KD de menos que 7,5 x 10-11 M. Los ejemplos de anticuerpos anti-C5a que se unen a C5a con una KD que es menor que 7,5 x 10-11 M incluyen, por ejemplo, a los anticuerpos anti-C5a BNJ369 y BNJ383.

Los métodos para determinar la afinidad de un anticuerpo por un antígeno de una proteína se conocen en la técnica. Por ejemplo, la afinidad de un anticuerpo por un antígeno de una proteína puede cuantificarse usando una variedad de técnicas tales como, pero sin limitación, transferencia de Western, transferencia puntual, interferometría de biocapa, método de resonancia de plasmón superficial (RPS) (por ejemplo, sistema BIAcore; Pharmacia Biosensor AB, Upsala, Sweden y Piscataway, N.J.), o ensayos inmunoespecíficos ligados a enzima (ELISA). Véase, por ejemplo, Harlow y Lane (1988) "Antibodies: A Laboratory Manual" Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Benny K. C. Lo (2004) "Antibody Engineering: Methods and Protocols," Humana Press (ISBN: 1588290921); Borrebaek (1992) "Antibody Engineering, A Practical Guide," W.H: Freeman, y Co., NY; Borrebaek (1995) "Antibody Engineering," 2ª Edición, Oxford University Press, NY, Oxford; Johne et al. (1993) Immunol Meth 160:191-198; Jonsson et al. (1993) Ann Biol Clin 51:19-26; y Jonsson et al. (1991) Biotechniques 11:620-627.

Cualquiera de los conjuntos de CDR de cadena ligera o regiones variables de cadena ligera descritos en el presente documento puede emparejarse con cualquiera de los conjuntos de CDR de cadena pesada o regiones variables de cadena pesada descritos en el presente documento. Está dentro del ámbito del experto en la técnica, por ejemplo, confirmar (probar) que un anticuerpo anti-C5 generado por tal emparejamiento posee la afinidad o actividad deseada. Los métodos adecuados para confirmar la actividad y/o afinidad de un anticuerpo anti-C5 se describen en el presente documento. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento se une a C5a de ser humano (C5ah) y C5a de un mamífero que no es ser humano tal como un primate que no es ser humano (por ejemplo, mono cinomolgo). En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento no se une a los parálogos de C5a de ser humano tales como C3a o C4a de la misma especie de mamífero que no es ser humano. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah libre y a la proteína C5a de mono cinomolgo que comprende, o consiste en, la siguientes secuencia de aminoácidos: MLQEKIEEJAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR (SEC ID Nº: 179). En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento se une a C5ah libre y a la proteína C5a de mono rhesus que comprende, o consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 179. En algunos aspectos de la divulgación, un anticuerpo, o fragmento de unión a antígeno del mismo, puede unirse a una forma desarginada de la proteína C5a de una especie de mamífero que no es ser humano (por ejemplo, una especie de primate que no es ser humano). Por ejemplo, el anticuerpo o fragmento de unión a antígeno del mismo puede unirse a la proteína C5a desarginada libre de mono cinomolgo o de mono rhesus, comprendiendo la proteína, o consistiendo en, la siguiente secuencia de aminoácidos: MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLG (SEC ID Nº: 180).

En algunos aspectos de la divulgación, los anticuerpos anti-C5a descritos en el presente documento se unen a C5a de ratón (es decir, la C5a libre proveniente de ratón). En algunos aspectos de la divulgación, los anticuerpos anti- C5a descritos en el presente documento se unen a C5a de ratón, pero no a C5a de ser humano. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento no se une a C5a de ratón natural (completamente plegada), no escindida. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito no se une a los parálogos de C5a de ratón tales como C3a de ratón o C4a de ratón. Un anticuerpo anti-C5a de ratón, o un fragmento de unión a antígeno del mismo, puede unirse a la proteína C5a de ratón que comprende, o que consiste en, la siguiente secuencia de aminoácidos: LRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR (SEC ID Nº: 51). Véase también, por ejemplo, Wetsel et al. (1987) Biochem 26:737-743. En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón o un fragmento de unión a antígeno del mismo, puede unirse a la forma desarginada de la proteína C5a de ratón que comprende, o que consiste en, la siguiente secuencia de aminoácidos: LRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLG (SEC ID Nº: 52). En algunos aspectos de la divulgación, el anticuerpo anti-C5a de ratón se une a la proteína C5a de ratón de longitud completa y la forma desarginada de la proteína C5a de ratón. Un anticuerpo anti-C5a de ratón descrito en el presente documento puede, por ejemplo, contener un conjunto CDR de cadena ligera obtenido a partir de un polipéptido de región variable de cadena ligera que comprende la siguiente secuencia de aminoácidos: EIVLTQSPAIMSASLGEKVTMSCRASSSVNYTYWYQQKSDASPKLWIYYTSNLAP GVPARFSGSGSGNSYSLTISSMEGEDAATYYCQQFTSSPLTFGVGTKLELKR (SEC ID Nº: 53). Por ejemplo, un anticuerpo anti-C5a de ratón puede contener: (i) una CDR1 de cadena ligera definida por Kabat que comprende, o que consiste en, la siguiente secuencia de aminoácidos: RASSSVNYIY (SEC ID Nº: 54); (ii) una CDR2 de cadena ligera definida por Kabat que comprende, o que consiste en, la siguiente secuencia de aminoácidos: YTSNLAP (SEC ID Nº: 55); y/o (iii) una CDR3 de cadena ligera definida por Kabat que comprende, o que consiste en, la siguiente secuencia de aminoácidos: QQFTSSPLT (SEC ID Nº: 56).

El anticuerpo anti-C5a de ratón puede contener una región constante de cadena ligera, por ejemplo, la región constante de cadena ligera kappa de ratón que comprende, o consiste en, la siguiente secuencia de aminoácidos: ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDE YERHNSYTCEATHKTSTSPIVKSFNKNEC (SEC ID Nº: 57).

En algunos aspectos de la divulgación un anticuerpo anti-C5a de ratón descrito en el presente documento puede contener un péptido señal aminoterminal, por ejemplo, un péptido señal que comprende, o que consiste en, la siguiente secuencia de aminoácidos: MGWSCIILFLVATATGVHS (SEC ID Nº: 58).

En algunos aspectos de la divulgación un anticuerpo anti-C5a de ratón descrito en el presente documento puede contener un polipéptido de cadena ligera que comprende, o que consiste en, la siguiente secuencia de aminoácidos: REIVLTQSPAIMSASLGEKVTMSCRASSSVNYIYWYQQKSDASPKLWIYYTSNLAPGVPARFSGSGSGNSYSLTISSM EGEDAATYYCQQFTSSPLTFGVGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEC ID Nº: 59) o MGWSCIILFLVATATGVHSREIVLTQSPAIMSASLGEKVTMSCRASSSVNYIYWYQQKSDASPKLWIYYTSNLAPGVPA RFSGSGSGNSYSLTISSMEGEDAATYYCQQFTSSPLTFGVGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNN FYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEC ID Nº: 60). En algunos aspectos de la divulgación un anticuerpo anti-C5a de ratón descrito en el presente documento contiene un polipéptido de cadena ligera que comprende los aminoácidos 2 a 214 de SEC ID Nº: 59. En algunos aspectos de la divulgación un anticuerpo anti-C5a de ratón descrito en el presente documento contiene un polipéptido de cadena ligera que comprende los aminoácidos 1 a 19 y 21 a 233 de SEC ID Nº: 60. Un anticuerpo anti-C5a de ratón descrito en el presente documento puede, por ejemplo, contener un conjunto de CDR de cadena pesada obtenido a partir de un polipéptido de región variable de cadena pesada que comprende la siguiente secuencia de aminoácidos: LEVQLQQSGPELVKPGASVKISCKASGYTFTDYYYINWVKQSHGKSLEWIGYIYPNDGDTNYNQKFKGKATLTVDKSS STAYMELRSLTSEDSAVYYCARPYYSDYGMDYWGQGTSVTVSS (SEC ID Nº: 61). Por ejemplo, un anticuerpo anti- C5a de ratón puede contener: (i) una CDR1 de cadena pesada definida por Kabat que comprende, o que consiste en, la siguiente secuencia de aminoácidos: DYYYIN (SEC ID Nº: 62); (ii) una CDR2 de cadena pesada definida por Kabat que comprende, o que consiste en, la siguiente secuencia de aminoácidos: YIYPNDGDTNYNQKFKG (SEC ID Nº: 63); y/o (iii) una CDR3 de cadena pesada definida por Kabat que comprende, o que consiste en, la siguiente secuencia de aminoácidos: PYYSDYGMDY (SEC ID Nº: 64). El anticuerpo anti-C5a de ratón puede contener una región constante de cadena pesada. En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón descrito en el presente documento puede contener un péptido señal aminoterminal, por ejemplo, un péptido señal que comprende, o que consiste en, la siguiente secuencia e aminoácidos: MGWSCIILFLVATATGVHS (SEC ID Nº: 65). En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón descrito en el presente documento puede contener un polipéptido de cadena pesada que comprende, o que consiste en, la siguiente secuencia de aminoácidos: LEVQLQQSGPELVKPGASVKISCKASGYTFTDYYYINWVKQSHGKSLEWIGYIYPNDGDTNYNQKFKGKATLTVDKSS STAYMELRSLTSEDSAVYYCARPYYSDYGMDYWGQGTSVTVSS (SEC ID Nº: 66) o MGWSCIILFLVATATGVHSLEVQLQQSGPELVKPGASVKISCKASGYTFTDYYYINWVKQSHGKSLEWIGYIYPNDGD TNYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARPYYSDYGMDYWGQGTSVTVSS (SEC ID Nº: 67). En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón descrito en el presente documento contiene un polipéptido de cadena pesada que comprende los aminoácidos 2 a 121 de SEC ID Nº: 66. En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón descrito en el presente documento contiene un polipéptido de cadena pesada que comprende los aminoácidos 1 a 19 y 21 a 140 de SEC ID Nº: 67. En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón descrito en el presente documento contiene un polipéptido de región constante de cadena pesada que comprende una o más sustituciones de aminoácidos de la secuencia descrita anteriormente. En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón descrito en el presente documento contiene un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 54; (ii) una CDR2 de cadena ligera que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 55; y (iii) una CDR3 de cadena ligera que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 56; (iv) una CDR1 de cadena pesada que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 62; (v) una CDR2 de cadena pesada que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 63; y/o (vi) una CDR3 de cadena pesada que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 64.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a de ratón descrito en el presente documento contiene un polipéptido de cadena ligera que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 59 y un polipéptido de cadena pesada que comprende, o que consiste en, la secuencia de aminoácidos representada en SEC ID Nº: 66.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento puede unirse a C5a de ser humano y a C5a de ratón. Métodos para producir los anticuerpos anti-C5a y fragmentos de unión a antígenos de los mismos La divulgación también presenta métodos para producir cualquiera de los anticuerpos anti-C5a o fragmentos de unión a antígeno de los mismos descritos en el presente documento. En algunos aspectos de la divulgación, los métodos para preparar un anticuerpo descrito en el presente documento pueden incluir inmunizar a un sujeto (por ejemplo, a un mamífero que no es ser humano) con un inmunógeno apropiado. Los inmunógenos adecuados para la generación de cualquiera de los anticuerpos descritos en el presente documento se indican en el presente documento. Por ejemplo, para generar un anticuerpo que se una a C5a, el experto puede inmunizar un sujeto adecuado (por ejemplo, un mamífero que sea ser humano tal como una rata, un ratón, un jerbo, un hámster, un perro, un gato, un cerdo, una cabra, un caballo, o un primate que no sea ser humano) con un polipéptido C5a de longitud completa tal como un polipéptido C5a de longitud completa que comprende la secuencia de aminoácidos representada en SEC ID Nº: 1 o la forma desarginada de C5a (por ejemplo, la C5a de ser humano desarginada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 2). En algunos aspectos de la divulgación, el mamífero que no es ser humano es deficiente en C5, por ejemplo, un ratón deficiente en C5 descrito en, por ejemplo, Levy y Ladda (1971) Nat New Biol 229(2):51-52; Crocker et al. (1974) J Clin Pathol 27(2):122-124; Wetsel et al. (1990) J Biol Chem 265:2435-2440; y Jungi y Pepys (1981) Immunology 43(2):271-279. La C5a de ser humano se puede purificar a partir de suero de ser humano como se describe en, por ejemplo, McCarthy y Henson (1979) J Immunol 123(6):2511-2517 y Manderino et al. (1982) J Immunol Methods 53(1):41-50. Véase también los ejemplos de trabajo. La C5a de ser humano puede también generarse in vitro como se describe en, por ejemplo, Vallota y Müller-Eberhard (1973) J Exp Med 137:1109. La C5a de ser humano purificada está también comercialmente disponible de, por ejemplo, Complement Technology, Inc. (número de catálogo A144; Tyler, Texas). La C5a recombinante también puede generarse por alguien con las habilidades habituales en la materia según se describe en, por ejemplo, Tothe et al. (1994) Prot Sci 3:1159-1168. Un sujeto adecuado (por ejemplo, un mamífero que no sea ser humano) puede inmunizarse con el antígeno apropiado, junto con inmunizaciones de refuerzo posteriores, un número de veces suficiente para obtener la producción de un anticuerpo en el mamífero. El inmunógeno se puede administrar a un sujeto (por ejemplo, un mamífero que no sea ser humano) con un adyuvante. Los adyuvantes útiles para producir un anticuerpo en un sujeto incluyen, pero sin limitación, adyuvantes proteicos; adyuvantes bacterianos, por ejemplo, de bacterias completas (BCG, Corynebacterium parvum o Salmonella minnesota) y componentes bacterianos incluyendo el esqueleto de la pared celular, dimicolato de trehalosa, monofosforil lípido A, restos extraíbles en metanol (REM) del bacilo de la tuberculosis, adyuvante de Freund completo o incompleto; adyuvantes virales; adyuvantes químicos, por ejemplo, hidróxido de aluminio, y yodoacetato y hemisuccinato de colesterol. Otros adyuvantes que pueden usarse en los métodos para inducir una respuesta inmunitaria incluyen, por ejemplo, toxina colérica y proteínas de parapoxvirus. Véase también Bieg et al. (1999) Autoimmunity 31(1):15-24. Véase también, por ejemplo, Lodmell et al. (2000) Vaccine 18:1059-1066; Johnson et al. (1999) J Med Chem 42:4640-4649; Baldridge et al. (1999) Methods 19:103- 107; y Gupta et al (1995) Vaccine 13(14): 1263-1276. En algunos aspectos de la divulgación, los métodos incluyen la preparación de una línea celular de hibridoma que secreta un anticuerpo monoclonal que se une al inmunógeno. Por ejemplo, un mamífero adecuado tal como un ratón de laboratorio se inmuniza con un polipéptido C5a según se describe anteriormente. Las células productoras de anticuerpo (por ejemplo, células B del bazo) del mamífero inmunizado se pueden aislar entre los dos y cuatro días después de al menos una inmunización de refuerzo con el inmunógeno y después se pueden crecer en cultivo brevemente antes de la fusión con células de una línea celular de mieloma adecuada. Las células se pueden fusionar en presencia de un promotor de la fusión tal como, por ejemplo, virus vaccinia o polietilenglicol. Las células híbridas obtenida en la fusión se clonan, y se exploran los clones celulares que secretan los anticuerpos deseados.

Por ejemplo, células de bazo de ratones Balb/c inmunizados con un inmunógeno adecuado pueden fusionarse con células de la línea celular de mieloma PAI o la línea celular de mieloma Sp2/0-Ag 14. Después de la fusión, las células se expanden, en un medio de cultivo adecuado, el que se complementa con un medio de selección, por ejemplo, medio HAT, a intervalos regulares con el fin de evitar el sobrecrecimiento de las células de mieloma normales sobre las células de hibridoma deseadas. Después, se exploran las células híbridas obtenidas para la secreción de los anticuerpos deseados, por ejemplo, un anticuerpo que se une a C5a e inhibe la interacción entre C5a y un receptor de C5a (por ejemplo, C5aR1). En algún aspecto de la divulgación, el experto puede identificar un anticuerpo anti-C5a a partir de una biblioteca sesgada no inmunitaria según se describe en, por ejemplo, la patente de Estados Unidos nº 6.300.064 (para Knappik

et al.; Morphosys AG) y Schoonbroodt et al. (2005) Nucleic Acids Res 33(9):e81.

En algunos aspectos de la divulgación, los métodos descritos en el presente documento pueden implicar o usarse junto con, por ejemplo, tecnologías de presentación de fagos, presentación bacteriana, presentación de superficie de levaduras, presentación viral eucariótica, presentación de células de mamífero, y técnicas de selección de anticuerpos libres de células (por ejemplo, presentación ribosómica) (véase, por ejemplo, Etz et al. (2001) J Bacteriol 183:6924-6935; Comelis (2000) Curr Opin Biotechnol 11:450-454; Klemm et al. (2000) Microbiology 146:3025-3032; Kieke et al. (1997) Protein Eng 10:1303-1310; Yeung et al. (2002) Biotechnol Prog 18:212-220; Boder et al. (2000) Methods Enzymology 328:430-444; Grabherr et al. (2001) Comb Chem High Throughput Screen 4:185-192; Michael et al. (1995) Gene Ther 2:660-668; Pereboev et al. (2001) J Virol 75:7107-7113; Schaffitzel et al. (1999) J Immunol Methods 231:119-135; y Hanes et al. (2000) Nat Biotechnol 18:1287-1292).

Se conocen en la técnica métodos para la identificación de anticuerpos usando diversos métodos de presentación de fagos. En los métodos de presentación de fagos, los dominios de anticuerpos funcionales se presentan en la superficie de las partículas de fagos que portan las secuencias polinucleotídicas que los codifican. Dichos fagos se pueden utilizar para presentar dominios de unión a antígenos de anticuerpos, tales como Fab, Fv, o fragmentos de anticuerpo Fv estabilizados por uniones disulfuro, expresados por una biblioteca de anticuerpos de repertorio o combinatoria (por ejemplo, de ser humano o murina). Los fagos usados en estos métodos son típicamente fagos filamentosos tales como fd y M13. Los dominios de unión a antígenos se expresan como una proteína fusionada de forma recombinante a una de las proteínas de la cubierta del fago pIII, pVIII, o pIX. Véase, por ejemplo, Shi et al. (2010) JMB 397:385-396. Ejemplos de métodos de presentación de fagos que pueden usarse para hacer inmunoglobulinas, o fragmentos de las mismas, descritas en el presente documento incluyen aquellas divulgadas en Brinkman et al. (1995) J Immunol Methods 182:41-50; Ames et al. (1995) J Immunol Methods 184:177-186; Kettleborough et al. (1994) Eur J Immunol 24:952-958; Persic et al. (1997) Gene 187:9-18; Burton et al. (1994) Advances in Immunology 57:191-280; y los documentos de publicación PCT nº WO 90/02809, WO 91/10737, WO 92/01047, WO 92/18619, WO 93/11236, WO 95/15982, y WO 95/20401. Los métodos adecuados se describen también, por ejemplo, las patentes de Estados Unidos nº 5.698.426; 5.223.409; 5.403.484; 5.580.717; 5.427.908; 5.750.753; 5.821.047; 5.571.698; 5.427.908; 5.516.637; 5.780.225; 5.658.727; 5.733.743 y 5.969.108. En algunos aspectos de la divulgación, las bibliotecas de anticuerpos de presentación de fagos pueden generarse usando ARNm recogido a partir de células B de mamíferos inmunizados. Por ejemplo, una muestra de células de bazo comprendiendo células B se puede aislar a partir de ratones inmunizados con polipéptidos C5a como se describe anteriormente. El ARNm se puede aislar a partir de células y se puede convertir a ADNc usando técnicas estándar de biología molecular. Véase, por ejemplo, Sambrook et al. (1989) "Molecular Cloning: A Laboratory Manual, 2ª Edición" Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow y Lane (1988), citado anteriormente; Benny K. C. Lo (2004), citado anteriormente; y Borrebaek (1995), citado anteriormente. El ADNc que codifica las regiones variables de los polipéptidos de cadena pesada y cadena ligera de inmunoglobulinas se usan para construir la biblioteca de representación de fagos. Los métodos para generar tal biblioteca se describen en, por ejemplo, Merz et al. (1995) J Neurosci Methods 62(1-2):213-9; Di Niro et al. (2005) Biochem J 388(Pt 3):889-894; y Engberget al. (1995) Methods Mol Biol 51:355-376.

En algunos aspectos de la divulgación, se puede emplear una combinación de selección y exploración para identificar un anticuerpo de interés a partir de, por ejemplo, una población de anticuerpos derivados de hibridoma o una biblioteca de anticuerpos de presentación de fagos. Los métodos adecuados se conocen en la técnica y se describen en, por ejemplo, Hoogenboom (1997) Trends in Biotechnology 15:62-70; Brinkman et al. (1995), citado anteriormente; Ames et al. (1995), citado anteriormente; Kettleborough et al. (1994), citado anteriormente; Persic et

al. (1997), citado anteriormente; y Burton et al. (1994), citado anteriormente. Por ejemplo, una serie de vectores fagémidos, codificando cada uno una proteína de fusión de una proteína de cubierta de bacteriófago (por ejemplo, pIII, pVIII, o pIX del fago M13) y una región de combinación de antígenos diferentes se producen usando técnicas estándar en biología molecular y después se introducen en una población de bacterias (por ejemplo, E. coli). La expresión de bacteriófagos en bacterias puede, en algunas realizaciones, necesitar el uso de un fago auxiliar. En algunas realizaciones no se necesita un fago auxiliar (véase, por ejemplo, Chasteen et al. (2006) Nucleic Acids Res 34(21):e145). Los fagos producidos a partir de bacterias se recuperan y después se ponen en contacto con, por ejemplo, un antígeno diana unido a un soporte sólido (inmovilizado). Los fagos se pueden también poner en contacto con un antígeno en solución, y el complejo posteriormente se une a un soporte sólido.

En algunos aspectos de la divulgación, los fagos inmovilizados son los fagos de interés. Por consiguiente, los fagos no unidos se eliminan mediante el lavado del soporte. Después de la etapa de lavado, los fagos unidos se eluyen del soporte sólido, por ejemplo, usando un tampón de pH bajo o un competidor antigénico libre de diana, y se recuperan mediante la infección de bacterias. En algunos aspectos de la divulgación, los fagos que no están movilizados son los fagos de interés. En dichos aspectos de la divulgación, la población de fagos puede estar en contacto con el antígeno dos o más veces para empobrecer a la población de cualquiera de los fagos que se unen al soporte. Después se recogen los fagos no unidos y se usan para etapas de exploración posteriores. Para enriquecer la población de fagos en partículas de fagos que contengan anticuerpos que tengan una mayor afinidad por el antígeno diana (mientras se reduce la proporción de fagos que pueden unirse no específicamente al antígeno), los fagos eluídos (descritos más arriba) pueden usarse para reinfectar una población de células hospedadoras bacterianas. Los fagos expresados se aíslan a partir de las bacterias y se ponen otra vez en contacto con un antígeno diana. Pueden modularse durante el contacto la concentración del antígeno, el pH, la temperatura y la inclusión de detergentes y adyuvantes, para enriquecer los fragmentos de anticuerpo de mayor afinidad. Los fagos no unidos se eliminan mediante el lavado del soporte sólido. El número de ciclos, la duración, el pH, la temperatura e inclusión de detergentes y adyuvantes durante el lavado pueden también modularse para enriquecer fragmentos de anticuerpo de mayor afinidad. Después de la etapa de lavado, los fagos unidos se eluyen del soporte sólido. Puede usarse cualquier parte de los ciclos iterativos de selección uno a seis para enriquecer los fagos que contengan los anticuerpos que tengan mayor afinidad por el antígeno diana. En algunas realizaciones, también puede realizarse una etapa de cancelación de la selección junto con cualquiera de las estrategias de selección descritas en el presente documento.

Pueden aislarse de la población fagos individuales mediante la infección de bacterias y, después, una siembra en placas a una densidad que permita la formación de anticuerpos monoclonales. Por ejemplo, para identificar usando técnicas de presentación de fagos un anticuerpo que se una a C5a, pero no se una a C5, se puede emplear el siguiente procedimiento de selección. Primero se puede poner en contacto a la población con una superficie que contenga unida C5 de ser humano de longitud completa, natural. El proceso puede repetirse dos o más veces, recogiendo cada vez los fagos no unidos. También se puede poner en contacto a la población con un soporte sólido que contenga las proteínas C4 y/o C3 unidas a la superficie. Después, los fagos no unidos de las etapas anteriores se ponen en contacto con una superficie que contenga unidas C5a o C5a desarginada. Los fagos que se unen a C5a se eluyen de la superficie y se recuperan mediante la infección de bacterias. Se pueden realizar rondas iterativas de la selección de fagos. Después de una a seis rondas de selección, los fagémidos individuales recuperados se pueden explorar en la expresión de los fragmentos de anticuerpo con la especificidad y la afinidad deseadas.

Se puede caracterizar una subpoblación de anticuerpos explorada usando los métodos anteriores, por su especificidad y afinidad de unión a un inmunógeno particular (por ejemplo, C5a) usando cualquier método basado en inmunología o bioquímica conocido en la técnica. Por ejemplo, la unión específica de un anticuerpo a C5a, en comparación a C5 de longitud completa, natural, se puede determinar, por ejemplo, usando métodos basados en inmunología o bioquímica tales como, pero sin limitación, un ensayo de ELISA, ensayos RPS, ensayos de inmunoprecipitación, cromatografía de afinidad, y diálisis de equilibrio según se describe anteriormente. Los inmunoensayos que pueden ser usados para analizar la unión inmunoespecífica y la reactividad en forma cruzada de los anticuerpos incluyen, pero sin limitación, sistemas de ensayo competitivos y no competitivos usando técnicas tales como transferencia Western, RIA, ELISA (ensayo inmunoabsorbente ligado a enzimas), inmunoensayos tipo "sándwich", ensayos de inmunoprecipitación, ensayos de inmunodifusión, ensayos de aglutinación, ensayos de fijación del complemento, ensayos inmunorradiométricos, inmunoensayos de fluorescencia, e inmunoensayos de proteína A. Dichos ensayos son de rutina y son conocidos en la técnica. También se pueden ensayar los anticuerpos usando cualquiera de los ensayos basados en RPS conocidos en la técnica para caracterizar los parámetros cinéticos de la interacción del anticuerpo con C5a. Pueden usarse, en los métodos escritos en el presente documento, cualquier instrumento de RPS comercialmente disponible incluyendo, pero sin limitación, instrumentos BIAcore (Biacore AB; Upsala, Suecia); instrumentos lAsys (Affinity Sensors; Franklin, Massachussetts); el sistema IBIS (Windsor Scientific Limited; Berks, RU), sistemas SPR-CELLIA (Nippon Laser and Electronics Lab; Hokkaido, Japón), y el detector SPR Spreeta (Texas Instruments; Dallas, Texas). Véase, por ejemplo, Mullett et al. (2000) Methods 22: 77-91; Dong et al. (2002) Reviews in Mol Biotech 82: 303-323; Fivash

et al. (1998) Curr Opin Biotechnol 9: 97-101; y Rich et al. (2000) Curr Opin Biotechnol 11: 54-61. Se entiende que los métodos anteriores también pueden usarse para determinar si, por ejemplo, un anticuerpo anti- C5 no se une a las proteínas C5, C3, y/o C4 naturales, de longitud completa. También se pueden usar los métodos anteriores para determinar si un anticuerpo que se une a C5a, también inhibe la interacción entre C5a y un receptor de C5a. También se pueden usar los métodos anteriores para determinar si un anticuerpo que se une a C5a también inhibe la actividad de C5a. Como se describe en las referencias anteriores, después de la selección de los fagos, las regiones que codifican el anticuerpo de los fagos, se pueden aislar y usar para generar anticuerpos completos, incluyendo anticuerpos de ser humano, o cualquiera de los fragmentos deseados, y se pueden expresar en cualquier hospedador deseado, incluyendo células de mamífero, células de insectos, células de plantas, levaduras, y bacterias, por ejemplo, como se describe en detalle más abajo. Por ejemplo, también se pueden usar técnicas para producir de forma recombinante fragmentos Fab, Fab' y F(ab')2, usando métodos conocidos en la técnica tales como aquellos divulgados en el documento de publicación PCT nº WO 92/22324; Mullinax et al. (1992) BioTechniques 12(6):864- 869; y Sawai et al. (1995) Am J Repr Immunol 34:26-34; y Better et al. (1988) Science 240:1041-1043. Los ejemplos de técnicas que pueden usarse para producir Fv de cadena simple y anticuerpos, incluyen aquellas descritas en la patente de Estados Unidos nº 4.946.778 y 5.258.498; Huston et al. (1991) Methods in Enzymology 203:46-88; Shu et al. (1993) Proc Nat Acad Sci USA 90:7995-7999; y Skerra et al. (1988) Science 240:1038-1040.

La tecnología de presentación de fagos también puede usarse para, por ejemplo, incrementar la afinidad de un anticuerpo por su antígeno afín. La tecnología, que recibe el nombre de maduración de afinidad, puede emplear mutagénesis o avance de CDR (CDR walking) y reselección para identificar anticuerpos que se unan con mayor afinidad a un antígeno en comparación con el anticuerpo inicial o parental. Véase, por ejemplo, Glaser et al. (1992) J Immunol 149:3903-3913. Las bibliotecas pueden construirse consistiendo de un grupo de clones variantes, difiriendo cada uno en una o más sustituciones de aminoácidos. Los mutantes con afinidad de unión incrementada por el antígeno, se pueden seleccionar poniendo en contacto los mutantes inmovilizados con el antígeno marcado o cualquier combinación de los métodos descritos anteriormente. Cualquier método de exploración conocido en la técnica puede usarse para identificar anticuerpos mutantes con afinidad incrementada por el antígeno (por ejemplo, técnicas de RPS o de ELISA).

En algunos aspectos de la divulgación, se puede usar mapeo epitópico para identificar, por ejemplo, la región de C5a que interactúa con un anticuerpo, por ejemplo, una región de C5a que se une a C5aR1. Los métodos para identificar en epítopo al cual se une un anticuerpo en particular también se conocen en la técnica y se describen arriba.

Los anticuerpos y fragmentos de los mismos identificados en el presente documento pueden ser, o pueden hacerse, “quiméricos”. Los anticuerpos quiméricos y fragmentos de unión a antígenos de los mismos comprenden porciones de dos o más especies diferentes (por ejemplo, ratón y ser humano). Los anticuerpos quiméricos pueden producirse con regiones variables de ratón de la especificidad deseada, fusionados a dominios constantes de ser humano (por ejemplo, patente de los Estados Unidos nº 4.816.567). De esta manera, los anticuerpos que no son de ser humano pueden modificarse para hacerlos más adecuados para la aplicación en clínica humana (por ejemplo, métodos para tratar o prevenir en un sujeto, un trastorno mediado por complemento). Los anticuerpos monoclonales de la presente divulgación incluyen formas “humanizadas” (por ejemplo, ratón) de los anticuerpos que no son de ser humano. Los Acm humanizados o injertados con CDR son particularmente útiles como agentes terapéuticos para seres humanos, porque no se eliminan de la circulación tan rápidamente como los anticuerpos de ratón y no provocan típicamente una reacción inmunitaria adversa. Generalmente, un anticuerpo humanizado tiene uno o más restos aminoacídicos introducidos dentro de ellos, provenientes una fuente que no es de ser humano. Estos restos aminoacídicos que no son de ser humano a menudo reciben el nombre de restos “importados”, los cuales se toman típicamente de un dominio variable importado. Los métodos para la preparación de anticuerpos humanizados se conocen de forma general en la técnica. Por ejemplo, en esencia la humanización se puede realizar siguiendo el método de Winter y colaboradores (véase, por ejemplo, Jones et al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-327; y Verhoeyen et al. (1988) Science 239:1534-1536), mediante la sustitución del armazón de roedor o de las secuencias de CDR por las correspondientes secuencias de un anticuerpo de ser humano. Véase también, por ejemplo, Staelens et al. (2006) Mol Immunol 43:1243-1257. En algunas realizaciones, las formas humanizadas de anticuerpos que no son de ser humano (por ejemplo, ratón) son anticuerpos de ser humano (anticuerpo destinatario) en los que los restos aminoacídicos de la región CDR del anticuerpo que no es de ser humano (por ejemplo, un anticuerpo de ratón, rata, conejo, o un primate que no es ser humano) que tiene la especificidad, la afinidad y la capacidad de unión deseadas, se injertan sobre la estructura de del armazón de un anticuerpo de ser humano. Se describe a continuación, en los ejemplos de trabajo, métodos adicionales de humanización. Los métodos para injertar secuencias de CDR provenientes de un anticuerpo donante (por ejemplo, un anticuerpo que no es de ser humano) en las regiones marco conservadas de un anticuerpo receptor (por ejemplo, un anticuerpo de ser humano) se conocen en la técnica y se describen en, por ejemplo, Jones et al. (1986) Nature 321:522-525; Verhoeyen et al. (1988) Science 239(4847):1534-1536; Riechmann et al. (1988) Nature 332:323-327; Queen et al. (1989) Proc Natl Acad Sci USA 86:10029-10033; en el documento de publicación PCT nº WO 93/011237; Kettleborough et al. (1991) Protein Engineering, Design and Selection 4:773-783; Benny K. C. Lo (2004) "Antibody Engineering: Methods and Protocols," Humana Press (ISBN: 1588290921); Borrebaek (1992) "antibody Engineering, A Practical Guide," W.H. Freeman y Co., NY; y Borrebaek (1995) "Antibody Engineering,"2ª Edición, Oxford University Press, NY, Oxford. Por ejemplo, las CDR de un anticuerpo donante pueden injertarse dentro de las regiones marco conservadas de un anticuerpo receptor usando técnicas de reacción en cadena de la polimerasa (PCR) de extensión solapante según se describe en, por ejemplo, Daugherty et al. (1991) Nucleic Acids Res 19(9):2471-2476; Roguska et al. (1996) Protein Engineering 9(10):895-904; y Yazaki et al. (2004) Protein Engineering" Design & Selection 17(5):481-489.

En aspectos de la divulgación donde las secuencias de aminoácidos de CDR seleccionadas son secuencias cortas (por ejemplo, de menos que 10-15 aminoácidos de longitud), los ácidos nucleicos que codifican las CDR pueden sintetizarse químicamente según se describe en, por ejemplo, Shiraishi et al. (2007) Nucleic Acids Symposium Series 51(1):129-130 y patente de los Estados Unidos nº 6.995.259. Para una dada secuencia de ácidos nucleicos codificando un anticuerpo receptor, la región de la secuencia del ácido nucleico que codifica las CDR puede reemplazarse con los ácidos nucleicos sintetizados de forma química usando técnicas estándar de biología molecular. Los extremos 5' y 3' de los ácidos nucleicos sintetizados de forma química, se pueden sintetizar para comprender sitios de enzimas de restricción con extremos cohesivos, para uso en clonación los de ácidos nucleicos dentro del ácido nucleico que codifica la región variable del anticuerpo donante.

En algunos ejemplos, uno o más restos aminoacídicos del armazón de la inmunoglobulina de ser humano se reemplazan también por los correspondientes restos aminoacídicos del anticuerpo que no es de ser humano (las así llamadas mutaciones de vuelta (back mutations). Además, las bibliotecas de presentación de fagos pueden usarse para cambiar aminoácidos en posiciones elegidas dentro de la secuencia del anticuerpo. Las propiedades de un anticuerpo humanizado se ven afectadas también por la elección del armazón de ser humano. Además, los anticuerpos humanizados y quimerizados pueden modificarse para comprender restos que no se encuentran en el anticuerpo receptor o en el anticuerpo donante, para mejorar aún más las propiedades del anticuerpo tales como, por ejemplo, la afinidad o la función efectora.

También se proporcionan en la divulgación anticuerpos completamente de ser humano. La expresión “anticuerpo de ser humano” incluye anticuerpos que tienen regiones variables y constantes (si están presentes) derivadas de secuencias de inmunoglobulinas de ser humano, preferiblemente secuencias de línea germinal de ser humano. Los anticuerpos de ser humano pueden incluir restos aminoacídicos no codificados por secuencias de inmunoglobulina de línea germinal de ser humano (por ejemplo, mutaciones introducidas por mutagénesis al azar o mutagénesis específica de sitio in vitro o por mutación somática in vivo). Sin embargo, la expresión “anticuerpo de ser humano” no incluye anticuerpos en los que las secuencias de las CDR derivadas a partir de otras especies de mamíferos, tales como un ratón, se injertaron sobre las secuencias del armazón de ser humano (es decir, anticuerpos humanizados). Los anticuerpos completamente de ser humano o de ser humano pueden derivar de ratones transgénicos que portan los genes de anticuerpos de ser humano (portando los exones variable (V), diversidad (D), unión (J), y constante (C)) o de células de ser humano. Por ejemplo, ahora es posible producir animales transgénicos (por ejemplo, ratones) que son capaces, después de la inmunización, de producir un repertorio completo de anticuerpos de ser humano sin producción de inmunoglobulinas endógenas. Véase, por ejemplo, Jakobovits et al. (1993) Proc Natl Acad Sci USA 90:2551; Jakobovits et al. (1993) Nature 362:255-258; Bruggemann et al. (1993) Year in Immunol. 7:33; y Duchosal et al. (1992) Nature 355:258. Las cepas de ratones transgénicos pueden modificarse por ingeniería genética para contener secuencias génicas de genes de inmunoglobulinas de ser humano no reordenados. Un ejemplo de tal ratón es HuMAb Mouse® (Medarex, Inc.), el cual contiene minilocus de transgenes de inmunoglobulinas de ser humano que codifican las secuencias de inmunoglobulinas de cadena ligera κ y de cadena pesada µ, junto con mutaciones dirigidas que inactivan los locus de las cadenas κ y µ endógenas. Véase, por ejemplo, Lonberg, et al. (1994) Nature 368(6474):856-859. La preparación y uso de ratones HuMab, y las modificaciones que portan tales ratones, se describen adicionalmente en Taylor et al. (1992) Nucleic Acids Res 20:6287-6295; Chen, J. et al. (1993) International Immunology 5: 647-656; Tuaillon et al. (1993) Proc Natl Acad Sci USA 90:3720-3724; Choi et al. (1993) Nature Genetics 4:1 17-123; Tuaillon et al. (1994) J Immunol 152:2912-2920; Taylor et al. (1994) International Immunology 6:579-591; y Fishwild et al. (1996) Nature Biotechnol 14:845-851. Un sistema alternativo de ratón transgénico para la expresión de genes de inmunoglobulinas de ser humano recibe el nombre de Xenomouse (Abgenix, Inc.) y se describe en, por ejemplo, las patentes de Estados Unidos nº 6.075.181; 6.114.598; 6.150.584; y 6.162.963. Al igual que el sistema HuMAb Mouse®, el sistema Xenomouse implica la alteración de los genes endógenos de ratón de las cadenas pesada y ligera y la inserción en el genoma de los transgenes de ratón portando los locus de las inmunoglobulinas de cadenas pesada y ligera de ser humano no reordenadas, que contienen las secuencias de las regiones variable y constante de ser humano. Otros sistemas conocidos en la materia para la expresión de genes de inmunoglobulinas de ser humano incluyen el sistema KM Mouse®, descrito en detalle en el documento de la publicación PCT WO 02/43478 y el sistema de ratón TC descrito en Tomizuka et al. (2000) Proc Natl Acad Sci USA 97:722-727. Las secuencias de ser humano pueden codificar para las cadenas pesada y ligera de anticuerpos de ser humano y funcionarían correctamente en los ratones, experimentando reordenamientos para proporcionar un repertorio de anticuerpos amplio similar al de seres humanos. Los ratones transgénicos pueden inmunizarse con el inmunógeno proteico diana para crear una serie diversa de anticuerpos específicos y sus ARN codificantes. Los ácidos nucleicos codificando los componentes de las cadenas de anticuerpos de tales anticuerpos, pueden clonarse después, a partir del animal, en un vector de presentación. Típicamente, se clonan poblaciones distintas de ácidos nucleicos que codifican las secuencias de las cadenas pesada y ligera, y después las poblaciones distintas se recombinan en la inserción en el vector, de tal manera que cualquier copia dada del vector recibe una combinación al azar de una cadena pesada y una cadena ligera. El vector se diseña para expresar cadenas de anticuerpos de manera que puedan ensamblarse y presentarse en la superficie externa de un paquete de presentación conteniendo el vector. Por ejemplo, las cadenas de anticuerpos pueden expresarse como proteínas de fusión con una proteína de cubierta del fago, de la superficie externa del fago. Posteriormente los paquetes de presentación se pueden seleccionar y explorar por la presentación de anticuerpos que se unen a una diana. Además, las bibliotecas de presentación de fagos exploradas más arriba pueden incluir anticuerpos de ser humano (Hoogenboom et al. (1992) J Mol Biol 227:381; Marks et al. (1991) J Mol Biol 222:581-597; y Vaughan et al. (1996) Nature Biotech 14:309). Pueden crearse bibliotecas de fagos sintéticas, las que usan de combinaciones al azar de regiones V de anticuerpos de ser humano sintéticas. Mediante la selección sobre el antígeno, se pueden hacer anticuerpos completamente de ser humano en los que las regiones V son muy similares a las de ser humano en la naturaleza. Véase, por ejemplo, las patentes de Estados Unidos nº 6.794.132; 6.680.209; 4.634.666; y Ostberg et al. (1983) Hybridoma 2:361-367.

Para la generación de anticuerpos de ser humano, véase también Mendez et al. (1998) Nature Genetics 15:146-156 y Green y Jakobovits (1998) J Exp Med 188:483-495. Adicionalmente, los anticuerpos de ser humano se tratan y definen en las patentes de Estados Unidos nº 5939.598; 6.673.986; 6.114.598; 6.075.181; 6.162.963; 6.150.584; 6.713.610; y 6.657.103 así como las publicaciones de las patentes de Estados Unidos nº 20030229905 A1, 20040010810 A1, 20040093622 A1, 20060040363 A1, 20050054055 A1, 20050076395 A1, y 20050287630 A1. Véase también las publicaciones internacionales nº WO 94/02602, WO 96/34096, y WO 98/24893, y la patente europea nº EP 0 463 151 B1.

Otros, en una estrategia alternativa, incluyendo GenPharm International, Inc., utilizaron una estrategia de "minilocus". En la estrategia de minilocus, un locus de Ig exógeno se mimetiza a través de la inclusión de trozos (genes individuales) del locus de Ig. Así, uno o más genes VH, uno o más genes DH, uno o más genes, JH genes, una región constante mu, y una segunda región constante (preferiblemente una región constante gamma) se forman en un constructo para la inserción en un animal. Esta estrategia se describe en, por ejemplo, las patentes de Estados Unidos nº: 5.545.807; 5.545.806; 5.625.825; 5.625.126; 5.633.425; 5.661.016; 5.770.429; 5.789.650; y 5.814.318; 5.591.669; 5.612.205; 5.721.367; 5.789.215; 5.643.763; 5.569.825; 5.877.397; 6.300.129; 5.874.299; 6.255.458; y 7.041.871. Véase también la patente europea nº 0 546 073 B1, la publicación de patente internacional nº WO 92/03918, WO 92/22645, WO 92/22647, WO 92/22670, WO 93/12227, WO 94/00569, WO 94/25585, WO 96/14436, WO 97/13852, y WO 98/24884. Adicionalmente, véase Taylor et al. (1992) Nucleic Acids Res 20: 6287; Chen et al. (1993) Int Immunol 5: 647; Tuaillon et al. (1993) Proc Natl Acad Sci USA 90: 3720-4; Choi et al. (1993) Nature Genetics 4: 117; Lonberg et al.

(1994) Nature 368: 856-859; Taylor et al. (1994) International Immunology 6:579-591; Tuaillon et al. (1995) J. Immunol 154: 6453-65; Fishwild et al. (1996) Nature. Biotechnology 14: 845; y Tuaillon et al. (2000)EurJImmunol. 10: 2998-3005. En determinados aspectos de la divulgación, se proporcionan las formas desinmunizadas de los anticuerpos, o fragmentos de unión a antígenos descritos en el presente documento. Los anticuerpos desinmunizados o fragmento de unión a antígenos de los mismos son anticuerpos que se modificaron con el fin de hacer al anticuerpo o fragmento de unión a antígeno del mismo no inmunogénico, o menos inmunogénico, para una especie dada. La desinmunización se puede conseguir mediante la modificación del anticuerpo o fragmentos de unión a antígeno del mismo utilizando cualquier técnica de una diversidad conocida por los expertos en la materia (véase, por ejemplo, las publicaciones PCT nº WO 04/108158 y WO 00/34317). Por ejemplo, un anticuerpo o fragmento de unión a antígeno del mismo puede desinmunizarse mediante la identificación de uno o más epítopos de células T y/o epítopos de células B potenciales del anticuerpo o fragmentos de unión a antígeno del mismo, por ejemplo, utilizando técnicas recombinantes. Después, el anticuerpo modificado, o fragmento de unión a antígeno del mismo, puede producirse opcionalmente y probarse para identificar anticuerpos o fragmentos de unión a antígeno de los mismos que retengan una o más actividades biológicas deseadas, tales como por ejemplo, afinidad de unión, pero tengan reducida la inmunogenicidad. Los métodos para la identificación de epítopos de células T y/o epítopos de células B potenciales, se pueden realizar usando técnicas conocidas en la técnica, tales como por ejemplo, métodos computacionales (véase por ejemplo, la publicación PCT nº WO 02/069232), técnicas in vitro o in silico, y ensayos biológicos o métodos físicos (tales como, por ejemplo, la determinación de la unión de péptidos a moléculas del CMH, la determinación de la unión de los complejos péptidos:CMH a los receptores de células T de especies que recibirán el anticuerpo o fragmento de unión a antígenos del mismo, probar la proteína o partes peptídicas de la misma usando animales transgénicos con las moléculas de CMH de las especies que recibirán el anticuerpo o fragmento de unión a antígeno del mismo, o pruebas con animales transgénicos reconstituidos con células del sistema inmunitario de las especies que recibirán el anticuerpo o fragmento de unión a antígenos del mismo, etc.).

En varios aspectos de la divulgación, los anticuerpos desinmunizados descritos en el presente documento incluyen fragmentos de unión a antígeno desinmunizados, Fab, Fv, scFv, Fab' y F(ab')2, anticuerpos monoclonales, anticuerpos murinos, anticuerpos completamente de ser humano, anticuerpos modificados por ingeniería genética (tales como, por ejemplo, quiméricos, de cadena simple, injertados con CDR, humanizados, y anticuerpos seleccionados artificialmente), anticuerpos sintéticos y anticuerpos semisintéticos.

En los aspectos terapéuticos de la presente divulgación, se contemplan anticuerpos biespecíficos. Los anticuerpos biespecíficos son anticuerpos monoclonales preferiblemente humanos o humanizados, que tienen especificidades de unión por al menos dos antígenos diferentes. En el caso presente, una de las especificidades de unión es por C5a, la otra es por cualquier otro antígeno.

Los métodos para hacer anticuerpos biespecíficos están dentro del ámbito de los expertos den la materia. De manera tradicional, la producción recombinante de anticuerpos biespecíficos se basa en la coexpresión de dos pares cadena pesada/cadena ligera de inmunoglobulina, donde los dos pares de cadena pesada/cadena ligera tienen diferentes especificidades (Milstein y Cuello (1983) Nature 305:537-539). Los dominios variables del anticuerpo con las especificidades de unión deseadas (sitios de combinación de anticuerpo-antígeno) se pueden fusionar a las secuencias de dominios constantes de inmunoglobulina. La fusión de la región variable de cadena pesada es de forma preferible con un dominio constante de cadena pesada de inmunoglobulina, incluyendo al menos parte de la bisagra, las regiones CH2, y CH3. Los ADN que codifican las fusiones de cadena pesada de inmunoglobulina y, si se desea, la cadena ligera de inmunoglobulina, se insertan en vectores de expresión distintos, y se cotransfectan en un organismo hospedador adecuado. Para detalles adicionales de los métodos ilustrativos actualmente conocidos para generar anticuerpos biespecíficos véase, por ejemplo, Suresh et al. (1986) Methods in Enzymology 121:210; publicación de PCT nº WO 96/27011; Brennan et al. (1985) Science 229:81; Shalaby et al., J Exp Med (1992) 175:217-225; Kostelny et al. (1992) J Immunol 148(5):1547-1553; Hollinger et al. (1993) Proc Natl Acad Sci USA 90:6444-6448; Gruber et al. (1994) J Immunol 152:5368; y Tutt et al. (1991) J Immunol 147:60. Los anticuerpos biespecíficos también incluyen anticuerpos entrecruzados o heteroconjugados. Los anticuerpos heteroconjugados pueden hacerse usando cualquier método de entrecruzamiento conveniente. Los agentes de entrecruzamiento convenientes se conocen bien en la técnica, y se divulgan en la patente de Estados Unidos nº 4.676.980, junto con diversas de técnicas de entrecruzamiento. Se describieron varias técnicas para hacer y aislar fragmentos de anticuerpo biespecíficos directamente a partir del cultivo de células recombinantes. Por ejemplo, los anticuerpos biespecíficos se produjeron usando cremalleras de leucina. Véase, por ejemplo, Kostelny et al. (1992) J Immunol 148(5):1547-1553. Los péptidos de cremallera de leucina de las proteínas Fos y Jun se pueden ligar a las porciones Fab' de dos anticuerpos diferentes mediante fusión génica. Los homodímeros de anticuerpo pueden reducirse en la región bisagra para formar monómeros y después reoxidarse para formar los heterodímeros de anticuerpo. También pueden utilizarse estos métodos para la producción de homodímeros de anticuerpo. La tecnología “diacuerpo” descrita por Hollinger et al. (1993) Proc Natl Acad Sci USA 90:6444-6448 proporcionó un mecanismo alternativo para hacer fragmentos de anticuerpo biespecíficos. Los fragmentos comprenden un dominio variable de cadena pesada (VH) conectado a un dominio variable de cadena ligera (VL) por un conector que es demasiado corto para permitir el emparejamiento entre los dos dominios en la misma cadena. Por consiguiente, los dominios VH y VL de un fragmento son forzados a emparejarse con los dominios complementarios VL y VH de otro fragmento, formando de este modo dos sitios de unión a antígeno. También se comunicó otra estrategia para hacer fragmentos de anticuerpos biespecíficos mediante el uso de dímeros de Fv (scFv) de cadena simple. Véase, por ejemplo, Gruber et al. (1994) J Immunol 152:5368. Alternativamente, los anticuerpos pueden ser “anticuerpos lineales” según se describe en, por ejemplo, Zapata (1995) Protein Eng. 8(10):1057-1062. Brevemente, los anticuerpos comprenden un par de fragmentos Fd en tándem (VH-CH1-VH-CH1) que forman un par de regiones de unión a antígeno. Los anticuerpos lineales pueden ser biespecíficos o monoespecíficos. Anticuerpos con más de dos valencias (por ejemplo, anticuerpos triespecíficos) se contemplan y describen, por ejemplo, Tutt et al. (1991) J Immunol 147:60.

La divulgación también abarca formas variantes de anticuerpos multiespecíficos, tales como el dominio variable dual de moléculas de inmunoglobulina (DVD-Ig) descrito en Wu et al. (2007) Nat Biotechnol 25(11):1290-1297. Las moléculas DVD-Ig son concebidas de tal manera que dos dominios variables de cadena ligera diferentes (VL) de dos anticuerpos parentales diferentes se unen en tándem directamente o a través de un conector corto mediante técnicas de ADN recombinante, seguidos por un dominio constante de cadena ligera. De forma similar, la cadena pesada comprende dos dominios variables de cadena pesada diferentes (VH) unidos en tándem, seguidos por el dominio constante CH1 y la región Fc. Los métodos para hacer moléculas DVD-Ig a partir de dos anticuerpos parentales se describen adicionalmente en, por ejemplo, las publicaciones PCT nº WO 08/0241188 y WO 07/024715.

La divulgación también proporciona anticuerpos de camélido o dromedario (por ejemplo, anticuerpos derivados de Camelus bactrianus, Calelus dromaderius, o Lama paccos). Dichos anticuerpos, a diferencia de los típicos anticuerpos de dos cadenas (fragmento) o cuatro cadenas (anticuerpo completo) de la mayoría de los mamíferos, generalmente carecen de cadenas ligeras. Véase la patente de Estados Unidos nº 5.759.808; Stijlemans et al.

(2004) J Biol Chem 279:1256-1261; Dumoulin et al. (2003) Nature 424:783-788; y Pleschberger et al. (2003) Bioconjugate Chem 14:440-448. Las bibliotecas de anticuerpos y fragmentos de anticuerpo de camélido, modificadas por ingeniería genética, están disponibles comercialmente, por ejemplo, de Ablynx (Gante, Bélgica). Como con otros anticuerpos de origen que no es de ser humano, una secuencia de aminoácidos de un anticuerpo de camélido puede alterarse de forma recombinante para obtener una secuencia que se asemeje más estrechamente a una secuencia de ser humano, es decir, el nanocuerpo puede ser “humanizado” para de esta manera reducir aún más la potencial inmunogenicidad del anticuerpo. En algunos aspectos de la divulgación, los anticuerpos anti-C5a descritos en el presente documento comprenden una región constante de cadena pesada alterada que tiene reducida (o no) la función efectora en comparación con su correspondiente región constante no alterada. Las funciones efectoras que implican la región constante del anticuerpo anti-C5 pueden modularse mediante la alteración de las propiedades de la región constante o región Fc. Las funciones efectoras alteradas incluyen, por ejemplo, una modulación en una o más de las siguientes actividades: citotoxicidad celular dependiente de anticuerpo (ADCC), citotoxicidad dependiente del complemento (CDC), apoptosis, unión a uno o más receptores de Fc, y respuestas proinflamatorias. La modulación se refiere a un incremento, disminución o eliminación de la actividad de una función efectora que muestra un anticuerpo de un sujeto que contiene una región constante alterada en comparación con la actividad de la forma no alterada de la región constante. En aspectos particulares de la divulgación, la modulación incluye situaciones en las que una actividad se suprime o está completamente ausente. Una región constante alterada con una afinidad de unión a FcR y/o actividad de ADCC alteradas y/o actividad de CDC alterada es un polipéptido que tiene mejorada o disminuida la actividad de unión a FcR y/o la actividad ADCC y/o la actividad CDC en comparación con la forma no alterada de la región constante. Una región constante alterada que presenta unión aumentada a un FcR, se une a al menos un FcR con afinidad mayor que el polipéptido no alterado. Una región constante alterada que presenta unión disminuida a un FcR se une al menos a un FcR con afinidad menor que la forma no alterada de la región constante. Dichas variantes que presentan unión disminuida a un FcR pueden poseer poca o una unión no apreciable a un FcR, por ejemplo, de 0 a 50% (por ejemplo, menor que 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, o 1%) de la unión del FcR en comparación al nivel de unión al FcR de una secuencia natural de la región constante o Fc de inmunoglobulina. De forma similar, una región constante alterada que presenta actividad ADCC y/o CDC modulada puede mostrar actividad ADCC y/o CDC aumentadas o reducidas en comparación con la región constante no alterada. Por ejemplo, en algunos aspectos de la divulgación, el anticuerpo anti-C5a comprende una región constante alterada que puede exhibir aproximadamente de 0 a 50% (por ejemplo, menos que 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, o 1%) de la actividad ADCC y/o CDC de la forma no alterada de la región constante. Un anticuerpo anti-C5a descrito en el presente documento que comprende una región constante alterada que presenta ADCC y/o CDC reducidas, puede mostrar actividad reducidas ADCC y/o CDC, o no mostrar actividad, como se ejemplifica en el presente documento. En ciertos aspectos de la divulgación, la región constante alterada tiene al menos una sustitución aminoacídica, inserción, y/o deleción, en comparación a una secuencia de la región constante natural o con la región constante no alterada, por ejemplo, desde aproximadamente una a aproximadamente cien sustituciones aminoacídicas, inserciones y/o deleciones de una región constante secuencias naturales, o en la región constante del polipéptido parental. En algunos aspectos de la divulgación, la región constante alterada en el presente documento poseerá, al menos, aproximadamente 70% de homología (similitud) o identidad con la región constante no alterada y en algunos ejemplos al menos aproximadamente 75% y en otros ejemplos al menos aproximadamente 80% de homología o identidad con las mismas, y en otras realizaciones al menos aproximadamente 85%, 90% o 95% de homología o identidad con las mismas. La región constante alterada puede también contener una o más deleciones o inserciones aminoacídicas. Adicionalmente, la región constante alterada puede contener una o más sustituciones, deleciones, o inserciones aminoacídicas que resultan en modificaciones postraduccionales alteradas, incluyendo, por ejemplo, un patrón de glucosilación alterado (por ejemplo, la adición de uno o más componentes de azúcar, la pérdida de uno o más componentes de azúcar, o un cambio en la composición de uno o más componentes de azúcar, en comparación a la región constante no alterada). Los anticuerpos con las funciones efectoras alteradas, o sin ellas, pueden generarse mediante modificación por ingeniería genética o produciendo anticuerpos con regiones constantes, Fc, o cadena pesada variantes; la tecnología de ADN recombinante y/o cultivo celular y condiciones de expresión se pueden utilizar para producir anticuerpos con función y/o actividad alteradas. Por ejemplo, la tecnología de ADN recombinante se puede usar para obtener por ingeniería genética una o más sustituciones, deleciones, o inserciones aminoacídicas en regiones (tales como, por ejemplo, regiones Fc o constantes) que afecten la función del anticuerpo incluyendo funciones efectoras. Alternativamente, se pueden conseguir cambios en las modificaciones postraduccionales, tales como, por ejemplo, patrones de glucosilación, mediante la manipulación de las condiciones de cultivo celular y expresión a través de las de las cuales se produce el anticuerpo. Los métodos adecuados para introducir una o más sustituciones, adiciones, o deleciones dentro de una región Fc de un anticuerpo se conocen bien en la técnica e incluyen, por ejemplo, técnicas estándar de mutagénesis de ADN según se describe en, por ejemplo, Sambrook et al.(1989) "Molecular Cloning: A Laboratory Manual, 2º Edición", Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow y Lane (1988), citado anteriormente; Borrebaek (1992), citado anteriormente; Johne et al.(1993), citado anteriormente; publicación PCT nº WO 06/53301; y patente de Estados Unidos nº 7.704.497. En algunos aspectos de la divulgación, un anticuerpo anti-C5a descrito en el presente documento muestra, o no, una función efectora reducida. En algunos aspectos de la divulgación, un anticuerpo anti-C5a comprende una región constante híbrida, o una porción de la misma, tal como una región constante hibrida G2/G4 (véase, por ejemplo, Burton et al. (1992) Adv Immun 51:1-18; Canfield et al. (1991) J Exp Med 173:1483-1491; y Mueller et al. (1997) Mol Immunol 34(6):441-452). Véase más arriba. Además de usar una construcción G2/G4 según se describe anteriormente, un anticuerpo anti-C5a descrito en el presente documento que tenga función efectora reducida puede producirse mediante la introducción de otros tipos de cambios en la secuencia de aminoácidos de ciertas regiones del anticuerpo. Dichos cambios en la secuencia de aminoácidos incluyen, pero sin limitación, la mutación Ala-Ala descrita en, por ejemplo, las publicaciones PCT nº WO 94/28027 y WO 98/47531; y Xu et al. (2000) Cell Immunol 200:16-26. Así, en algunos aspectos de la divulgación, un anticuerpo anti-C5a con una o más mutaciones dentro de la región constante, incluyendo la mutación Ala-Ala, tiene reducida, o no tiene tiene, la función efectora. De acuerdo con estos aspectos, la región constante del anticuerpo puede comprender una sustitución de una alanina en la posición 234 o una mutación de una alanina en la posición 235. De forma adicional, la región constante alterada puede contener una mutación doble: una mutación en una alanina en la posición 234 y una segunda mutación en una alanina en la posición 235. En un aspecto de la divulgación, un anticuerpo anti-C5a comprende un armazón de IgG4, en el que la mutación Ala-Ala describiría una mutación (o mutaciones) de fenilalanina a alanina en la posición 234 y/o una mutación de leucina a alanina en la posición 235. En otro aspecto de la divulgación, el anticuerpo anti-C5a comprende un armazón de IgG1, en el que la mutación Ala-Ala describiría una mutación (o mutaciones) de leucina a alanina en la posición 234 y/o una mutación de leucina a alanina en la posición 235. Un anticuerpo anti-C5a puede, de forma alternativa o de forma adicional, portar otras mutaciones, incluyendo la mutación puntual K322A en el dominio CH2 (Hezareh metal. (2001) J Virol 75:12161-12168). Un anticuerpo con dicha mutación (o mutaciones) en la región constante puede además ser un anticuerpo bloqueante o no bloqueante. Sustituciones adicionales que, cuando se introducen en la región constante de cadena pesada, resultan en una función efectora disminuida se indican en, por ejemplo, Shields et al. (2001) J Biol Chem 276(9):6591-6604. En particular, véase la Tabla 1 ("Unión de la variante de ser humano de IgG1 a FcRn y FcγR”) de Shields et al., cuya divulgación se incorpora en el presente documento como referencia en su totalidad. Mediante la exploración de una biblioteca de anticuerpos anti-IgE, cada anticuerpo de la biblioteca que difiere en una o más sustituciones en la región constante de cadena pesada, por unión a un panel de receptores Fc (incluyendo FcRn, FcγRI, FcγRIIA, FcγRIIB, y FcγRIIIA), los autores identifican diversas sustituciones que modulan interacciones específicas Fc- receptor de Fc. Por ejemplo, una variante de la región constante de cadena pesada de IgG2a, en la cual el dominio CH2 contiene una sustitución D265A (numeración de los aminoácidos de la cadena pesada de acuerdo a Kabat et al. (citado anteriormente)), resulta en una pérdida completa de la interacción entre la región constante variante y los receptores de Fc de IgG, FcγRIIB, FcγRIII, FcγRI, y FcγRIV. Shields et al. (2001) en la página 6595, Tabla 1. Véase también Baudino et al. (2008) J Immunol 181:6664-6669 (citado anteriormente).

Los cambios dentro de la región bisagra también afectan las funciones efectoras. Por ejemplo, la deleción de la región bisagra puede reducir la afinidad por los receptores Fc y puede reducir la activación del complemento (Klein et al. (1981) Proc. Natl Acad Sci USA 78: 524-528). Por lo tanto, la presente divulgación también se refiere a anticuerpos con alteraciones en la región bisagra.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a puede contener una región constante alterada, mostrando citotoxicidad dependiente del complemento mejorada o reducida (CDC). Se puede conseguir una actividad CDC modulada mediante la introducción de una o más sustituciones, inserciones, o deleciones aminoacídicas, en una región Fc del anticuerpo. Véase, por ejemplo, la patente de Estados Unidos nº 6.194.551. De forma alternativa o de forma adicional, el resto (o restos) de cisteína se pueden introducir en la región Fc, permitiendo de este modo la formación de uniones disulfuro entre cadenas en esta región. Los anticuerpos homodiméricos así generados pueden tener mejorada o reducida la capacidad de internalización y/o incrementada o disminuida la destrucción celular mediada por el complemento. Véase, por ejemplo, Caron et al. (1992) J Exp Med 176:1191-1195 y Shopes (1992) Immunol 148:2918-2922; las publicaciones PCT nº WO 99/51642 y WO 94/29351; Duncan y Winter (1988) Nature 322:738-40; y las patentes de Estados Unidos nº 5.648.260 y 5.624.821.

Otro medio potencial para modular la función efectora de anticuerpos incluye cambios en la glucosilación, lo que se sintetiza, por ejemplo, en Raju (2003) BioProcess International 1(4):44-53. De acuerdo con Wright y Morrison, la microheterogeneidad de los oligosacáridos de IgG de ser humano puede afectar a las funciones biológicas tales como CDC y ADCC, a la unión a varios de receptores de Fc, y a la unión a la proteína Clq. (1997) TIBTECH 15:26- 32. Los patrones glucosilación de los anticuerpos pueden diferir dependiendo de las células productoras y de las condiciones del cultivo celular (Raju, citado anteriormente). Dichas diferencias pueden conducir a cambios en la función efectora y farmacocinética. Véase, por ejemplo, Israel et al. (1996) Immunology 89(4):573-578; Newkirk et al. (1996) Clin Exp Immunol 106(2):259-264. Las diferencias en la función efectora pueden estar relacionadas con la habilidad de la IgG para unirse a los receptores de Fcγ (FcγR) en las células efectoras. Shields et al mostraron que la IgG, con alteraciones en la secuencia de aminoácidos que tenga la unión a FcγR mejorada, puede exhibir hasta un 100% de ADCC potenciada usando células efectoras de ser humano. (2001) J Biol Chem 276(9):6591-6604. Mientras que estas alteraciones incluyen cambios en aminoácidos que no se encuentran en la interfase de unión, la naturaleza del componente de azúcar así como su patrón estructural puede también contribuir a las diferencias observadas. Además, la presencia o ausencia de fucosa en el componente de oligosacárido de una IgG puede mejorar la unión y la ADCC. Véase, por ejemplo, Shields et al. (2002) J Biol Chem 277(30):26733-26740. Una IgG que perdió un carbohidrato fucosilado unido a Asn297 exhibió una unión normal al receptor con el receptor FcγRI. En contraste, la unión al recepctor FcγRIIIA mejoró 50 veces y vino acompañada de una ADCC potenciada, especialmente a bajas concentraciones de anticuerpo.

Shinkawa et al. Demostraron que un anticuerpo contra el receptor de IL-5 de ser humano producido en un hibridoma de rata mostró una ADCC un 50% mayor en comparación con el anticuerpo producido en células de ovario de hámster chino (CHO) (Shinkawa et al. (2003) JBiol Chem 278(5):3466-73). La composición de monosacáridos y el perfil de oligosacáridos mostraron que la IgG producida por hibridoma de rata tenía un menor contenido de fucosa que la proteína producida en CHO. Los autores concluyeron que la pérdida de fucosilación de una IgG1 tiene un papel crítico en la potenciación de la actividad de ADCC.

Umana et al. adoptaron una estrategia diferente, ya que cambiaron el patrón de glucosilación de chCE7, un anticuerpo IgG1 quimérico antineuroblastoma. (1999) Nat Biotechnol 17(2):176-180). Usando tetraciclina, regularon la actividad de una enzima glucosiltransferasa (GnTIII) la cual divide en dos oligosacáridos implicados en la actividad ADCC. La actividad ADCC del anticuerpo parental estuvo apenas por encima del nivel de fondo. La medición de la actividad ADCC del chCE7 producida a diferentes niveles de tetraciclina mostró un rango óptimo de expresión de GnTIII para la actividad máxima ADCC in vitro de chCE7. Esta actividad se correlacionó con el nivel de oligosacárido complejo dividido en dos, asociado a la región constante. Las variantes recién optimizadas exhibieron actividad ADCC sustancial. De manera similar, Wright y Morrison produjeron anticuerpos en una línea celular CHO deficiente en glucosilación y mostraron que los anticuerpos producidos en esta línea celular eran incapaces de realizar citólisis mediada por complemento. (1994) J Exp Med 180:1087-1096. Así, las alteraciones conocidas que afectan a la función efectora, incluyen modificaciones en el patrón de glucosilación o un cambio en el número de restos glucosilados, la presente divulgación se refiere a un anticuerpo anti-C5a en el que la glucosilación se altera para potenciar o disminuir la función (o funciones) efectora incluyendo ADCC y CDC. Una glucosilación alterada incluye una disminución o aumento en el número de restos glucosilados así como un cambio en el patrón o emplazamiento de los restos glucosilados. Aún existen otras estrategias para alterar la función efectora de los anticuerpos. Por ejemplo, células productoras de anticuerpos pueden ser hipermutagénicas, generando de este modo anticuerpos con restos polipeptídicos, alterados al azar, a lo largo de toda una molécula de anticuerpo. Véase, por ejemplo, la publicación PCT nº WO 05/011735.

Las células hospedadoras hipermutagénicas incluyen células deficientes en la reparación de desapareamiento de ADN. Los anticuerpos producidos de esta manera pueden ser menos antigénicos y/o tener propiedades farmacocinéticas beneficiosas. Adicionalmente, dichos anticuerpos pueden seleccionarse por propiedades tales como la función (o funciones) efectora potenciada o disminuida. A continuación se indican detalles adicionales de las técnicas de biología molecular útiles para preparar un anticuerpo o fragmento de unión a antígeno del mismo descrito en el presente documento. Expresión y purificación de anticuerpos recombinantes Los anticuerpos o fragmentos de unión a antígeno de los mismos descritos en el presente documento pueden producirse usando una variedad de técnicas conocidas en la materia de biología molecular y química de proteínas. Por ejemplo, un ácido nucleico que codifica uno o ambos polipéptidos de la cadena pesada y la cadena ligera de un anticuerpo pueden insertarse dentro de un vector de expresión que contenga secuencias reguladoras transcripcionales y traduccionales, que incluyen, por ejemplo, secuencias de promotores, sitios de unión ribosomal, secuencias de inicio y de terminación transcripcionales, secuencias de inicio y de terminación traduccionales, señales terminadoras de la transcripción, señales de poliadenilación, y secuencias potenciadoras o activadoras. Las secuencias reguladoras incluyen un promotor y secuencias de inicio y de terminación transcripcionales. Además, el vector de expresión puede incluir más de un sistema de replicación de manera que este se pueda mantener en dos organismos diferentes, por ejemplo en células para expresión de mamífero o de insecto y en un hospedador procariota para clonación y amplificación.

Están disponibles varios sistemas de vectores posibles para la expresión de polipéptidos de cadena pesada y cadena ligera clonados a partir de ácidos nucleicos en células de mamífero. Una clase de vectores se basa en la integración de las secuencias génicas deseadas en el genoma de la célula hospedadora. Las células que tienen ADN integrado de manera estable se pueden seleccionar mediante la introducción simultánea de genes de resistencia a fármacos tales como gpt de E. coli (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) o neo de Tn5 (Southern and Berg (1982) Mol. Appl Genet 1:327). El gen del marcador de selección puede ligarse a las secuencias de ADN génicas a expresar, o introducirse en la misma célula mediante cotransfección (Wigler et al. (1979) Cell 16:77). Una segunda clase de vectores utiliza elementos de ADN que otorgan capacidades de replicación autónoma a un plásmido extra cromosomal. Estos vectores pueden derivar de virus de animales, tales como el papilomavirus bovino (Sarver et al. (1982) Proc. Natl Acad Sci USA, 79:7147), citomegalovirus, poliomavirus, (Deans et al. (1984) Proc Natl Acad Sci USA 81:1292), o virus SV40 (Lusky and Botchan (1982) Nature 293:79). Los vectores de expresión pueden introducirse dentro de células de una manera adecuada para la expresión posterior del ácido nucleico. El método de introducción lo dictamina, en gran medida, el tipo de célula diana, analizado a continuación. Los métodos ejemplares incluyen precipitación con CaPO4, fusión de liposomas, liposomas catiónicos, electroporación, infección viral, transfección mediada por dextrano, transfección mediada por polibreno, fusión de protoplastos, y microinyección directa.

Las células hospedadoras apropiadas para la expresión de anticuerpos o de fragmentos de unión a antígeno de los mismos incluyen células de levaduras, de bacterias, de insecto, de planta, y de mamífero. De particular interés son las bacterias tales como E. coli, hongos tales Saccharomyces cerevisiae y Pichia pastoris, células de insectos tales como SF9, líneas celulares de mamífero (por ejemplo, líneas celulares de ser humano), así como líneas de células primarias.

En algunos aspectos de la divulgación, un anticuerpo o fragmento del mismo se puede expresar en, y purificar de, animales transgénicos (por ejemplo, mamíferos transgénicos). Por ejemplo, un anticuerpo puede producirse en mamíferos que no son seres humanos transgénicos (por ejemplo, roedores) y aislarse de leche como se describe en, por ejemplo, Houdebine (2002) Curr Opin Biotechnol 13(6):625-629; van Kuik-Romeijn et al. (2000) Transgenic Res 9(2):155-159; y Pollock et al. (1999) J Immunol Methods 231(1-2):147-157. Los anticuerpos y fragmentos de los mismos se pueden producir a partir de células por cultivo de una célula hospedadora transformada con el vector de expresión conteniendo el ácido nucleico que codifica los anticuerpos o fragmento, en condiciones, y por una cantidad de tiempo, suficientes para permitir la expresión de las proteínas.

Dichas condiciones para la expresión de proteína variará con la elección del vector de expresión y de la célula hospedadora, y se comprobará fácilmente por alguien experto en la materia a través de experimentación de rutina. Por ejemplo, los anticuerpos expresados en E. coli se pueden replegar a partir de cuerpos de inclusión (véase, por ejemplo, Hou et al. (1998) Cytokine 10:319-30). Los sistemas de expresión bacteriana y los métodos para su uso se conocen bien en la técnica (véase Current Protocols in Molecular Biology, Wiley & Sons, y Molecular Cloning A Laboratory Manual-3º Ed., Cold Spring Harbor Laboratory Press, New York (2001)). La elección de los codones, de los vectores expresión adecuados y de células hospedadoras adecuadas, variará dependiendo de diversos factores, y puede optimizarse de forma fácil según sea necesario. Un anticuerpo (o fragmento del mismo) descrito en el presente documento se puede expresar en células de mamífero o en otros sistemas de expresión incluyendo, pero sin limitación, levaduras, baculovirus, y sistemas de expresión in vitro (véase, por ejemplo, Kaszubska et al. (2000) Protein Expression and Purification 18:213-220). Después de la expresión se pueden aislar los anticuerpos o fragmentos de los mismos. Los términos “purificado” o “aislado” como se aplica a cualquiera de las proteínas (anticuerpos o fragmentos) descritas en el presente documento se refiere a un polipéptido que se separó o purificó a partir de componentes (por ejemplo, proteínas u otras moléculas biológicas u orgánicas de origen natural) que la acompañan de forma natural, por ejemplo, otras proteínas, lípidos, y ácidos nucleicos en un procariota expresando las proteínas. Típicamente, un polipéptido se purifica cuando este constituye al menos el 60 (por ejemplo, al menos el 65, 70, 75, 80, 85, 90, 92, 95, 97, o 99) %, por peso, de las proteínas totales en una muestra.

Un anticuerpo, o fragmento del mismo, se puede aislar o purificar de una diversidad de modos conocidos por los expertos en la materia, dependiendo de qué otros componentes están presentes en la muestra. Los métodos de purificación estándar incluyen técnicas electroforéticas, moleculares, inmunológicas y cromatográficas, incluyendo cromatografía de intercambio iónico, cromatografía hidrofóbica, cromatografía de afinidad, y cromatografía en fase inversa HPLC. Por ejemplo, un anticuerpo se puede purificar usando una columna anti anticuerpo estándar (por ejemplo, una columna de proteína A o de proteína G). Son también útiles las técnicas de ultrafiltración y diafiltración, junto con la concentración de proteínas. Véase, por ejemplo, Scopes (1994) "protein Purification, 3ª Edición", Springer-Verlag, ciudad de Nueva York City, Nueva York. El grado de purificación necesario variará dependiendo del uso deseado. En algunos casos no será necesaria la purificación del anticuerpo expresado, o de los fragmentos del mismo.

Los métodos para determinar el rendimiento o pureza de un anticuerpo purificado o fragmento del mismo, se conocen en la técnica e incluyen, por ejemplo, el ensayo de Bradford, espectroscopía UV, ensayo de proteínas de Biuret, ensayo de proteínas de Lowry, ensayo de proteínas amido black, cromatografía líquida de alta presión (HPLC), espectrometría de masas (EM), y métodos electroforéticos en gel (por ejemplo, usando una tinción de proteínas tal como azul de Coomassie o tinción de plata coloidal). En algunos aspectos de la divulgación, las endotoxinas pueden eliminarse de los anticuerpos o fragmentos. Los métodos para la eliminación de endotoxinas a partir de una muestra de proteínas se conocen en la técnica y se ejemplifican en los ejemplos de trabajo. Por ejemplo, las endotoxinas pueden eliminarse a partir de una muestra de proteínas usando una diversidad de reactivos disponibles de forma comercial, incluyendo, sin limitación, los kits de eliminación de endotoxinas ProteoSpin™ (Norgen Biotek Corporation), el gel de eliminación de endotoxinas Detoxi- Gel (Thermo Scientific; Pierce Protein Research Products), el kit de eliminación de endotoxinas MiraCLEAN® (Mirus), o la membrana Acrodisc™ - Mustang® E (Pall Corporation).

Los métodos para la detección y/o medición de la cantidad de endotoxina presente en una muestra (antes y después de la purificación) se conocen en la técnica, y están disponibles kits comerciales. Por ejemplo, la concentración de endotoxina en una muestra de proteínas se puede determinar usando el kit QCL-1000 Chromogenic (BioWhittaker), kits basados en lisado de amebocito límulus, tales como los kits (LAL) Pyrotell®, Pyrotell®-T, Pyrochrome®, Chromo-LAL, y kits CSE disponibles de Associates of Cape Cod Incorporated.

Aunque de ninguna forma pretenden ser limitantes, los métodos ejemplares para la generación de anticuerpos, descritos en el presente documento, se indican en los ejemplo de trabajo.

Modificación de los anticuerpos o fragmentos de unión a antígeno de los mismos Después de su expresión y purificación, los anticuerpos o fragmentos de unión a antígeno de los mismos se pueden modificar. Las modificaciones pueden ser modificaciones covalente o no covalentes. Dichas modificaciones se pueden introducir en los anticuerpos o fragmentos mediante, por ejemplo, la reacción de residuos de aminoácidos diana del polipéptido, con un agente de derivación orgánico que sea capaz de reaccionar con cadenas laterales o restos terminales seleccionados. Los sitios adecuados para la modificación pueden elegirse usando cualquiera de una diversidad de criterios incluyendo, por ejemplo, análisis estructural o análisis de la secuencia de aminoácidos de los anticuerpos o fragmentos.

En algunos aspectos de la divulgación, los anticuerpos o fragmentos de unión a antígeno de los mismos se pueden conjugar a un resto heterólogo. El resto heterólogo puede ser, por ejemplo, un polipéptido heterólogo, un agente terapéutico, (por ejemplo, una toxina o un fármaco) o un marcaje que se pueda detectar tal como, pero sin limitación, un marcaje radioactivo, un marcaje enzimático, un marcaje fluorescente, un marcaje de metal pesado, un marcaje luminiscente, o una etiqueta de afinidad tal como biotina o estreptavidina. Los polipéptidos heterólogos adecuados incluyen, por ejemplo, una etiqueta antigénica (por ejemplo, FLAG (DYKDDDDK (SEC ID Nº: 50)), polihistidina (6- His; HHHHHH (SEC ID Nº: 81), hemaglutinina (HA; YPYDVPDYA (SEC ID Nº: 82), glutation-S-transferasa (GST), o proteína de unión a maltosa (MBP)) para su uso en la purificación de anticuerpos o fragmentos. Los polipéptidos heterólogos también incluyen polipéptidos (por ejemplo, enzimas) que sean útiles como marcadores de diagnóstico o marcadores que se puedan detectar, por ejemplo, luciferasa, una proteína fluorescente (por ejemplo, proteína fluorescente verde (GFP)), o cloranfenicol acetil transferasa (CAT). Los marcajes radioactivos adecuados incluyen, por ejemplo, 32P, 33P, 14C, 125I, 131I, 35S, y 3H. Los marcajes fluorescentes adecuados incluyen, pero sin limitación, fluoresceína, isotiocianato de fluoresceína (FITC), proteína fluorescente verde (GFP), DyLight™ 488, ficoeritrina (FE), yoduro de propidio (IP), PerCP, PE-Alexa Fluor® 700, Cy5, aloficocianina, y Cy7. Los marcajes luminiscentes incluyen, por ejemplo, cualquiera de una diversidad de quelatos de lantánidos luminiscentes (por ejemplo, europio o terbio). Por ejemplo, los quelatos de europio adecuados incluyen el quelato de europio de ácido dietilentriamina pentaacético (DTPA) o ácido tetraazaciclododecano-1,4,7,10-tetraacético (DOTA). Los marcajes enzimáticos incluyen, por ejemplo, fosfatasa alcalina, CAT, luciferasa, y peroxidasa de rábano picante.

Dos proteínas (por ejemplo, un anticuerpo, y un resto heterólogo) se pueden entrecruzar usando cualquiera de una diversidad de agentes entrecruzadores químicos conocidos. Ejemplos de dichos agentes entrecruzadores son aquellos que ligan dos restos de aminoácidos a través de un enlace que incluye una unión disulfuro “obstaculizada”. En estos enlaces, una unión disulfuro dentro de la unidad de entrecruzamiento está protegida (por grupos obstaculizantes en cualquiera de los lados de la unión disulfuro) de la reducción mediante la acción, por ejemplo, de un glutatión reducido o de la enzima disulfuro reductasa. Un reactivo adecuado, 4-succinimidiloxicarbonil-α-metil-α(2- piridilitio) tolueno (SMPT), forma dicho enlace entre dos proteínas utilizando una lisina terminal sobre una de las proteínas y una cisteína terminal sobre la otra. También se pueden usar reactivos heterobifuncionales que entrelazan mediante un resto de unión diferente sobre cada proteína. Otros agentes de entrecruzamiento útiles incluyen, pero sin limitación, reactivos que unen dos grupos amino (por ejemplo, N-5-azida-2- nitrobenzoiloxisuccinimida), dos grupos sulfhidrilos (por ejemplo, 1,4-bis-maleimidobutano), un grupo amino y un grupo sulfhidrilo (por ejemplo, m-maleimidobenzoil-N-hidroxisuccinimida éster), un grupo amino y un grupo carboxilo (por ejemplo, 4-[p-azidosalicilamido]butilamina), y un grupo amino y un grupo guanidinio que esté presente en la cadena lateral de arginina (por ejemplo, p-azidofenil glioxal monohidrato).

En algunos aspectos de la divulgación, un marcaje radioactivo puede ser conjugado directamente al esqueleto aminoacídico del anticuerpo. De forma alternativa, el marcaje radioactivo puede incluirse como parte de una molécula más grande (por ejemplo, 125I en Meta:[125I]yodofenil-N-hidroxisuccinimida ([125I]mIPNHS) que se une a grupos amino libres para formar derivados de metal-yodofenil (mIP) de proteínas relevantes (véase, por ejemplo, Rogers et al. (1997) J Nucl Med 38:1221-1229) o un quelato (por ejemplo, DOTA o DTPA) que se une a su vez al esqueleto de la proteína. Los métodos para conjugar los marcajes radioactivos, o las moléculas-quelatos más grandes que los contienen, a los anticuerpos o fragmentos de unión a antígeno descritos en el presente documento se conocen en la técnica. Dichos métodos implican la incubación de proteínas con el marcaje radioactivo, en condiciones (por ejemplo, pH, concentración de sales, y/o temperatura) que facilitan la unión del marcaje radioactivo o el quelato a la proteína (véase, por ejemplo, la patente de Estados Unidos nº 6.001.329) Los métodos para conjugar un marcaje fluorescente (algunas veces denominado como un “fluoróforo”) a una proteína (por ejemplo, un anticuerpo), se conocen en la técnica de química de proteínas. Por ejemplo, los fluoróforos pueden conjugarse a grupos amino libres (por ejemplo, de lisinas) o grupos sulfhidrilos (por ejemplo, cisteínas) de proteínas, usando restos succinimidil (NHS) éster o tetrafluorofenil (TFP) éster unidos a los fluoróforos. En algunos aspectos de la divulgación, los fluoróforos pueden conjugarse a un resto entrecruzador heterobifuncional tal como sulfo-SMCC. Los métodos adecuados de conjugación implican la incubación de una proteína de anticuerpo, o fragmento de la misma, con el fluoróforo en condiciones que faciliten la unión del fluoróforo a la proteína. Véase, por ejemplo, Welch y Redvanly (2003) "Handbook of Radiopharmaceuticals: Radiochemistry and Applications," John Wiley and Sons (ISBN 0471495603).

En algunos aspectos de la divulgación, los anticuerpos o fragmentos se pueden modificar, por ejemplo, con un resto que mejore la estabilización y/o retención de los anticuerpos en circulación, por ejemplo, en sangre, suero, u otros tejidos. Por ejemplo, el anticuerpo o fragmento puede ser PEGilado como se describe en, por ejemplo, Lee et al. (1999) Bioconjug Chem 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries Reviews 54:477-485; y Roberts

et al. (2002) Advanced Drug Delivery Reviews 54:459-476 o HESilado (Fresenius Kabi, Alemania; véase, por ejemplo, Pavisić et al. (2010) Int J Pharm 387(1-2):110-119). El resto de estabilización puede mejorar la estabilidad, o retención de, el anticuerpo (o fragmento) en al menos 1,5 (por ejemplo, al menos 2, 5, 10, 15, 20, 25, 30, 40, o 50 o más) veces.

En algunos aspectos de la divulgación, los anticuerpos o fragmentos de unión a antígeno del mismo descritos en el presente documento pueden glucosilarse. En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo descrito en el presente documento se puede someter a tratamiento enzimático o químico, o se puede producir a partir de una célula, de tal manera que el anticuerpo o fragmento tenga una glucosilación reducida o ausente. Los métodos para producir anticuerpos con glucosilación reducida se conocen en la técnica y se describen en, por ejemplo, la patente de Estados Unidos nº 6.933.368; Wright et al. (1991) EMBO J 10(10):2717-2723; y Co et al. (1993) Mol Immunol 30:1361. Composiciones farmacéuticas Las composiciones que contienen un anticuerpo o un fragmento de unión a antígeno del mismo descrito en el presente documento, se pueden formular como una composición farmacéutica, por ejemplo, para la administración a un sujeto para el tratamiento o prevención de un trastorno asociado a complemento. Las composiciones farmacéuticas generalmente incluirán un excipiente farmacéuticamente aceptable. Según se usa en el presente documento, un “excipiente farmacéuticamente aceptable" se refiere a, e incluye, cualquiera y todos los disolventes, medios de dispersión, recubrimientos, agentes antibacterianos y antifúngicos, agentes isotónicos y agentes retardantes, y similares, que sean fisiológicamente compatibles. Las composiciones pueden incluir una sal fisiológicamente aceptable, por ejemplo, una sal de adición de ácidos o una sal de adición de bases (véase, por ejemplo, Berge et al. (1977) J Pharm Sci 66: 1-19).

Las composiciones pueden formularse de acuerdo a métodos estándar. La formulación farmacéutica es una técnica consolidada, y se describe adicionalmente en, por ejemplo, Gennam (2000) "Remington: The Science and Practice of Pharmacy," 20ª Edición, Lippincott, Williams & Wilkins (ISBN: 0683306472); Ansel et al. (1999) "Pharmaceutical Dosage Forms and Drug Delivery Systems," 7ª Edición, Lippincott Williams & Wilkins Publishers (ISBN: 0683305727); y Kibbe (2000) "Handbook of Pharmaceutical Excipients American Pharmaceutical Association," 3ª Edición (ISBN: 091733096X). En algunos aspectos de la divulgación, una composición puede formularse, por ejemplo, como una solución tamponada a una concentración adecuada y adecuada para el almacenamiento a 2-8 °C (por ejemplo, 4° C). En algunos aspectos de la divulgación, una composición puede formularse para el almacenamiento a una temperatura por debajo de 0 °C (por ejemplo, -20 °C o -80 °C). En algunos aspectos de la divulgación, una composición puede formularse para el almacenamiento por hasta 2 años (por ejemplo, un mes, dos meses, tres meses, cuatro meses, cinco meses, seis meses, siete meses, ocho meses, nueve meses, 10 meses, 11 meses, 1 año, 1 año y ½ o 2 años) a 2-8 °C (por ejemplo, 4 °C). Así, en algunos aspectos de la divulgación, las composiciones descritas en el presente documento son estables en almacenamiento por al menos 1 año a 2-8 °C (por ejemplo, 4° C).

Las composiciones farmacéuticas pueden estar en una diversidad de formas. Estas formas incluyen, por ejemplo, las formas de dosificación líquida, semisólida y sólida, tales como soluciones líquida (por ejemplo, soluciones inyectables e infusibles), dispersiones o suspensiones, comprimidos, píldoras, polvos, liposomas y supositorios. La forma preferente depende, en parte, del modo de administración previsto y de la aplicación terapéutica. Por ejemplo, las composiciones que contengan un anticuerpo o fragmento, previsto para administración sistémica o local, pueden estar en la forma de soluciones inyectables o infusibles. Por consiguiente, las composiciones pueden formularse para la administración por un modo parenteral (por ejemplo, inyección intravenosa, subcutánea, intraperitoneal o intramuscular). "Administración parenteral", "administrado de forma parenteral", y otras expresiones gramaticalmente equivalentes, según se usan en el presente documento, se refieren a modelos de administración que no sean la administración enteral y tópica, de forma usual por inyección, e incluyen, sin limitación, inyección e infusión intravenosa, intranasal, intraocular, intramuscular, intraarterial, intratecal, intracapsular, intraorbital, intracardiaca, intradérmica, intraperitoneal, transtraqueal, subcutánea, subcuticular, intraaricular, subcapsular, subaracnoidea, intraespinal, epidural, intracerebral, intracraneal, intracarotídea e intraesternal. Las composiciones se pueden formular como una solución, microemulsión, dispersiones, liposomas u otras estructuras ordenadas adecuadas para el almacenamiento estable a alta concentración. Las soluciones inyectables estériles pueden prepararse por la incorporación de un anticuerpo (o un fragmento del anticuerpo) descrito en el presente documento, en la cantidad necesaria, en un disolvente apropiado, con uno o una combinación de los ingredientes enumerados más arriba, según se necesite, seguido de esterilización por filtración. De manera general, las dispersiones se preparan mediante la incorporación de un anticuerpo o fragmento descrito en el presente documento en un vehículo estéril que contiene un medio de dispersión básico y los otros ingredientes necesarios de aquellos enumerados más arriba. En el caso de polvos estériles para la preparación de soluciones inyectables estériles, los métodos para la preparación incluyen secado al vacío y liofilización, que rinden un polvo de un anticuerpo, o un fragmento de unión a antígeno del mismo, descrito en el presente documento además de cualquier ingrediente adicional deseado (véase más arriba) a partir de una solución del mismo previamente filtrada en esterilidad. La fluidez apropiada de una solución se puede mantener, por ejemplo, por el uso de un recubrimiento tal como lecitina, por el mantenimiento del tamaño de partícula necesario en el caso de dispersión y por el uso de surfactantes. La absorción prolongada de composiciones inyectables puede provocarse por la inclusión en la composición de un reactivo que retrase la absorción, por ejemplo, sales de monoestearato y gelatina. Los anticuerpos anti-C5a, o fragmentos de unión a antígeno de los mismos, descritos en el presente documento pueden también formularse en composiciones de inmunoliposoma. Los liposomas conteniendo el anticuerpo se pueden preparar mediante métodos conocidos en la técnica tales como, por ejemplo, los métodos descritos en Epstein et al. (1985) Proc Natl Acad Sci USA 82: 3688; Hwang et al. (1980) Proc Natl Acad Sci USA 77: 4030; y la patente de Estados Unidos nº 4.485.045 y 4.544.545. Los liposomas con el tiempo de circulación potenciado se divulgan en, por ejemplo, la patente de Estados Unidos nº 5.013.556.

En ciertos aspectos de la divulgación, un anticuerpo o un fragmento de unión a antígeno del mismo puede prepararse con un excipiente que protegerá al compuesto frente a la liberación rápida, tal como una formulación de liberación controlada, incluyendo implantes y sistemas de administración microencapsulados. Pueden utilizarse polímeros biodegradables, biocompatibles, tales como acetato de etilenvinilo, polianhídridos, ácido poliglicólico, colágeno, poliortoésteres, y ácido poliláctico. Se conocen en la técnica muchos métodos para la preparación de tales formulaciones. Véase, por ejemplo, J.R. Robinson (1978) "Sustained and Controlled Release Drug Delivery Systems," Marcel Dekker, Inc., Nueva York. En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno descrito en el presente documento puede formularse en una composición adecuada para la administración intrapulmonar (por ejemplo, para la administración a través de un nebulizador; véase más arriba) a un mamífero tal como un ser humano. Los métodos para preparar tales composiciones se conocen bien en la técnica y se describen en, por ejemplo, la publicación de solicitud de patente de Estados Unidos nº 20080202513; las patentes de Estados Unidos nº 7.112.341 y 6.019.968; y el documento de publicación de solicitud PCT nº WO 00/061178 y WO 06/122257, las divulgaciones de cada una de las cuales se incorpora en el presente documento como referencia en su totalidad. Las formulaciones de inhaladores de polvo seco y los sistemas adecuados para la administración de las formulaciones se describen en, por ejemplo, la solicitud de patente de Estados Unidos nº de publicación 20070235029, el documento de publicación PCT nº WO 00/69887; y la patente de Estados Unidos nº 5.997.848.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede formularse en una composición adecuada para la administración en el ojo. En algunos aspectos de la divulgación, uno o más de los anticuerpos anti-C5a (o fragmentos de unión a antígeno de los mismos) descritos en el presente documento pueden administrarse localmente, por ejemplo por medio de aplicación tópica o inyección intravitreal. Por ejemplo, en algunas realizaciones, los anticuerpos anti-C5a se pueden formular para administración mediante una gota ocular. La preparación terapéutica para tratar el ojo puede contener uno o más de los anticuerpos anti-C5a en una concentración desde aproximadamente 0,01 a aproximadamente 1% por peso, preferiblemente desde aproximadamente 0,05 a aproximadamente 0,5% en una solución, suspensión o pomada farmacéuticamente aceptables. La preparación será, de forma preferible, en la forma de una solución acuosa estéril conteniendo, por ejemplo, ingredientes adicionales tales como, pero sin limitación, conservantes, tampones, agentes osmóticos, antioxidantes y estabilizadores, agentes de humectación no iónicos o agentes clarificantes, y agentes para aumentar la viscosidad.

Los conservantes adecuados para su uso en tal solución incluyen cloruro de benzalconio, cloruro de bencetonio, clorobutanol, timerosal y similares. Los tampones adecuados incluyen, por ejemplo, ácido bórico, bicarbonato de sodio y bicarbonato de potasio, borato de sodio y borato de potasio, carbonato de sodio y carbonato de potasio, acetato de sodio y bifosfato de sodio, en cantidades suficientes para mantener el pH entre aproximadamente pH 6 y pH 8, y de forma preferible, entre aproximadamente pH 7 y pH 7.5. Los agentes osmóticos adecuados son dextrano 40, dextrano 70, dextrosa, glicerina, cloruro de potasio, propilenglicol y cloruro de sodio. Los antioxidantes y estabilizadores adecuados incluyen bisulfito de sodio, metabisulfito de sodio, tiosulfito de sodio y tiourea. Los agentes de humectación y agentes clarificantes incluyen polisorbato 80, polisorbato 20, poloxámero 282 y tiloxapol. Los agentes para aumentar la viscosidad adecuados incluyen dextrano 40, dextrano 70, gelatina, glicerina, hidroxietilcelulosa, hidroximetilpropilcelulosa, lanolina, metilcelulosa, vaselina, polietilenglicol, alcohol polivinílico, polivinilpirrolidona y carboximetilcelulosa. La preparación se puede administrar al ojo del sujeto que necesita tratamiento (por ejemplo, un sujeto aquejado de DME) de forma tópica, mediante métodos convencionales, por ejemplo, la forma de gotas o mediante baño ocular en una solución terapéutica, conteniendo uno o más anticuerpos anti-C5a.

ES 2 552 954 T3   Además, una diversidad de dispositivos se desarrolló para introducir fármacos en la cavidad vítrea del ojo. Por ejemplo, la publicación de solicitud de patente de Estados Unidos nº de 20020026176 describe un tapón que contiene fármacos que se puede insertar a través de la esclerótica, de tal manera que se proyecta dentro de la cavidad vítrea para administrar el agente farmacéutico dentro de la cavidad vítrea. En otro ejemplo, la patente de Estados Unidos nº 5.443.505 describe un dispositivo que se puede implantar para la introducción dentro del espacio supracoroideo o una región avascular, para la liberación sostenida del fármaco en el interior del ojo. Las patentes de Estados Unidos nº 5.773.019 y 6.001.386 divulgan un dispositivo de administración de fármaco que se puede implantar, adherible a la superficie de la esclerótica de un ojo. El dispositivo comprende un núcleo interno que contiene una cantidad eficaz de un agente de baja solubilidad cubierto por un polímero que se puede “bioerosionar” que es permeable al agente de baja solubilidad. Durante la operación, el agente de baja solubilidad infiltra la cubierta del polímero que se puede bioerosionar, para una liberación sostenida a partir del dispositivo. Los métodos adicionales y dispositivos (por ejemplo, un parche transescleral y administración por medio de lentes de contacto) para la administración de un agente terapéutico al ojo se describen en, por ejemplo, Ambati y Adamis (2002) Prog Retin Eye Res 21(2): 145-151; Ranta y Urtti (2006) Adv Drug Delivery Rev 58(11): 1164-1181; Barocas y Balachandran (2008) Expert Opin Drug Delivery 5(1): 1-10(10); Gulsen y Chauhan (2004) Invest Opthalmol Vis Sci 45:2342-2347; Kim et al. (2007) Ophthalmic Res 39:244-254; y el documento de publicación PCT nº WO 04/073551. Los ácidos nucleicos que codifican un anticuerpo (o un fragmento de unión a antígeno del mismo) se puede incorporar en una construcción génica para usarse como parte de un protocolo de terapia génica para administrar ácidos nucleicos que pueden usarse para expresar y producir agentes dentro de las células (véase más abajo). Las construcciones de expresión de tales componentes pueden administrarse en cualquier excipiente terapéuticamente eficaz, por ejemplo, cualquier formulación o composición capaz de administrar eficazmente el componente génico a las células in vivo. Las estrategias incluyen la inserción del gen sujeto en vectores virales incluyendo retrovirus, adenovirus, virus adenoasociados, lentivirus y herpes simplex virus-1 (HSV-1) recombinantes, o plásmidos recombinantes bacterianos o eucarióticos. Los vectores virales pueden transfectar células directamente, el ADN plasmídico puede administrarse con la ayuda de, por ejemplo, liposomas catiónicos (lipofectina) o derivados (por ejemplo, conjugado de anticuerpo), conjugados de polilisina, gramicidina S, envolturas virales artificiales u otros tales transportadores intracelulares, así como inyección directa de la construcción génica o precipitación por CaPO4 (véase, por ejemplo, el documento WO04/060407) realizados in vivo. (Véase también, "Ex vivo Approaches," véase más abajo). Ejemplos de retrovirus adecuados incluyen pLJ, pZIP, pWE y pEM, que conocen aquellos expertos en la materia (véase, por ejemplo, Eglitis et al. (1985) Science 230:1395-1398; Danos y Mulligan (1988) Proc Natl Acad Sci USA 85:6460-6464; Wilson et al. (1988) Proc Natl Acad Sci USA 85:3014-3018; Armentano et al. (1990) Proc. Natl. Acad. Sci. USA 87:6141-6145; Huber et al. (1991) Proc Natl Acad Sci USA 88:8039-8043; Ferry et al. (1991) Proc Natl Acad Sci USA 88:8377-8381; Chowdhury et al. (1991) Science 254:1802-1805; van Beusechem et al.

(1992) Proc Natl Acad Sci USA 89:7640-7644; Kay et al. (1992) Human Gene Therapy 3:641-647; Dai et al. (1992) Proc Natl Acad Sci USA 89:10892-10895; Hwu et al. (1993) J Immunol. 150:4104-4115; las patentes de Estados Unidos nº 4.868.116 y 4.980.286; los documentos de publicaciones PCT nº WO89/07136, WO89/02468, WO89/05345 y WO92/07573). Otro sistema viral de entrega de genes utiliza vectores derivados de adenovirus (véase, por ejemplo, Berkner et al (1988) BioTechniques 6:616; Rosenfeld et al. (1991) Science 252:431-434; y Rosenfeld et al. (1992) Cell 68:143-155). Los vectores adenovirales adecuados derivados de la cepa de adenovirus Ad tipo 5 dl324 u otras cepas de adenovirus (por ejemplo, Ad2, Ad3, Ad7, etc.) se conocen por aquellos expertos en la materia. Otro sistema más de vector viral, útil para la administración de un gen sujeto, es el virus adenoasociado (VAA). Véase, por ejemplo, Flotte et al. (1992) Am J Respir Cell Mol Biol 7:349-356; Samulski et al. (1989) J Virol 63:3822-3828; y McLaughlin et al. (1989) J Virol 62:1963-1973.

En algunos aspectos de la divulgación, un anticuerpo, o fragmento de unión a antígeno del mismo, descrito en el presente documento, se puede formular con uno o más agentes activos adicionales útiles para el tratamiento o prevención de un trastorno asociado al complemento en un sujeto. Los agentes adicionales para el tratamiento de un trastorno asociado al complemento en un sujeto variarán dependiendo del trastorno particular a tratarse, pero puede incluir, si limitación, un antihipertensivo (por ejemplo, un inhibidor de la enzima convertidora de angiotensina), un anticoagulante, a corticoesteroide (por ejemplo, prednisona), o un agente inmunosupresor (por ejemplo, vincristina o ciclosporina A). Los ejemplos de anticoagulantes incluyen, por ejemplo, warfarina (Coumadín), heparina, fenindiona, fondaparinux, idraparinux e inhibidores de trombina (por ejemplo, argatroban, lepirrudina, bivalirrudina, o dabigatrán). Un anticuerpo o fragmento del mismo descrito en el presente documento puede formularse con un agente fibrinolítico (por ejemplo ancrod, ácido ε-aminocaproico, antiplasmina-a1, prostaciclina y defibrótido) para el tratamiento de un trastorno mediado por complemento. En algunos aspectos de la divulgación, un anticuerpo puede formularse con un agente hipolipemiante tales como un inhibidor de hidroximetilglutaril CoA reductasa. En algunos aspectos de la divulgación, un anticuerpo se puede formular con, o usarse con, un agente anti-CD20 tal como rituximab (Rituxan™; Biogen Idec, Cambridge, MA). En algunos aspectos de la divulgación, por ejemplo, para el tratamiento de RA, el anticuerpo o fragmento de unión a antígeno del mismo se puede formular con uno o ambos de infliximab (Remicade®; Ceptocor, Inc.) y metotrexato (Rheumatrex®, Trexall®). En algunos aspectos de la divulgación, un anticuerpo o un fragmento de unión a antígeno del mismo descrito en el presente documento se pueden formular con un fármaco anti-inflamatorio no esteroideo (AINE). Están disponibles muchos AINE diferentes, algunos sin receta médica incluyendo ibuprofeno (Advil ®, Motrin®, Nuprin ®) y naproxeno (Alleve®) y muchos otros están disponibles con receta médica incluyendo meloxicam (Mobic®), etodolac (Lodine®), nabumetona (Relafen®), sulindac (Clinoril®), tolementina (Tolectin®), salicilato de colina y magnesio (Trilasate®), diclofenaco (Cataflam®,

ES 2 552 954 T3   Voltaren®, Arthrotec®), Diflusinal (Dolobid®), indometicina (Indocin®), Ketoprofeno (Orudis®, Oruvail®), oxaprozina (Daypro®) y piroxicam (Feldene®). En algunos aspectos de la divulgación, un anticuerpo o un fragmento del mismo puede formularse para su uso con un antihipertensivo, un agente anticonvulsivo (por ejemplo, sulfato de magnesio), o un agente antitrombótico. Los anti hipertensivos incluyen, por ejemplo, labetalol, hidralazina, nifedipina, antagonistas del canal de calcio, nitroglicerina o nitroprusiato de sodio. Véase, por ejemplo, Mihu et al. (2007) J Gasrointestin LiverDis 16(4): 419-424. Los agentes antitrombóticos incluyen, por ejemplo, heparina, antitrombina, prostaciclina o aspirina a baja dosis. En algunos aspectos de la divulgación, un anticuerpo o fragmento de unión a antígeno del mismo se puede formular para administración a un sujeto junto con de terapia de gammaglobulina intravenosa (IVIG), plasmaféresis o intercambio de plasma. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se puede formular para su uso antes, durante, o después de un trasplante de riñón. Cuando un anticuerpo o fragmento de unión a antígeno del mismo se va a utilizar en combinación con un segundo agente activo, los agentes se pueden formular por separado o conjuntamente. Por ejemplo, las respectivas composiciones farmacéuticas pueden mezclarse, por ejemplo, justo antes de la administración, y administrarse conjuntamente o pueden administrarse por separado, por ejemplo, al mismo tiempo o a diferentes tiempos (véase más adelante).

Como se describe anteriormente, una composición puede formularse de tal forma que ésta incluya una cantidad terapéuticamente eficaz de un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento. En algunos aspectos de la divulgación, una composición puede formularse para que incluya una cantidad subterapéutica del anticuerpo (o fragmento) y una cantidad subterapéutica de uno o más agentes activos adicionales de tal forma que los componentes en total sean terapéuticamente eficaces para tratar o prevenir un trastorno asociado al complemento. En la materia se conocen métodos para determinar una dosis terapéuticamente eficaz de un agente, tal como un anticuerpo terapéutico, y se describen en el presente documento. Aplicaciones Los anticuerpos, fragmentos de unión a antígeno de los mismos, conjugados, y composiciones de cualquiera de los anteriores se pueden usar en diversas aplicaciones diagnósticas y terapéuticas. Por ejemplo, anticuerpos anti-C5a marcados de manera detectable (por ejemplo, anticuerpos anti-C5a de ser humano, o anticuerpos anti-C5a de ratón) pueden usarse en ensayos para detectar la presencia o cantidad de C5a presente en una muestra biológica. La determinación de la cantidad de C5a en una muestra, por ejemplo, una muestra de sangre de un paciente, puede ser útil para evaluar el nivel de activación del complemento en la muestra. En la materia se conocen métodos adecuados para el uso de anticuerpos en ensayos diagnósticos e incluyen, sin limitación, ELISA, aplicaciones de transferencia de energía de resonancia fluorescente, transferencia de Western, y técnicas de transferencia puntual. Véase, por ejemplo, Sambrook et al., citado anteriormente y Ausubel et al., citado anteriormente.

En algunos aspectos de la divulgación, los anticuerpos y fragmentos de unión a antígeno descritos en el presente documento pueden usarse como controles positivos en ensayos diseñados para identificar compuestos novedosos adicionales para el tratamiento de trastornos mediados por complemento. Por ejemplo, un anticuerpo anti-C5a que inhibe la actividad de C5a puede usarse como un control positivo en un ensayo para identificar compuestos adicionales (por ejemplo, moléculas pequeñas, aptámeros o anticuerpos) que inhiban C5a o la señalización del receptor de C5a dependiente de C5a. En algunos aspectos de la divulgación, los anticuerpos anti-C5a de reacción cruzada o fragmentos de unión a antígeno de los mismos (por ejemplo, de reacción cruzada con C5a de ser humano y, por ejemplo, C5a de mono cinomolgo) descritos en el presente documento, pueden usarse para pruebas preclínicas en mamíferos que no sean seres humanos, por ejemplo, estudios farmacocinéticos o farmacodinámicos en primates que no sean seres humanos. Por consiguiente, un investigador que quiera evaluar la eficacia de un anticuerpo anti-C5a en el tratamiento de un trastorno de interés asociado al complemento (por ejemplo, AR o septicemia) puede usar un anticuerpo anti-C5a de reacción cruzada descrito en el presente documento en un modelo de primate que no sea ser humano apropiado para la enfermedad. Si el investigador, por ejemplo, establece la eficacia del anticuerpo en el modelo de primate que no sea ser humano, estos resultados pueden proporcionar suficiente respaldo de prueba de hipótesis para la aprobación reguladora para el uso del anticuerpo en el tratamiento de seres humanos. Como alternativa, o además, un investigador puede administrar el anticuerpo de reacción cruzada a un primate que no sea ser humano para estudiar, por ejemplo, la eliminación de anticuerpos y/o las propiedades farmacodinámicas. Basándose en tales estudios usando el anticuerpo de reacción cruzada, el investigador puede ajustar mejor la dosis necesaria para tratar una enfermedad humana. En algunos aspectos de la divulgación, los anticuerpos anti-C5a de ratón o fragmentos de unión a antígeno de los mismos descritos en el presente documento, así como los anticuerpos que reaccionan de forma cruzada con C5a de ser humano y de ratón, pueden usarse como un anticuerpo sustituto en modelos de ratón de enfermedades de ser humano. Esto puede ser especialmente útil cuando un anticuerpo anti-C5a de ser humano humanizado no reacciona de forma cruzada con C5a de ratón y/o es probable que cause una respuesta de anticuerpos anti ser humano en un

ES 2 552 954 T3   ratón al que se administra el anticuerpo humanizado. Por consiguiente, un investigador que desea estudiar el efecto de un anticuerpo anti-C5a en el tratamiento de una enfermedad (por ejemplo, daños por isquemia y reperfusión) puede usar un anticuerpo anti-C5a de ratón descrito en el presente documento en un modelo de ratón apropiado para la enfermedad. Si el investigados puede establecer la eficacia en el modelo de ratón de la enfermedad usando el anticuerpo anti-C5a, los resultados pueden establecer prueba de hipótesis para el uso de un anticuerpo anti-C5a de ser humano en el tratamiento de enfermedad en seres humanos. Los ejemplos de trabajo divulgan un estudio ejemplar usando un anticuerpo anti-C5a de ratón sustituto en un modelo de ratón de AR estableciendo prueba de hipótesis para el uso de un anticuerpo anti-C5a de ser humano para tratar la AR en ser humano.

Los anticuerpos anti-C5a descritos en el presente documento pueden usarse en métodos para purificar C5a de una muestra (por ejemplo, una muestra biológica). En algunos aspectos de la divulgación, un anticuerpo anti-C5a se puede inmovilizar en un soporte de fase sólida usando métodos bien conocidos en la materia. Una muestra que contiene el antígeno a purificar, en este caso C5a, se pone en contacto con el anticuerpo en el soporte sólido en condiciones y durante un tiempo suficiente para permitir la unión del antígeno al anticuerpo. Después, el soporte sólido se lava una o más veces con un tampón adecuado para eliminar el material no unido. Después, el soporte sólido puede ponerse en contacto con un segundo tampón producto de la liberación del antígeno del anticuerpo. Después se recoge el antígeno liberado y se caracteriza (por ejemplo, por pureza y actividad) usando métodos bien conocidos en la materia.

Los anticuerpos anti-C5a y fragmentos de unión a antígeno de los mismos descritos en el presente documento pueden también usarse en métodos terapéuticos como se explica más adelante. Métodos de tratamiento Las composiciones descritas anteriormente son útiles, entre otras cosas, en métodos para el tratamiento o prevención de una diversidad de trastornos asociados con el complemento en un sujeto. Las composiciones pueden administrarse a un sujeto, por ejemplo, a un sujeto que sea ser humano, usando una diversidad de métodos que dependen, en parte, de la vía de administración. La vía puede ser, por ejemplo, inyección o infusión intravenosa (IV) inyección subcutánea (SC), inyección intraperitoneal (IP), o inyección intramuscular (IM).

La administración puede realizarse, por ejemplo, por infusión local, inyección, o por medio de un implante. El implante puede ser de un material gelatinoso, no poroso, o poroso, incluyendo membranas, tales como membranas sialásticas, o fibras. El implante se puede configurar para liberación sostenida o periódica de la composición en el sujeto. Véase, por ejemplo, la solicitud de patente de Estados Unidos publicación nº 20080241223; las patentes de Estados Unidos nº 5.501.856; 4.863.457; y 3.710.795; EP488401; y EP 430539. La composición se puede administrar al sujeto por medio de un dispositivo implantable basado, por ejemplo, en sistemas difusivos, erosionables, o convectivos, por ejemplo, bombas osmóticas, implantes biodegradables, sistemas de electrodifusión, sistemas de electroósmosis, bombas de presión de vapor, bombas electrolíticas, bombas efervescentes, bombas piezoeléctricas, sistemas basados en erosión, o sistemas electromecánicos.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se administra terapéuticamente a un sujeto por medio de administración local. Como se usa en el presente documento, “administración local” o “liberación local”, se refiere a un liberación que no se basa en el transporte de la composición o agente a su tejido o sitio diana previstos a través del sistema vascular. Por ejemplo, la composición puede liberarse por inyección o implantación de la composición o agente o por inyección o implantación de un dispositivo que contenga la composición o agente. Tras la administración local en las proximidades de un tejido o sitio diana, la composición o agente, o uno o más componentes del mismo, puede difundirse al tejido o sitio diana previsto.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo puede administrarse por vía local a una articulación (por ejemplo, a una articulación articulada). Por ejemplo, en realizaciones en las que el trastorno asociado al complemento sea artritis, el inhibidor del complemento se puede administrar directamente a una articulación (por ejemplo, dentro de un espacio articular) o cerca una articulación. Ejemplos de articulaciones intraarticulares a las cuales un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo puede administrarse por vía local incluyen, por ejemplo, la cadera, la rodilla, el codo, la muñeca, la articulación esternoclavicular, la articulación temporomandibular, la articulación carpiana, la articulación tarsal, el tobillo, y cualquier otra articulación sujeta a afecciones artríticas. Un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo puede también administrarse a bursas tales como, por ejemplo, la bursa acromial, bicipitorradial, cubitorradial, deltoide, infrarrotuliana, isquial, y cualquier otra bursa conocida en el campo de la medicina.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo puede administrarse localmente al ojo. Según se usa en el presente documento, el término “ojo” se refiere a cualquiera y a todos los tejidos anatómicos y estructuras asociadas con el ojo. El ojo tiene una pared compuesta de tres capas diferentes: la esclerótica externa, la capa coroidea media, y la retina interna. La cámara detrás del cristalino está cargada con un fluido gelatinoso que recibe el nombre de humor vítreo. En el fondo del ojo está la retina, la cual detecta luz. La córnea es un tejido ópticamente transparente, que transmite las imágenes al fondo del ojo. La córnea

ES 2 552 954 T3   incluye una ruta para la penetración de fármacos en el ojo. Otras estructuras tisulares anatómicas asociadas con el ojo incluyen el sistema de drenaje lagrimal, que incluye un sistema secretor, un sistema distributivo y un sistema excretor. El sistema secretor comprende secretores que se estimulan por el parpadeo y por la carga de temperatura debido a la evaporación de las lágrimas y por secretores reflejos que tienen un aporte nervioso parasimpático eferente y secreta lágrimas en respuesta a estimulación física o emocional. El sistema distributivo incluye los párpados y el menisco lagrimal alrededor de los bordes de los párpados de un ojo abierto, que propaga lágrimas sobre la superficie ocular por parpadeo, reduciendo de este modo el desarrollo de áreas secas. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se administra a la cámara posterior del ojo. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se administra de forma intravitreal. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se administra de forma transescleral. En algunos aspectos de la divulgación, por ejemplo, en aspectos para tratamiento o prevención de un trastorno pulmonar asociado al complemento tal como EPOC o asma, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede administrarse a un sujeto por medio de los pulmones. La administración pulmonar de un fármaco puede realizarse por inhalación, y la administración por inhalación en el presente documento puede ser oral y/o nasal. Los ejemplos de dispositivos farmacéuticos para la administración pulmonar incluyen inhaladores de dosis medida, inhaladores en polvo seco (IPS) y nebulizadores. Por ejemplo, un anticuerpo anti-C5a o un fragmento de unión a antígeno del mismo se puede administrar a los pulmones de un sujeto por medio de un inhalador de polvo seco. Estos inhaladores son dispositivos libres de propulsores que administran las formulaciones de polvo seco dispersables y estables a los pulmones. Los inhaladores de polvo seco se conocen bien en la materia de medicina e incluyen, pero sin limitación: el TurboHaler® (AstraZeneca; Londres, Inglaterra) el inhalador AIR® (Alkermes®; Cambridge, Massachusetts); Rotahaler® (GlaxoSmithKline; Londres, Inglaterra); y Eclipse™ (Sanofi-Aventis; Paris, Francia). Véanse también, por ejemplo, las publicaciones PCT nº WO 04/026380, WO 04/024156, y WO 01/78693. Los dispositivos IPS se usan para administración pulmonar de polipéptidos tales como insulina y hormona del crecimiento. En algún aspecto de la divulgación, un anticuerpo anti- C5a o fragmento de unión a antígeno del mismo puede administrarse de forma intrapulmonar por medio de un inhalador de dosis medida. Estos inhaladores se basan en un propulsor para administrar una dosis distinta de un compuesto a los pulmones. Los ejemplos de compuestos administrados por medio de inhaladores de dosis medida incluyen, por ejemplo, Astovent® (Boehringer-Ingelheim; Ridgefield, Connecticut) y Flovent® (GlaxoSmithKline). Véanse también, por ejemplo, las patentes de Estados Unidos nº 6.170.717; 5.447.150; y 6.095.141. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo puede administrarse a los pulmones de un sujeto por medio de un nebulizador. Los nebulizadores usan aire comprimido para administrar un compuesto como un aerosol licuado o atomización. Un nebulizador puede ser, por ejemplo, un nebulizador de chorro (por ejemplo, nebulizadores de chorro de aire o de chorro líquido) o un nebulizador ultrasónico. Los dispositivos adicionales y los métodos de administración intrapulmonar se indican, por ejemplo, en la solicitud de patente de Estados Unidos publicación nº 20050271660 y 20090110679.

En algunos aspectos de la divulgación, los anticuerpos o fragmentos de unión a antígeno de los mismos proporcionados en el presente documento están presentes en forma de dosificación unitaria, que pueden ser particularmente adecuadas para la autoadministración. Un producto formulado de la presente divulgación puede incluirse dentro de un envase, típicamente, por ejemplo, un vial, cartucho, jeringa precargada o pluma desechable.

También puede usarse un dosificador, tal como el dispositivo dosificador descrito en la patente de Estados Unidos nº 6.302.855, por ejemplo, con un sistema de inyección de la presente divulgación. Un sistema de inyección de la presente divulgación puede emplear una pluma de administración como se describe en la patente de Estados Unidos nº 5.308.341. Los dispositivos de pluma, más comúnmente utilizados para la autoadministración de insulina en pacientes con diabetes, se conocen bien en la materia. Dichos dispositivos pueden comprender al menos una aguja de inyección (por ejemplo, una aguja de calibre 31 de aproximadamente 5 a 8 mm de longitud), típicamente precargados con una o más dosis de unidades terapéuticas de una solución terapéutica, y son útiles para administrar rápidamente la solución a un sujeto con el menor dolor posible.

Una pluma de administración de medicación incluye un portavial dentro del cual puede incluirse un vial de insulina u otra medicación. El portavial es una estructura tubular generalmente alargada con un extremo proximal y uno distal. El extremo distal del portavial incluye medios de montaje para conectar una cánula de aguja de dos extremos. El extremo proximal también incluye medios de montaje para conectar el cuerpo de una pluma que incluye un controlador y un aparato de ajuste de dosis. Un vial desechable que contiene medicación (por ejemplo, una solución de alta concentración de un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo) para su uso con el portavial de la técnica anterior, incluye un extremo distal que tiene un tabique elastomérico perforable que se puede perforar en un extremo de una cánula de aguja de dos extremos. El extremo proximal de este vial incluye un tapón deslizable dispuesto en conexión hermética a fluidos con la pared cilíndrica del vial. Esta pluma de administración de medicación se usa mediante la inserción del vial de medicación dentro del portavial. Un cuerpo de pluma se conecta después al extremo proximal del portavial. El cuerpo de pluma incluye un aparato de ajuste de dosis para indicar una dosis de medicación que se administra por medio de la pluma y un aparato controlador para impulsar el tapón del

ES 2 552 954 T3   vial distalmente por una distancia correspondiente a la dosis elegida. El usuario de la pluma monta una cánula de aguja de dos extremos al extremo distal del portavial de tal manera que el punto proximal de la cánula de aguja perfora el tabique del vial. El paciente selecciona después una dosis y acciona la pluma para impulsar el tapón distalmente para administrar la dosis elegida. El aparato de selección de dosis vuelve a cero después de la inyección de la dosis seleccionada. Después, el paciente elimina y desecha la cánula de aguja, y mantiene la pluma de administración de medicación en un lugar conveniente para la siguiente administración de medicación necesaria. La medicación en el vial se agotará después de varias de dichas administraciones de medicación. El paciente después separa el portavial del cuerpo de la pluma. Después, el vial vacío puede eliminarse y desecharse. Un vial nuevo puede insertarse dentro del portavial, y el portavial y el cuerpo de pluma pueden reensamblarse y usarse como acaba de explicarse. Por consiguiente, una pluma de administración de medicación generalmente tiene un mecanismo de control para una dosificación precisa y una facilidad de uso. Un mecanismo de dosificación tal como una manija giratoria permite al usuario ajustar de forma precisa la cantidad de medicación que será inyectada por la pluma a partir de un vial de medicación preempaquetado. Para inyectar la dosis de medicación, el usuario inserta la aguja bajo la piel y presiona la manija una vez, hasta que se hunda. La pluma puede ser un dispositivo enteramente mecánico o puede combinarse con un circuito electrónico para ajustar precisamente, y/o indicar, la dosificación de la medicación que se inyecta en el usuario. Véase la patente de Estados Unidos nº 6.192.891.

En algunos aspectos de la divulgación, la aguja del dispositivo de pluma es desechable y los kits incluyen una o más agujas de reemplazo desechables. Los dispositivos de pluma adecuados para la administración de cualquiera de los anticuerpos que se presentan ahora, o fragmentos de unión a antígeno de los mismos, también se describen en, por ejemplo, las patentes de Estados Unidos nº 6.277.099; 6.200.296; y 6.146.361.

Un dispositivo de pluma basado en micro aguja se describe en, por ejemplo, la patente de Estados Unidos nº 7.556.615. Véase también el dispositivo Precision Pen Injector (PPI), Molly™, fabricado por Scandinavian Health Ltd.

La presente divulgación también presenta formulaciones de liberación controlada o liberación extendida adecuadas para la administración crónica o la autoadministración de una medicación tal como un anticuerpo anti-C5a o un fragmento de antígeno del mismo descrito en el presente documento. Las diversas formulaciones se pueden administrar a un paciente que necesite tratamiento con la medicación, como un bolo o por infusión continua a lo largo de un período de tiempo.

En algunos aspectos de la divulgación, una concentración alta de anticuerpo anti-C5a (o fragmento de unión a antígeno del mismo) descrito en el presente documento se formula para administración de liberación sostenida, de liberación prolongada, de liberación gradual, de liberación de controlada o de liberación continua. En algunos aspectos de la divulgación se usan formulaciones de liberación prolongada para administrar el anticuerpo al sujeto en necesidad del mismo. En este método, el anticuerpo se formula con uno o más excipientes que proporcionan una liberación gradual del agente activo a lo largo de un período de un número de horas o días. Dichas formulaciones a menudo se basan en una matriz de degradación que dispersa gradualmente el agente activo que se quiere liberar. En algunos aspectos de la divulgación, un fragmento de unión a C5a (por ejemplo, un anticuerpo de cadena simple, un diacuerpo, o un fragmento Fab') de un anticuerpo anti-C5a descrito en el presente documento se administra por medio de administración intrapulmonar a un sujeto en necesidad del mismo. Por ejemplo, una forma de anticuerpo de cadena simple de cualquiera de los anticuerpos anti-C5a descritos en el presente documento pueden administrarse por medio de un nebulizador o un inhalador a un sujeto (por ejemplo, un ser humano) aquejado con un trastorno pulmonar asociado al complemento tal como asma o EPOC.

Una dosis adecuada de un anticuerpo o fragmento del mismo descrito en el presente documento, cuya dosis es capaz de tratar o prevenir en un sujeto, un trastorno asociado al complemento, puede depender en una diversidad de factores incluyendo, por ejemplo, la edad, el sexo, y el peso de un sujeto a ser tratado y del compuesto inhibidor particular utilizado. Por ejemplo, puede requerirse una dosis diferente de un anticuerpo anti-C5a completo para tratar a un sujeto con AR en comparación con la dosis de un fragmento de anticuerpo Fab' de unión a C5a necesaria para tratar al mismo sujeto. Otros factores que afectan la dosis que se administra a un sujeto incluyen, por ejemplo, el tipo o severidad del trastorno asociado al complemento. Por ejemplo, un sujeto que tiene AR puede necesitar la administración de una dosificación de un anticuerpo anti-C5a diferente a la de un sujeto con DME. Otros factores pueden incluir, por ejemplo, otros trastornos médicos concurrentes o que afectaban previamente al sujeto, la salud general del sujeto, la disposición genética del sujeto, la dieta, el tiempo de administración, la tasa de excreción, la combinación de fármacos, y cualquier otra terapia adicional que se administre al sujeto. Debe entenderse también que una dosificación específica y una pauta de tratamiento para cualquier sujeto particular, dependerá también del juicio del facultativo médico que lo trata (por ejemplo, médico o enfermera).

Un anticuerpo descrito en el presente documento se puede administrar, como una dosis fija, en una dosis de miligramo por kilogramo (mg/kg). En algunos aspectos de la divulgación, la dosis puede también elegirse para

ES 2 552 954 T3   reducir o evitar la producción de anticuerpos u otras respuestas inmunitarias del hospedador contra uno o más de los anticuerpos activos en la composición. Mientras que en ninguna forma pretende ser limitante, las dosificaciones ejemplares de un anticuerpo, tales como un anticuerpo anti-C5a incluyen, por ejemplo, 1-1.000 µg/kg, 1-100 µg/kg, 0,5-50 µg/kg, 0,1-100 µg/kg, 0,5-25 µg/kg, 1-20 µg/kg, y 1-10 µg/kg, 1-100 mg/kg, 0,5-50 mg/kg, 0,1-100 mg/kg, 0,5- 25 mg/kg, 1-20 mg/kg, 0,100 mg/kg a 1 mg/kg, y 1-10 mg/kg. Las dosis ejemplares de un anticuerpo o fragmento de unión a antígeno del mismo descrito en el presente documento incluyen, sin limitación, 0,1 µg/kg, 0,5 µg/kg, 1,0 µg/kg, 2,0 µg/kg, 4 µg/kg, y 8 µg/kg, 0,1 mg/kg, 0,5 mg/kg, 1,0 mg/kg, 2,0 mg/kg, 4 mg/kg, 8 mg/kg, y 20 mg/kg. Una composición farmacéutica puede incluir una cantidad terapéuticamente eficaz de un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento. Dichas cantidades eficaces pueden determinarse fácilmente por alguien con las habilidades habituales en la materia basándose, en parte, en el efecto del anticuerpo administrado, o en el efecto combinatorio del anticuerpo y uno o más agentes activos adicionales, si se usa más de un agente. Una cantidad terapéuticamente eficaz de un anticuerpo o fragmento del mismo descrito en el presente documento puede también variar de acuerdo a factores tales como el estado de la enfermedad, la edad, el sexo, el peso del individuo, y la capacidad del anticuerpo (y uno o más agentes activos adicionales) para provocar una respuesta deseada en el individuo, por ejemplo, la mejora en al menos un parámetro de la afección, por ejemplo, la mejora en al menos un síntoma del trastorno mediado por el complemento. Por ejemplo, una cantidad terapéuticamente eficaz de un anticuerpo anti-C5a puede inhibir (disminuir la severidad de o eliminar la aparición de) y/o prevenir un trastorno en particular, y/o cualquiera de los síntomas del trastorno particular conocido en la técnica o descrito en el presente documento. Una cantidad terapéuticamente eficaz es también una en la que cualquiera de los efectos tóxicos o perjudiciales de la composición se compensa por los efectos terapéuticamente beneficiosos. Las dosis adecuadas para ser humano de cualquiera de los anticuerpos o fragmentos de los mismos descritos en el presente documento pueden evaluarse adicionalmente, por ejemplo, en estudios de escalado de dosis de Fase I.

Véase, por ejemplo, van Gurp et al. (2008) Am J Transplantation 8(8):1711-1718; Hanouska et al. (2007) Clin Cancer Res 13(2, parte 1):523-531; y Hetherington et al. (2006) Antimicrobial Agents and Chemotherapy 50(10): 3499-3500. Las expresiones “cantidad terapéuticamente eficaz” o “dosis terapéuticamente eficaz”, o expresiones similares usadas en el presente documento pretenden significar una cantidad de un agente (por ejemplo, un anticuerpo anti- C5a o un fragmento de unión a antígeno del mismo) que provocará la respuesta biológica o médica deseada (por ejemplo, una mejora en uno o más síntomas de un trastorno asociado al complemento). En algunos aspectos de la divulgación, una composición descrita en el presente documento contiene una cantidad terapéuticamente eficaz de un anticuerpo, o fragmento de unión a antígeno del mismo, que específicamente se une a un neoepítopo presente en C5a. En aspectos de la divulgación, la composición contiene cualquiera de los anticuerpos o fragmentos de unión a antígeno de los mismos descritos en el presente documento, y uno o más (por ejemplo, dos, tres, cuatro, cinco, seis, siete, ocho, nueve, 10 u 11 o más) agentes terapéuticos adicionales de manera que la composición en su conjunto sea terapéuticamente eficaz. Por ejemplo, una composición puede contener un anticuerpo anti-C5a descrito en el presente documento y un agente inmunosupresor, en la que el anticuerpo y el agente están cada uno a una concentración que cuando se combinan son terapéuticamente eficaces para tratar o prevenir un trastorno asociado al complemento (por ejemplo, un trastorno inflamatorio asociado al complemento tal como EPOC, asma, septicemia, o AR) en un sujeto. La toxicidad y la eficacia terapéutica de tales composiciones se pueden determinar por procedimientos farmacéuticos conocidos, en cultivos celulares o animales de experimentación (por ejemplo, modelos animales de cualquiera de los trastornos mediados por el complemento descritos en el presente documento). El uso de un anticuerpo anti-C5a en un modelo animal de AR se ejemplifica en los ejemplos de trabajo. Estos procedimientos pueden usarse, por ejemplo, para determinar la DL50 (la dosis letal para el 50% de la población) y la DE50 (la dosis terapéuticamente eficaz en el 50% de la población). La relación de dosis entre el efecto tóxico y el efecto terapéutico es el índice terapéutico y se puede expresar como el cociente de DL50/DE50. Un anticuerpo o fragmento de unión a antígeno del mismo que muestra un índice terapéutico alto es preferente. Aunque se pueden usar composiciones que presenten efectos secundarios tóxicos, debería tenerse cuidado para diseñar un sistema de administración que dirija tales compuestos al sitio del tejido afectado y en minimizar el daño potencial a las células normales y, de esta manera, reducir los efectos secundarios.

Los datos obtenidos a partir de los ensayos de cultivo celular y estudios en animales pueden usarse en la formulación de un intervalo de dosificación para uso en seres humanos. La dosificación de tales anticuerpos o fragmentos de unión a antígeno de los mismos se sitúa generalmente dentro de un intervalo de concentraciones circulantes de los anticuerpos, o fragmentos, que incluyen la DE50 con poca o ninguna toxicidad. La dosificación puede variar dentro de este intervalo dependiendo de la forma de dosificación empleada y la vía de administración utilizada. Para un anticuerpo anti-C5a descrito en el presente documento, la dosis terapéuticamente eficaz se puede estimar inicialmente a partir de ensayos de cultivos celulares. Una dosis puede formularse en modelos animales para conseguir un intervalo de concentración plasmática circulante que incluya la CI50 (es decir, la concentración del anticuerpo que consigue la mitad de la inhibición máxima de los síntomas) según se determine en cultivo celular. Dicha información se puede usar para determinar más precisamente las dosis útiles en seres humanos. Los niveles plasmáticos pueden medirse, por ejemplo, por cromatografía líquida de alto rendimiento. En algunos aspectos de la divulgación por ejemplo, donde se desea administración local (por ejemplo, en el ojo o en una articulación), se

ES 2 552 954 T3   pueden usar cultivo celular o modelos animales para determinar una dosis necesaria para conseguir unas concentraciones terapéuticamente eficaces dentro del sitio local. En algunos aspectos de la divulgación, los métodos se pueden realizar junto con otras terapias para trastornos asociados al complemento. Por ejemplo, la composición se puede administrar a un sujeto al mismo tiempo que, antes de, o después de, plasmaféresis, terapia IGIV, o intercambio de plasma. Véase, por ejemplo, Appel et al. (2005) J Am Soc Nephrol 16:1392-1404. En algunos aspectos de la divulgación, la composición se puede administrar a un sujeto al mismo tiempo que, antes de, o después de, un trasplante de riñón.

Un “sujeto”, según se usa en el presente documento, puede ser cualquier mamífero. Por ejemplo, un sujeto puede ser un ser humano, un primate que no es un ser humano (por ejemplo, mono, babuino, o chimpancés), un caballo, una vaca, un cerdo, una oveja, una cabra, un perro, un gato, un conejo, una cobaya, un jerbo, un hámster, una rata, o un ratón. En algunas realizaciones, el sujeto es un infante (por ejemplo, un infante ser humano).

Según se usa en el presente documento, un sujeto “en necesidad de prevención”, “en necesidad de tratamiento” o “en necesidad del mismo” se refiere a un sujeto, quien por el juicio de un facultativo médico apropiado (por ejemplo, un médico, una enfermera, o un facultativo de enfermería en el caso de seres humanos; un veterinario en el caso de mamíferos que no sean seres humanos), se beneficiaría de forma razonable de un tratamiento dado (tal como el tratamiento con una composición comprendiendo un anticuerpo anti-C5a).

El término “prevención” se reconoce en la técnica, y cuando se usa en relación a una afección, se entiende bien en la técnica, e incluye la administración de una composición que reduce la frecuencia de, o retrasa la aparición de, los síntomas de una afección médica en un sujeto en relación a un sujeto que no recibe la composición. Así, la prevención de un trastorno asociado al complemento tal como asma incluye, por ejemplo, reducir el grado o frecuencia de la tos, jadeo, o dolor de pecho en una población de pacientes que reciben un tratamiento profiláctico, con respecto a una población de control no tratada, y/o el retraso de la aparición de tos o jadeo en una población tratada contra una población de control no tratada, por ejemplo, por una cantidad estadísticamente y/o clínicamente significativa.

Como se describe más arriba, los anticuerpos y fragmentos biológicamente activos descritos en el presente documento pueden usarse para tratar una diversidad de trastornos asociados al complemento tales como, pero sin limitación: artritis reumatoide (AR); nefritis lúpica; daños por isquemia y reperfusión; síndrome urémico hemolítico atípico (SUHa); síndrome urémico hemolítico típico o infeccioso (SUHt); enfermedad del depósito denso (EDD); hemoglobinuria nocturna paroxística (HNP); esclerosis múltiple (EM); degeneración macular (por ejemplo, degeneración macular relacionada con la edad (DME)); síndrome de hemólisis, enzimas hepáticas elevadas, y el síndrome de recuento de plaquetas bajo (HELLP acrónimo de: hemolytic anemia, elevated liver enzymes and low platelet count); septicemia; dermatomiositis; retinopatía diabética; púrpura trombótica trombocitopénica (PTT); pérdida fetal espontánea; vasculitis Pauciimmune; epidermolisis ampollosa; pérdida fetal recurrente; esclerosis múltiple (EM); y daño cerebral traumático. Véase, por ejemplo, Holers (2008) Immunological Reviews 223:300-316 y Holers y Thurman (2004) Molecular Immunology 41:147-152. En algunos aspectos de la divulgación, el trastorno mediado por el complemento es un trastorno vascular mediado por el complemento tal como, pero sin limitación, un trastorno cardiovascular, miocarditis, un trastorno cerebrovascular, un trastorno vascular periférico (por ejemplo, musculoesquelético), un trastorno renovascular, un trastorno vascular mesentérico/entérico, revascularización de trasplantes y/o reimplantes, vasculitis, nefritis púrpura de Henoch-Schönlein, vasculitis asociada a lupus eritematoso sistémico, vasculitis asociada con artritis reumatoide, vasculitis de complejo inmunitario, enfermedad de Takayasu, síndrome de extravasación capilar, cardiomiopatía dilatada, angiopatía diabética, aneurisma aórtico torácico abdominal, enfermedad de Kawasaki (arteritis), embolia gaseosa venosa (EGV) y restenosis siguiendo colocación de estent, aterectomía rotacional, y angioplastia coronaria transluminal percutánea (ACTP). (Véase, por ejemplo, la publicación de solicitud de la patente de Estados Unidos nº 20070172483). En algunas realizaciones, el trastorno asociado al complemento es miastenia gravis, enfermedad de aglutininas frías (EAF), hemoglobinuria paroxística por frío (HPF) dermatomiositis, esclerodermia, anemia hemolítica autoinmunitaria tipo caliente, enfermedad de Graves, tiroiditis de Hashimoto, diabetes tipo I, psoriasis, pénfigo, anemia hemolítica autoinmunitaria (AHAI), púrpura trombocitopénica idiopática (PTI), síndrome de Goodpasture, síndrome antifosfolípido (SAF), enfermedad de Degos, y SAF catastrófico (SAFC).

En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento, solo, en combinación con un segundo agente antiinflamatorio, puede usarse para tratar un trastorno inflamatorio tal como, pero sin limitación, AR (arriba), enfermedad intestinal inflamatoria, septicemia (arriba), shock septicémico, daño de pulmón agudo, coagulación intravascular diseminada (CID) o enfermedad de Crohn. En algunos aspectos de la divulgación, el segundo agente antiinflamatorio puede ser uno seleccionado de un grupo consistiendo de AINE, corticoesteroides, metotrexato, hidroxicloroquina, agentes anti TNF tales como etanercept e infliximab, un agente reductor de células B tal como rituximab, un antagonista de interleucina 1, o un agente bloqueante coestimulatorio de células T tal como abatacept.

ES 2 552 954 T3   En algunos aspectos de la divulgación, el trastorno asociado al complemento es un trastorno neurológico asociado al complemento tal como, pero sin limitación, esclerosis lateral amiotrófica (ELA), daño cerebral, enfermedad de Alzheimer, y neuropatía desmielinizante inflamatoria crónica.

Los trastornos asociados al complemento también incluyen trastornos pulmonares asociados al complemento tales como, pero sin limitación, asma, bronquitis, enfermedad pulmonar obstructiva crónica (EPOC), una enfermedad pulmonar intersticial, deficiencia antitripsina α-1, enfisema, bronquiectasias, bronquiolitis obliterante, alveolitis, sarcoidosis, fibrosis pulmonar, y trastornos vasculares del colágeno.

En el caso de trastornos hemolíticos asociados al complemento tales como HNP, EAF, y HPF, un facultativo médico apreciará que el fragmento C5b de C5 (por medio del complejo del complemento terminal) contribuye de forma significativa a la patogénesis de estos trastornos. Véase, por ejemplo, Kaplan (2002) Curr Opin Investig Drugs 3(7):1017-23; Hill (2005) Clin Adv Hematol Oncol 3(11):849-50; y Rother et al. (2007) Nature Biotechnology 25(11):1256-1488. Por consiguiente, un facultativo médico puede elegir administrar uno o más de los anticuerpos anti-C5a descritos en el presente documento, junto con una o más terapias adicionales para el trastorno hemolítico tal como un inhibidor del complemento que impide la formación del complejo del complemento terminal C5b-9. En algunos aspectos de los métodos descritos en el presente documento, el trastorno asociado al complemento no es un trastorno hemolítico asociado al complemento. En algunos aspectos de la divulgación, un anticuerpo anti-C5a o un fragmento de unión a antígeno del mismo se administra a un sujeto para tratar, prevenir o mejorar al menos un síntoma de una respuesta inflamatoria asociada el complemento (por ejemplo, el aspecto de la respuesta inflamatoria asociada al complemento de un trastorno asociado al complemento) en un sujeto. Por ejemplo, un anticuerpo anti-C5a descrito en el presente documento puede usarse para tratar, prevenir y/o mejorar uno o más síntomas asociados con una respuesta inflamatoria asociada a complemento tales como rechazo de injerto/enfermedad de injerto contra hospedador (EICH), daños por reperfusión (por ejemplo, después de una derivación cardiopulmonar o un trasplante tisular), y daño tisular después de otras formas de lesión traumática tales como una quemadura (por ejemplo, una quemadura severa), trauma contundente, lesión espinal, o congelación. Véase, por ejemplo, Park et al. (1999) Anesth Analg 99(1):42-48; Tofukuji et al. (1998) J Thorac Cardiovasc Surg 116(6):1060-1068; Schmid et al. (1997) Shock 8(2):119-124; y Bless et al. (1999) Am J Physiol 276(1):L57-L63.

En algunos aspectos de la divulgación, un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento puede administrarse a un sujeto como una monoterapia. Alternativamente, como se describe más arriba, el anticuerpo o fragmento del mismo puede administrarse a un sujeto como una terapia de combinación con otro tratamiento, por ejemplo, otro tratamiento para un trastorno asociado al complemento o una respuesta inflamatoria asociada al complemento. Por ejemplo, la terapia de combinación puede incluir administrar al sujeto (por ejemplo, un paciente ser humano) uno o más agentes adicionales (por ejemplo, anticoagulantes, antihipertensivos, o fármacos antiinflamatorios (por ejemplo, esteroides)) que proporcionen un beneficio terapéutico a un sujeto que tenga o esté en riesgo de desarrollar, septicemia. En otro ejemplo, la terapia de combinación puede incluir administrar al sujeto uno o más agentes adicionales (por ejemplo, un anticuerpo anti-IgE, un anticuerpo anti- IL-4, un anticuerpo anti-IL-5, o un antihistamínico) que proporcione beneficio terapéutico a un sujeto que tenga, o esté en riesgo de desarrollar, o se sospecha que tiene un trastorno pulmonar asociado al complemento tal como EPOC o asma. En algunos aspectos de la divulgación, un anticuerpo anti-C5a y uno o más de los agentes activos adicionales se administran al mismo tiempo. En otros aspectos de la divulgación, el anticuerpo anti-C5a se administra primero en el tiempo y uno o más de los agentes activos adicionales se administran segundos en el tiempo. En algunos aspectos de la divulgación, uno o más de los agentes activos adicionales se administran primeros en el tiempo y el anticuerpo anti-C5a se administra segundo en el tiempo. Un anticuerpo anti-C5a o un fragmento de unión a antígeno del mismo descrito en el presente documento puede reemplazar o aumentar una terapia que se administra previamente o actualmente. Por ejemplo, después de tratar con un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo, la administración de uno o más de los agentes activos adicionales, puede cesar o disminuir, por ejemplo, administrase a niveles más bajos. En algunos aspectos de la divulgación, la administración de la terapia previa puede mantenerse. En algunos aspectos de la divulgación, una terapia previa será mantenida hasta que el nivel del anticuerpo anti-C5a alcance un nivel suficiente para proporcionar un efecto terapéutico. Las dos terapias pueden administrarse en combinación.

Monitorizar la mejora en un sujeto (por ejemplo, un paciente que es ser humano) de un trastorno asociado al complemento (por ejemplo, septicemia, quemadura severa, AR, nefritis lúpica, síndrome de Goodpasture, o asma), según se define en el presente documento, significa evaluar un cambio en un parámetro de una enfermedad en el sujeto, por ejemplo, una mejora en uno o más síntomas de un trastorno dado. Los síntomas de los trastornos asociados al complemento se conocen bien en la técnica de medicina. En algunos aspectos de la divulgación, la evaluación se realiza al menos una (1) hora, por ejemplo, al menos 2, 4, 6, 8, 12, 24, o 48 horas, o al menos 1 día, 2 días, 4 días, 10 días, 13 días, 20 días o más, o al menos 1 semana, 2 semanas, 4 semanas, 10 semanas, 13 semanas, 20 semanas o más, después de una administración. Se puede evaluar al sujeto en uno o más de los siguientes periodos: antes del inicio del tratamiento; durante el tratamiento; o después de que se administraron uno o más elementos del tratamiento. La evaluación puede incluir evaluar la necesidad de tratamiento adicional, por ejemplo, evaluar si una dosificación, la frecuencia de administración, o la duración del tratamiento deberían alterarse. Esto puede incluir también evaluar la necesidad de añadir o abandonar una modalidad terapéutica elegida,

ES 2 552 954 T3   por ejemplo, añadir o abandonar cualquiera de los tratamientos de un trastorno asociado al complemento descrito en el presente documento. Kits terapéuticos y de diagnóstico La divulgación también presenta kits terapéuticos y de diagnóstico que contienen, entre otras cosas, uno o más de los anticuerpos anti-C5a, y/o fragmentos de unión a antígeno de los mismos, descritos en el presente documento. Los kits terapéuticos pueden contener, por ejemplo, un medio adecuado para la administración del anticuerpo, o fragmento de unión a antígeno, a un sujeto. En algunos aspectos de la divulgación, el medio es adecuado para la administración subcutánea del anticuerpo o fragmento de unión a antígeno del mismo a un sujeto. El medio puede ser, por ejemplo, una jeringa o una bomba osmótica. Es decir, un kit terapéutico descrito en el presente documento puede contener una jeringa precargada con un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo (por ejemplo, un dispositivo de pluma conteniendo el anticuerpo o fragmento) descrito en el presente documento, o el kit puede contener una bomba (por ejemplo, una bomba osmótica) y uno o más módulos desechables configurados para su uso con la bomba, los módulos precargados con un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento (por ejemplo, precargados con una solución acuosa conteniendo el anticuerpo anti-C5a o fragmento de unión a antígeno del mismo). En otro ejemplo, el kit puede contener un dispositivo de administración transescleral o implantable (por ejemplo, un tapón) que esté precargado con (o contiene de otro modo) una solución que contenga un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento.

En algunos aspectos de la divulgación, el medio para administrar un anticuerpo anti-C5a, o fragmento de unión a antígeno del mismo, es un dispositivo de pluma para la administración de fármacos. En algunos aspectos de la divulgación, el medio es adecuado para la administración intrapulmonar del anticuerpo, o fragmento de unión a antígeno del mismo, a un sujeto, por ejemplo, para uso en el tratamiento o prevención de un trastorno pulmonar asociado al complemento tal como, pero sin limitación, EPOC o asma. Por consiguiente, el medio puede ser, por ejemplo, un inhalador oral o nasal (véase más arriba). El inhalador puede ser, por ejemplo, un inhalador de dosis medida (IDM), un inhalador de polvo seco (IPS), o un nebulizador. Dicho kit también puede, de forma opcional, incluir instrucciones para la administración (por ejemplo, la autoadministración de) el anticuerpo anti- C5a o fragmento de unión a antígeno del mismo a un sujeto. Los kits terapéuticos pueden incluir, por ejemplo, uno o más agentes activos adicionales para el tratamiento o prevención de un trastorno asociado al complemento y/o la mejora de un síntoma del mismo. Por ejemplo, los kits terapéuticos diseñados para uso en el tratamiento o prevención de un trastorno pulmonar asociado al complemento pueden incluir uno o más agentes activos adicionales incluyendo, pero sin limitación, otro anticuerpo terapéutico (un anticuerpo anti-IgE, un anticuerpo anti-IL-4, o un anticuerpo anti-IL-5), un inhibidor anti-IgE de molécula pequeña (por ejemplo, montelukast sódico), un simpatomimético (por ejemplo, albuterol), un antibiótico (por ejemplo, tobramicina), una desoxiribonucleasa (por ejemplo, pulmozyme), un fármaco anticolinérgico (por ejemplo, bromuro de ipratropio), un corticoesteroide (por ejemplo, dexametasona), un agonista de los receptores adrenérgicos β, un inhibidor de leucotrienos (por ejemplo, zileuton), un inhibidor de 5-lipooxigenasa, un inhibidor de fosfodiesterasa (FDE), un antagonista de CD23, un antagonista de IL-13, un inhibidor de liberación de citoquina, un antagonista de receptor de histamina HI, un antihistamínico, un agente antiinflamatorio, por ejemplo, cromolín sódico o cualquier otro agente antiinflamatorio conocido en la técnica, o descrito en el presente documento), o un inhibidor de la liberación de histamina.

En algunos aspectos de la divulgación, el medio puede ser adecuado para la administración intraocular de un anticuerpo anti-C5a, o un fragmento de unión a antígeno del mismo, descrito en el presente documento, a un sujeto en necesidad del mismo, por ejemplo, un sujeto aquejado de DMA o cualquier otro trastorno ocular asociado el complemento. El medio puede ser, por ejemplo, una jeringa, un parche transescleral e incluso una lente de contacto conteniendo el anticuerpo o fragmento. El medio puede, en algunos aspectos de la divulgación, ser un gotero para ojos, en el que el anticuerpo anti-C5a o fragmento de unión a antígeno del mismo se formula para tal administración. Dichos kits terapéuticos pueden incluir también, por ejemplo, uno o más agentes terapéuticos adicionales para su uso en el tratamiento de un trastorno asociado al complemento del ojo. Los agentes terapéuticos pueden ser, por ejemplo, bevacizumab o el fragmento Fab de bevacizumab, ranibizimab, vendidos ambos por Roche Pharmaceuticals, Inc., o pegaptanib sódico (Mucogen®; Pfizer, Inc.). Dicho kit puede también, de forma opcional, incluir instrucciones para la administración del anticuerpo anti-C5a o fragmento de unión a antígeno del mismo a un sujeto. En algunos aspectos de la divulgación, el medio puede ser adecuado para la administración intraarticular de un anticuerpo anti-C5a o fragmento de unión a antígeno del mismo descrito en el presente documento, a un sujeto en necesidad del mismo, por ejemplo, un sujeto aquejado con AR. El medio puede ser, por ejemplo, una jeringa o una jeringa de cañón doble. Véase, por ejemplo, las patentes de Estados Unidos nº 6.065.645 y 6.698.622. Una jeringa de cañón doble es útil para la administración, en una articulación, de dos composiciones diferentes con una sola inyección. Se pueden incorporar dos jeringas diferentes para uso en la administración de la terapia mientras se retira fluido de la rodilla para análisis (punción) en una forma tipo empujar-tirar. Los agentes terapéuticos adicionales que pueden administrarse con los anticuerpos anti-C5a o fragmentos, junto con la jeringa de cañón doble, o que pueden

ES 2 552 954 T3   de forma general incluirse de otro modo en los kits terapéuticos descritos en el presente documento, incluyen, por ejemplo, AIND, corticoesteroides, metotrexato, hidroxicloroquina, agentes anti-TNF tales como etanercept e infliximab, un agente disminuidor de células B tal como rituximab, un antagonista de interleucina-1, o un agente bloqueante coestimulatorio de células T tal como abatacept. Dicho kit puede también, de forma opcional, incluir instrucciones para la administración del anticuerpo anti-C5a o fragmento de unión a antígeno del mismo a un sujeto. Se apreciará que la divulgación abarca kits comprendiendo uno o más de los anticuerpos anti-C5a descritos en el presente documento y uno o más agentes antiinflamatorios seleccionados de entre un grupo consistiendo de AIND, corticoesteroides, metotrexato, hidroxicloroquina, agentes anti-TNF tales como etanercept e infliximab, un agente disminuidor de células B tal como rituximab, un antagonista de interleucina-1, o un agente bloqueante coestimulatorio de células T tal como abatacept. Los anticuerpos y agentes pueden, por ejemplo, formularse de forma separada, o juntos. Los kits se pueden usar para tratar una afección inflamatoria tal como AR, enfermedad de Crohn, enfermedad intestinal inflamatoria, o cualquier otro trastorno inflamatorio conocido en la técnica o que se enumere en el presente documento.

También se presentan kits diagnósticos conteniendo los anticuerpos anti-C5a o fragmentos de unión a antígeno de los mismos descritos en el presente documento. Por ejemplo, los kits pueden contener una forma marcada de manera detectable de un anticuerpo anti-C5a (por ejemplo, un anticuerpo anti-C5a o un anticuerpo anti-C5a de ratón) descrito en el presente documento para su uso en la detección o cuantificación de la cantidad de C5a en una muestra biológica. En algunos aspectos de la divulgación, los kits pueden contener proteína C5a aislada (por ejemplo, una o ambas proteínas C5a de ser humano y de ratón) y/o una muestra de control que comprenda una o ambas proteínas C5a de ser humano y de ratón. En algunos aspectos de la divulgación el kit contiene una placa de pocillos múltiples recubierta con un primer anticuerpo anti-C5a que tiene una primera especificidad. El kit también contiene un segundo anticuerpo anti-C5a (por ejemplo, un segundo anticuerpo anti-C5a marcado de manera detectable) que tiene una segunda especificidad. Dicho kit se diseña para su uso en capturar, con el primer anticuerpo unido a la placa, proteína C5a (por ejemplo, proteína C5a de ser humano) en una muestra (por ejemplo, una muestra biológica) puesta en contacto con la placa, y después detectando la proteína C5a capturada utilizando el segundo anticuerpo. En algunos aspectos de la divulgación, los kits diagnósticos incluyen un anticuerpo anti-C5a de ratón y un anticuerpo anti-C5a de ser humano, descritos en el presente documento. En algunos aspectos de la divulgación, los kits diagnósticos incluyen un anticuerpo anti-C5a que se une a C5a de ratón y a C5a de ser humano.

Los siguientes ejemplos tienen por objeto ilustrar, sin limitación, la invención. Ejemplos

Ejemplo 1. Métodos de inmunización Los anticuerpos anti-C5a descritos ahora son formas humanizadas de anticuerpos murinos generados por el siguiente protocolo de inmunización. Las inmunizaciones para provocar anticuerpos contra C5a desarginada de ser humano, se realizaron en cuatro ratones incluyendo dos ratones de la cepa DBA/2J y dos ratones de la cepa A/J.

Estas cepas se seleccionaron porque portan el alelo Hc0, que las hace deficientes en C5 endógena, todas las inmunizaciones se repitieron en intervalos de 14 días con un total de tres inmunizaciones. Todos los animales recibieron una inmunización de refuerzo subcutánea de aproximadamente 50 µg de C5a purificada en 200 µl de emulsión adyuvante, aproximadamente 14 días después de la última inmunización, y 5 a 7 días antes de la recolección. La titulación de los sueros de los ratones inmunizados, utilizando un ensayo de ELISA, mostraron que los ratones presentaban una fuerte respuesta de anticuerpos contra el inmunógeno C5a desarginada de ser humano. Ejemplo 2. Determinación de la especificidad de los anticuerpos de ratón por C5a de ser humano Un subconjunto de cinco Fab de ratón anti-C5a de ser humano que fueron representativos de Fab selectivos de neoepítopos, se convirtieron en anticuerpos IgG2a de ratón de longitud completa designados como 5an048ME, 5an101ME, 5an178ME, 5an179ME, y 5an180ME. Se evaluó la especificidad de estos anticuerpos usando interferometría de Biocapa en un Octet (ForteBio Inc.). (Las secuencias de aminoácidos de los conjuntos de las CDR de cadena ligera y cadena pesada de cada anticuerpo, definidos por Kabat, se indican en la Tabla 3). En resumen, C5a de ser humano, C5a desarginada de ser humano, C5 de longitud completa de ser humano, o los parálogos de C5a, C3a de ser humano y C4a de ser humano, se conjugaron a biotina a una estequiometria < 1 (biotina):1 (anticuerpo) a través de grupos amino, y se inmovilizaron sobre una punta de estreptavidina. Las puntas cargadas se expusieron a una solución conteniendo el anticuerpo IgG anti-C5a 20 nM. Cada uno de los anticuerpos se unió a C5a y a C5a desarginada. Ninguno de los anticuerpos IgG anti-C5a se unió a C3a o a C4a. Sin embargo, 5an178ME y 5an179ME se unieron a C5a de ser humano de longitud completa. Se observó una pequeña cantidad de unión entre 5an048ME y C5 de ser humano de longitud completa. Sin embargo, la unión de 5an048ME a C5 fue mucho menor que la unión observada para C5a. Estos resultados confirmaron que los anticuerpos de ratón anti-C5a de ser humano - 5an048ME, 5an101ME, y 5an180ME - se unen a un neoepítopo sobre C5a que estaba obstruido en C5 de longitud completa, natural, o se

ES 2 552 954 T3   genera después de la escisión de C5 en los fragmentos C5a y C5b. Los resultados también indicaron que los tres anticuerpos fueron selectivos por C5a de ser humano, en comparación con los parálogos C3a o C4a.

Tabla 3. Secuencias de aminoácidos de cinco anticuerpos murinos anti-C5a de ser humano Ac SIN: Descripción Secuencia de aminoácidos* 5an048 151 Secuencia de aminoácidos ME del VL 140 CDR1 de cadena ligera RASSSVSSSYLH 96 CDR2 de cadena ligera STSNLAS 142 CDR3 de cadena ligera QQYSGYPLT 152 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 144 CDR2 de cadena pesada YIFPKTGGTHYNQRFKG 117 CDR3 de cadena pesada GPFAY 5an101 153 Secuencia de aminoácidos ME del VL CDR1 de cadena ligera RASESVDSYGNSFMH 21 CDR2 de cadena ligera RASNLES 22 CDR3 de cadena ligera OOSNEDPYT 154 Secuencia de aminoácidos del VH 28 CDR1 de cadena pesada DYSMD 67 CDR2 de cadena pesada AINPNSGGTNYSQKFKD CDR3 de cadena pesada SGSYDGYYAMDY 5an180 155 Secuencia de aminoácidos ME del VL 156 CDR1 de cadena ligera RASENIYSYLA 157 CDR2 de cadena ligera NAKTLAE 158 CDR3 de cadena ligera QHHYGTPYT 159 Secuencia de aminoácidos del VH 160 CDR1 de cadena pesada DYWMN 161 CDR2 de cadena pesada TIDPSDSYTIYNQKFKG 162 CDR3 de cadena pesada GEDYDVSSYTMDY

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 5an178 163 Secuencia de aminoácidos ME del VL QQSRKVPWTFGGGTKLEIKR 164 CDR1 de cadena ligera SASESVEYFGTSLMQ 165 CDR2 de cadena ligera AASNVES 166 CDR3 de cadena ligera QQSRKVPWT 167 Secuencia de aminoácidos del VH 168 CDR1 de cadena pesada DYGMV 169 CDR2 de cadena pesada FISSGSSNIYYADTVKG 170 CDR3 de cadena pesada AFSFYYGYDY 5an179 171 Secuencia de aminoácidos ME del VL 172 CDR1 de cadena ligera RSSQSLVHSNGNTYLH 173 CDR2 de cadena ligera KVSNRFS 174 CDR3 de cadena ligera SQSTHVPLT 175 Secuencia de aminoácidos del VH 176 CDR1 de cadena pesada SYLIH 177 CDR2 de cadena pesada YIYPFNDGTKNNENFKG 178 CDR3 de cadena pesada SHGPHYYGGSYGYHFDY "SIN" en la Tabla se refiere a "SEC ID Nº".

* Secuencia de aminoácidos de la CDR definida por Kabat et al. (citado anteriormente).

Una serie de ensayos tipo sandwich se realizaron en Octet sobre el subconjunto seleccionado de anticuerpos de ratón IgG2a anti-C5a de ser humano para determinar el grado solapamiento de los epítopos de C5a para cada uno de los cinco anticuerpos IgG2a representativos. En resumen, un primer anticuerpo se biotiniló e inmovilizó sobre una punta recubierta de estreptavidina, sobre la plataforma Octet. A continuación, se capturó sobre el anticuerpo inmovilizado, C5a de ser humano a partir de una solución 20 nM. Después, la punta portando el complejo anticuerpo-C5a se expuso a una solución que contenía un segundo anticuerpo IgG anti-C5a no marcado a 20 nM. La obtención de un perfil de asociación adicional en el sensograma indicaría que los dos anticuerpos se unieron de forma simultánea a C5a en un complejo ternario y que los epítopos de unión para los dos anticuerpos eran no solapantes. Un fracaso en la obtención de un segundo perfil de asociación después de la adición de un segundo anticuerpo indicaría que los dos anticuerpos se unieron a C5a de una manera competitiva, es decir, el epítopo sobre C5a al cual el segundo anticuerpo se une, estaba obstaculizado después de la unión del primer anticuerpo. En contraste a una unión no competitiva, la unión competitiva no necesariamente indica que el primero y segundo anticuerpos reconocen los mismos, o incluso solapantes, epítopos sobre C5a de ser humano. Utilizando esta estrategia, los sitios de unión de los cinco anticuerpos anti-C5a representativos se asignaron a 4 epítopos distintos sobre C5a de ser humano. (Figura 1). Los anticuerpos 5an048ME, 5an180ME, y 5an101ME compitieron entre sí. Aunque 5an048 y 5an180 también compitieron con el anticuerpo no selectivo por neoepítopo 5an179ME, 5an101ME no lo hizo, lo que indicó que 5an048ME y 5an180ME reconocen un neoepítopo que es diferente que el neoepítopo reconocido por 5an101ME. Además, aunque que el anticuerpo no selectivo por neoepítopo 5an178ME compitió con 5an179ME no selectivo para neoepítopo, solo el último compitió con 5an180ME y 5an048ME, mostrando que 5an179ME y 5an178ME se unen a diferentes epítopos, que son accesibles tanto en C5 y como en C5a. Los

ES 2 552 954 T3   resultados también indican que algunas combinaciones de los anticuerpos podrían usarse en ensayos basado en sándwich para detectar y/o cuantificar la cantidad de C5a en una muestra. Ejemplo 3. Humanización de anticuerpos de ratón anti-C5a de ser humano seleccionados Las regiones variables de dos anticuerpos de ratón anti-C5a de ser humano relacionados - 5an101ME y 5an185ME - se seleccionaron para su humanización como anticuerpos IgG de longitud completa. La humanización de las regiones variables de cadena ligera y cadena pesada se basó en la identificación de regiones marco conservadas individuales de anticuerpos de ser humano (con una preferencia dada por los v-genes de línea germinal) con un alto grado de identidad de secuencia con el anticuerpo parental murino original. Los métodos para la identificación las regiones marco conservadas candidatas adecuadas se describen en la patente de Estados Unidos nº 7.393.648 de Rother y Wu. Las definiciones de regiones marco conservadas (RMC) y regiones determinantes de complementariedad (CDR) se realizaron de acuerdo a métodos descritos por Kabat, Chothia y IMGT® (International ImmunoGenetics Information System; Francia). En resumen, las consultas de bases de datos se realizaron de forma independiente para las dos regiones variables de cadena ligera y de cadena pesada, con una diversidad de fragmentos de anticuerpo incluyendo: la región variable murina intacta desde la RMC1 hasta la RMC4, las regiones variables murinas intactas excluyendo las CDR y todos los fragmentos posibles de las regiones variables murinas incluyendo una, dos o tres regiones marco conservadas con o sin sus CDR flanqueantes. Las regiones marco conservadas de ser humano se seleccionaron a partir de este grupo candidato basándose en su identidad de secuencia global con los anticuerpos murinos originales y los fragmentos de los mismos. Se emplearon métodos rutinarios de biología molecular para generar bibliotecas combinatorias pequeñas, de menos de 103 miembros, en las cuales cada conjunto de CDR murinas estaban flaqueadas por todas las combinaciones posibles de regiones marco conservadas de ser humano. Estos anticuerpos humanizados se expresaron como Fab solubles y se evaluó su unión a C5a desarginada usando ELISA. Las Fab que se unieron a C5a después fueron sujetas a análisis de secuencia de ADN. A partir de estos elementos que se unían, un subconjunto de seis Fab humanizados se reformó como IgG de longitud completa (IgG2 de ser humano o IgG2/G4 de ser humano). Se realizó una humanización adicional en dos anticuerpos (BNJ371 y BNJ381) mediante el reemplazo de restos murinos en la CDR2 de la cadena ligera por sus correspondientes aminoácidos de línea germinal de ser humano. Las secuencias de aminoácidos de los anticuerpos anti-C5a humanizados - BNJ364, BNJ367, BNJ371, BNJ378, BNJ366, BNJ369, BNJ381, y BNJ383 - se indican más abajo en la Tabla 2. Ejemplo 4. Determinación de la afinidad por C5a de los anticuerpos humanizados anti-C5a de ser humano Los anticuerpos humanizados se sometieron a análisis BIAcore para cuantificar sus afinidades respectivas por C5a de ser humano. Véase, por ejemplo, Karlsson y Larsson (2004) Methods Mol Biol 248:389-415. En resumen, cada uno de los anticuerpos humanizados se exploró con 3-4 concentraciones de C5a de ser humano (antígeno) utilizando una técnica de captura. Los anticuerpos se capturaron por un anti-Fc (de ser humano) inmovilizado directamente sobre un chip sensor CM5, con varias concentraciones de C5a de ser humano en el intervalo desde 0,6 nM a 5,9 nM, pasadas por encima de la superficie del chip sensor. Después de cada ciclo la superficie se regeneró con ClH 20 mM, P20 al 0,02%, para eliminar el anticuerpo y el antígeno no unidos. Los datos se evaluaron usando un software BIAevaluation de Biacore usando un ajuste de modelo Langmuir 1:1 (Rmáx: ajuste global; RI: ajuste local). La información de cinéticas tales como (ka: constante de tasa de asociación), (kd: constante de tasa de disociación) y KD (constante de disociación en equilibrio), se obtuvo a partir del ajuste. Los resultados de los análisis se indican en la Tabla 4. Estos experimentos se hicieron con propósitos de exploración con un número mínimo de concentraciones del analito (3 a 4), con 1 duplicado. Así, los valores cinéticos aproximados se informan en la Tabla 4.

Tabla 4. Mediciones de la afinidad por anticuerpos anti-C5a humanizados seleccionados Designación del anticuerpo ka (1/Ms) (x106) kd (1/s) (x10-4) KD (M) (x10-12) χ2 BNJ364 0,991 6,38 644 0,819 BNJ367 3,94 7,78 198 0,848 BNJ371 2,38 28,2 1180 9,52 BNJ378 1,93 5,76 298 3,63 BNJ366 1,05 1,58 150 1,23 BNJ369 4,19 2,23 53,1 0,642 BNJ381 2,57 2,09 81,5 1,93 BNJ383 2,12 1,5 70,4 2,52 Todos los anticuerpos humanizados se unieron específicamente a C5a de ser humano con una kD menor que 1,20 nanomolar. Todos los anticuerpos con excepción de BNJ371 se unieron a C5a de ser humano con una KD menor

ES 2 552 954 T3   que 1 nanomolar. Tres de los anticuerpos, BNJ369, BNJ381, y BNJ383 se unieron a C5a de ser humano con una KD menor que 100 picomolar. Ejemplo 5. Los anticuerpos anti-C5a muestran señalización mediada por C5a in vitro

Se usó un ensayo de activación de neutrófilos in vitro para evaluar la actividad de los anticuerpos humanizados. En ensayo se describe de forma general en, por ejemplo, Paczkowski et al. (1999) Br J Pharmacol 128(7):1461-1466, y sirve para cuantificar la cantidad de mieloperoxidasa (MPO) producida por neutrófilos como una medida de la activación de neutrófilos. En resumen, células polimorfonucleares, la mayoría de las cuales eran neutrófilos, se aislaron usando centrifugación de densidad (medio de resolución mono-poli nº de catálogo: 91698049; MP Biochemicals; Solon, Ohio) a partir de sangre entera de un donante saludable. Se lavaron las células una vez con solución salina tamponada con fosfato (PBS) y los glóbulos rojos (GR) se eliminaron de la población celular mediante lisis en una solución hipotónica (tampón de lisis ACK nº de catálogo 10-548E; Lonza). Después de dos lavados más con PBS, las células libres de GR se resuspendieron a una concentración de 4 x 106 células/ml en solución salina balanceada de Hank (HBSS; Mediatech, nº de catálogo: 21-023-CV), la cual se suplementó con calcio y magnesio, y se suplementó adicionalmente con gelatina al 0,1% (Sigma Aldrich; St. Louis, Missouri) [en lo sucesivo en este documento, el tampón de ensayo]. Se añadió a la suspensión celular citocalasina B (Sigma Aldrich) en una cantidad suficiente para alcanzar una concentración de 10 µg/ml. La suspensión se incubó durante 10 minutos a 37º C. Se añadió 100 µl de las células a pocillos de placas de 96 pocillos de fondo en U. Los pocillos de la placa se agruparon en varios conjuntos diferentes. Cada uno o varios de los diferentes conjuntos de pocillos contenían un anticuerpo anti-C5a: cada pocillo del conjunto 1 contenía un anticuerpo humanizado que se une a C5 natural, no escindida, pero no a C5a libre; cada pocillo del conjunto 2 contenía el anticuerpo anti-C5a humanizado BNJ367; cada pocillo del conjunto 3 contenía el anticuerpo anti-C5a humanizado BNJ369; cada pocillo del conjunto 4 contenía el anticuerpo anti-C5a humanizado BNJ371; cada pocillo del conjunto 5 contenía el anticuerpo anti-C5a humanizado BNJ378; cada pocillo del conjunto 6 contenía el anticuerpo anti-C5a humanizado BNJ381; y cada pocillo del conjunto 7 contenía el anticuerpo anti-C5a humanizado BNJ383. Cada pocillo de un octavo conjunto de pocillos no contenía anticuerpo. En cada conjunto de pocillos se evaluó un intervalo de concentraciones de anticuerpo, el intervalo incluía anticuerpo 0,08 nM, 0,4 nM, 2 nM, y 10 nM.

C5a (obtenida de Complement Technologies, Inc.) se evaluó a una concentración de 2 nM. Una concentración de trabajo 10X de 20 nM se preparó en el tampón de ensayo anteriormente mencionado y se añadió 20 µl a cada pocillo. Después de añadir C5a a los pocillos, la placa se incubó durante 10 minutos a 37º C. Después de la incubación, se añadieron 60 µl de PBS a cada pocillo de la placa. Las placas se sometieron a centrifugación a 1200 rpm (aproximadamente 335 x g) durante 10 minutos a temperatura ambiente. Se transfirieron 100 µl del sobrenadante de cada pocillo, al pocillo correspondiente de una segunda placa. Se añadieron 25 µl de sustrato (Sigma Aldrich nº de catálogo T0440) a cada pocillo de la segunda placa y se permitió el desarrollo de la reacción de peroxidasa durante aproximadamente dos a cinco minutos. La reacción se finalizó mediante la adición de 25 µl de ClH 1N. Se registró la OD a 450 nM.

Como se muestra en la Figura 2, todos los anticuerpos anti-C5a humanizados inhibieron la activación de neutrófilo in vitro. Estos resultados indican que los anticuerpos anti-C5a humanizados descritos en el presente documento son inhibidores potentes de la señalización mediada por C5a in vitro y respalda la conclusión de los inventores de que los anticuerpos son útiles para el tratamiento de una diversidad de trastornos asociados al complemento (por ejemplo, trastornos inflamatorios asociados al complemento) en seres humanos. Ejemplo 6. Caracterización de un anticuerpo de ratón anti-C5a de ratón sustituto Se realizó una serie de ensayos tipo sándwich, sobre un anticuerpo IgG de ratón anti-C5a de ratón seleccionado - 5an195ME - para determinar la especificidad del anticuerpo por C5a. En resumen, los pocillos de una placa de ensayo se recubrieron con el anticuerpo 5an195ME. La placa se lavó minuciosamente para eliminar el anticuerpo no unido. A continuación, los pocillos conteniendo 5an195ME se pusieron en contacto con C5a de ratón durante un tiempo y en condiciones suficientes para permitir la unión el antígeno al anticuerpo. La proteína no unida se eliminó mediante lavado. Después de la etapa de lavado, los pocillos se pusieron en contacto adicionalmente con una solución conteniendo un segundo anticuerpo anti-C5a biotinilado. Los pocillos se lavaron otra vez para eliminar cualquier segundo anticuerpo no unido. La cantidad de unión del segundo anticuerpo al pocillo se cuantificó usando peroxidasa de rábano picante (HRP) conjugada a estreptavidina. La cantidad de unión del segundo anticuerpo fue en función de la unión de C5a a 5an195ME.

En un experimento paralelo, un conjunto de pocillos recubiertos con 5an195ME se incubaron con proteína C5 de ratón de longitud completa, en lugar de C5a. Después de la etapa de lavado, los pocillos se pusieron en contacto con una solución conteniendo un segundo anticuerpo: un anticuerpo anti-C5 de ratón biotinilado. La cantidad del segundo anticuerpo, en función de la cantidad de C5 unida por 5an195ME, se cuantificó usando la construcción HRP conjugada a estreptavidina. Una pérdida de unión del segundo anticuerpo indica que 5an195ME no se une a C5 de ratón de longitud completa.

ES 2 552 954 T3   Aunque 5an195ME se une a C5a en una forma dependiente de dosis, no se detectó, utilizando estos ensayos, unión entre el anticuerpo y C5a de ratón de longitud completa. Estos resultados indican que 5an195ME se une a un neoepítopo presente en C5a.

La afinidad de unión relativa de 5an195ME por C5a de ratón se cuantificó adicionalmente usando BIAcore. Las cinéticas de 5an195ME se midieron usando una técnica de captura. El anticuerpo se capturó con un anti-Fc (ratón) inmovilizado directamente sobre un chip sensor CM5 con varias concentraciones entre, e incluyendo, 0,4 nM y 25 nM de C5a de ratón pasadas por encima de la superficie del chip sensor. También se realizaron duplicados de cada concentración. La superficie del chip se regeneró con glicina ClH 10 mM pH 1,7 después de cada ciclo para eliminar el anticuerpo y el antígeno unidos. Los datos se evaluaron usando el software BIAevaluation de Biacore usando un ajuste de modelo Langmuir 1:1 (Rmáx: ajuste global; RI: ajuste local). La información de cinéticas tales como ka (constante de tasa de asociación), kd (constante de tasa de disociación) y KD (constante de disociación en equilibrio) se obtuvo a partir del ajuste. Los resultados de los análisis de las cinéticas se muestran en la Tabla 5.

Tabla 5. Cinéticas medidas de 5an195ME para C5a de ratón Parámetro: ka (1/Ms) kd (1/s) KD (M) χ2 5an195ME 8,47 x 105 1,27 x 10-3 1,5 x 10-9 1,17 Estos resultados indican que el anticuerpo de ratón anti-C5a de ratón no solo es específico por C5a, en comparación a C5 de ratón de longitud completa, sino que también el anticuerpo se une con alta afinidad a C5a de ratón.

Ejemplo 7. Uso del anticuerpo anti-C5a de ratón sustituto 5an195ME en un modelo animal de AR El anticuerpo anti-C5a de ratón 5an195ME se evaluó en un modelo de ratón de artritis inducida por colágeno. Ratones machos de DBA/1LacJ (de 9 a 12 semanas de edad) se inmunizaron mediante inyección intradérmica en la base de la cola con 300 µg de colágeno bovino tipo II emulsionado con volúmenes equivalentes de adyuvante de Freund completo. El procedimiento se repitió dos semanas después de la primera inmunización. Se inspeccionaron los ratones diariamente para identificar inflamación en una articulación de la rodilla inicial. Una vez que la inflamación inicial se identificó, se administró a los ratones de forma intraperitoneal tres veces por semana el anticuerpo anti-C5a de ratón 5an195ME (40 mg/kg) o un anticuerpo de control (40 mg/kg). El grosor de la articulación inflamada inicialmente (en mm) se midió a diario hasta el día 12.

Como se muestra en la Figura 3, 5an195ME reduce el grosor de la articulación de la rodilla en comparación al anticuerpo control. 5an195ME pareció proporcionar el beneficio de mantener un grosor de articulación de la rodilla por debajo de 4,5 mm.

Además de evaluar la habilidad del anticuerpo 5an195ME para reducir la hinchazón de la articulación de la rodilla inflamada inicialmente, la capacidad del anticuerpo anti-C5a 5an195ME para impedir la migración de la inflamación a nuevas articulaciones también se evaluó. El número de articulaciones recién incorporadas se midió a diario desde del día 1 hasta el día 12. El resultado del experimento se indica en la Tabla 6.

Tabla 6. Eficacia de 5an195ME en un modelo de AR Tratamiento Número de Número de Número de articulaciones Número promedio de ratones articulaciones recién inflamadas en el día inflamaciones recién inflamadas en el día 1 12 inflamadas por ratón Ac control 6 7 12 2 5an195ME 6 7 2 0,3 Como se muestra en la Tabla 6, los ratones tratados con 5an195ME tuvieron de forma notoria menos articulaciones recién inflamadas en el día 12 en comparación con los animales tratado con Ac de control. Los ratones tratados con 5an195ME también tenían en promedio, de forma notoria, menos articulaciones recién inflamadas.

También se monitorizó la artritis en los ratones y se definió utilizando un índice de valor/artritis clínico. Cada extremidad se evaluó diariamente de acuerdo con un sistema de valoración establecido (0, articulación normal; 1, eritema e hinchazón visibles leves/moderados; 2, eritema severo e hinchazón afectando una pata o articulación completa; 3, pata deformada o articulación con anquilosis), con un valor máximo de 24 por animal. Véase, por ejemplo, Wang et al. (2000) J Immunol 164:4340-4347. Como se muestra en la Figura 4, los ratones tratados con el anticuerpo anti-C5a de ratón 5an195ME muestran una reducción marcada en el valor clínico (valor promedio de menos que 1) en comparación con los ratones tratados con el anticuerpo de control (valor promedio por arriba de 6), a lo largo del curso del estudio.

En resumen, estos resultados indican que el anti-C5a de ratón sustituto es efectivo en el tratamiento de AR - ambos en una articulación inicial y en la migración de la inflamación a articulaciones secundarias - en el modelo de ratón de la enfermedad. Estos resultados también sugieren con fuerza, que un anticuerpo anti-C5a de ser humano

ES 2 552 954 T3   terapéutico, tal como cualquiera de los anticuerpos anti-C5a humanizados descritos en el presente documento, son útiles para tratar seres humanos con AR. Ejemplo 8. Uso de un anticuerpo anti-C5a para tratar artritis reumatoide Un facultativo médico identifica a un paciente ser humano como presentando artritis reumatoide en una única articulación articulada. Poco después se administra al paciente una composición de forma intraarticular o intraperitoneal que contiene un anticuerpo anti-C5a humanizado descrito en el presente documento, en una cantidad suficiente para reducir la señalización de C5aR1 mediada por C5a localmente dentro del espacio articular. Después del tratamiento, el paciente y el facultativo médico observan una mejora sustancial en al menos dos síntomas conocidos de artritis reumatoide. Los pacientes reciben administración intravenosa de “dosis de mantenimiento” del anticuerpo cada mes para prevenir la recurrencia de los síntomas, para prevenir la progresión de AR en la articulación única o para prevenir la migración de los síntomas de AR a una segunda articulación.

Ejemplo 9. Uso de un anticuerpo anti-C5a para tratar septicemia Un facultativo médico identifica a un paciente ser humano como teniendo septicemia. Poco después se administra al paciente una composición que contiene un anticuerpo anti-C5a humanizado descrito en el presente documento, a una dosis de aproximadamente 600 a 900 mg por medio de infusión intravenosa. Durante el tratamiento, el paciente y el facultativo médico observan una mejora sustancial de al menos dos síntomas conocidos de septicemia. El paciente recibe, de forma intravenosa, “dosis de mantenimiento” administradas del anticuerpo cada dos semanas hasta que el paciente deja el hospital. Ejemplo 10. Uso de un anticuerpo anti-C5a para tratar trastornos inflamatorios pulmonares asociados al complemento Un facultativo médico identifica a un paciente ser humano como presentando una forma de severa de EPOC. Una vez cada dos a cuatro semanas, se administra al paciente una composición que contiene un anticuerpo anti-C5a humanizado, a una dosis de aproximadamente 600 mg a 900 mg mediante infusión intravenosa. Durante el tratamiento inicial, el paciente y el facultativo médico observan una mejora sustancial de al menos dos síntomas conocidos de EPOC. Por ejemplo, el paciente que recibe el anticuerpo anti-C5a, tiene una frecuencia y/o severidad reducidas de exacerbaciones relacionadas con EPOC. El paciente continua recibiendo “dosis de mantenimiento”, administradas de forma intravenosa, del anticuerpo cada dos semanas para mantener reducidas la frecuencia y/o severidad de exacerbaciones relacionadas con EPOC.

Un facultativo médico identifica a un paciente ser humano como presentando una forma severa de asma. Se prescribe al paciente un anticuerpo terapéutico anti-C5a humanizado, que se administra por medio de un inhalador. Durante el siguiente ataque de broncoespasmos, el paciente se autoadministra el anticuerpo anti-C5a en una cantidad suficiente para reducir en los pulmones del paciente, la respuesta inflamatoria mediada por C5a. El paciente continúa usando el inhalador según se necesite, para prevenir o disminuir la severidad de los ataques de asma. Ejemplo 11. Anticuerpos anti-C5a adicionales identificados a partir de ratones inmunizados Varios anticuerpos adicionales se obtuvieron a partir de ratones inmunizados (véase Ejemplo 1) y se identificaron adicionalmente por ELISA como capaces de unirse a C5a de ser humano. Los anticuerpos adicionales incluyen 15 conjuntos de CDR de cadena ligera únicos (indicados en la Tabla 7) y 14 conjuntos de CDR de cadena pesada únicos (como se indica en la Tabla 8).

Tabla 7. Secuencias de aminoácidos de varias secuencias únicas del VL y de las CDR de cadena ligera definidas por Kabat de anticuerpos murinos anti-C5a de ser humano adicionales.

Ac SIN: Descripción Secuencia de aminoácidos* 5an110 83 Secuencia de aminoácidos del VL 84 CDR1 de cadena ligera KASQNVGTNVA 85 CDR2 de cadena ligera SASYRYS 86 CDR3 de cadena ligera QQYNSYPFT

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 5an177 87 Secuencia de aminoácidos del VL 88 CDR1 de cadena ligera SASSSVSYMH 89 CDR2 de cadena ligera DTSKLAS 90 CDR3 de cadena ligera QQWSSNPLT 5anG12 91 Secuencia de aminoácidos del VL 92 CDR1 de cadena ligera SASSSISYMH 89 CDR2 de cadena ligera DTSKLAS 93 CDR3 de cadena ligera HQRSSYPWT 5an052 94 Secuencia de aminoácidos del VL 95 CDR1 de cadena ligera SASSSVSSSYLY 96 CDR2 de cadena ligera STSNLAS 97 CDR3 de cadena ligera HQWSSYPPT 5an107 98 Secuencia de aminoácidos del VL 99 CDR1 de cadena ligera RGSENIYSNLA 100 CDR2 de cadena ligera AATNLAD 101 CDR3 de cadena ligera 5anE11 102 Secuencia de aminoácidos del VL 84 CDR1 de cadena ligera KASQNVGTNVA 85 CDR2 de cadena ligera SASYRYS 103 CDR3 de cadena ligera QQYNSYPWT 5an054 104 Secuencia de aminoácidos del VL 105 CDR1 de cadena ligera SASSSVSYMY 106 CDR2 de cadena ligera DTSNLAS 107 CDR3 de cadena ligera QQWSSYPPT

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 5anG10 141 Secuencia de aminoácidos del VL 92 CDR1 de cadena ligera SASSSISYMH 89 CDR2 de cadena ligera DTSKLAS 108 CDR3 de cadena ligera HQRRSYPWT 5an188 109 Secuencia de aminoácidos del VL CDR1 de cadena ligera RASESVDSYGNSFMH 110 CDR2 de cadena ligera LASNLES 111 CDR3 de cadena ligera QQNNEDPLT 5an185 112 Secuencia de aminoácidos del VL CDR1 de cadena ligera RASESVDSYGNSFMH 21 CDR2 de cadena ligera RASNLES 113 CDR3 de cadena ligera QQSNEDPLT "SIN" en la Tabla se refiere a "SEC ID Nº". * Secuencia de aminoácido de la CDR definida por Kabat et al. (citado anteriormente).

Tabla 8. Secuencias de aminoácidos de varias secuencias únicas del VH y de las CDR de cadena pesada definidas por Kabat de anticuerpos murinos anti-C5a de ser humano adicionales Ac SIN: Descripción Secuencia de aminoácidos * 5an110 114 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 116 CDR2 de cadena pesada YIFPKTGGTNYSQRFKG 117 CDR3 de cadena pesada GPFAY 5an177 118 Secuencia de aminoácidos del VH 119 CDR1 de cadena pesada SYYMA 120 CDR2 de cadena pesada TISSGGSYTYYPDNVKG 121 CDR3 de cadena pesada YYEDDAMDY

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 5an055 122 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 123 CDR2 de cadena pesada YIFPKTGGTNYNQRFKG 117 CDR3 de cadena pesada GPFAY 5an054 145 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 124 CDR2 de cadena pesada YIFPNTGGTTYNQRFKG 117 CDR3 de cadena pesada GPFAY 5an107 125 Secuencia de aminoácidos del VH 119 CDR1 de cadena pesada SYYMA 126 CDR2 de cadena pesada TISSGGSYTYYRDNVKG 127 CDR3 de cadena pesada YFEDYPMDY 5an111 128 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 129 CDR2 de cadena pesada YIFPNTGGTSYNQRFKD 117 CDR3 de cadena pesada GPFAY 5an183 130 Secuencia de aminoácidos del VH 131 CDR1 de cadena pesada SSWMH 132 CDR2 de cadena pesada EIHTSGHTNYNEKFKG 133 CDR3 de cadena pesada GGLRRGYAMDY 5an185 134 Secuencia de aminoácidos del VH

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 28 CDR1 de cadena pesada DYSMD 46 CDR2 de cadena pesada AIHLNTGYTNYNQKFKG 47 CDR3 de cadena pesada GFYDGYSPMDY 5an188 135 Secuencia de aminoácidos del VH 136 CDR1 de cadena pesada SYWMH 137 CDR2 de cadena pesada EIHPSSGHTNYHEKFKS 138 CDR3 de cadena pesada ASLLRAYAMDY "SIN" en la Tabla se refiere a "SEC ID Nº." * Secuencia de aminoácido de la CDR definida por Kabat et al. (citado anteriormente).

Los emparejamientos de VL y VH dando origen a los anticuerpos 5an177ME, 5an054ME, 5an110ME, 5an188ME, 5an185ME, y 5an107ME, son evidentes a partir de las Tablas 7 y 8. Emparejamientos ejemplares adicionales de las regiones variables de cadena pesada y cadena ligera y/o conjuntos de las CDR son según se indica en la Tabla 9 más abajo.

Tabla 9. Secuencias de aminoácidos para conjuntos de CDR de anticuerpos de ratón anti-C5a de ser humano y adicionales Ac SIN: Descripción Secuencia de aminoácidos* 5an047 139 Secuencia de aminoácidos del VL 140 CDR1 de cadena ligera RASSSVSSSYLH 96 CDR2 de cadena ligera STSNLAS 142 CDR3 de cadena ligera QQYSGYELT 143 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 144 CDR2 de cadena pesada YIFPKTGGTHYNQRFKG 117 CDR3 de cadena pesada GPFAY 5an181 139 Secuencia de aminoácidos del VL

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 140 CDR1 de cadena ligera RASSSVSSSYLH 96 CDR2 de cadena ligera STSNLAS 142 CDR3 de cadena ligera QQYSGYPLT 122 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 123 CDR2 de cadena pesada YIFPKTGGTNYNQRFKG 117 CDR3 de cadena pesada GPFAY 5an109 146 Secuencia de aminoácidos del VL 105 CDR1 de cadena ligera SASSSVSYMY 106 CDR2 de cadena ligera DTSNLAS 107 CDR3 de cadena ligera QQWSSYPPT 122 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 123 CDR2 de cadena pesada YIFPKTGGTNYNQRFKG 117 CDR3 de cadena pesada GPFAY 5anG10 141 Secuencia de aminoácidos del VL 92 CDR1 de cadena ligera SASSSISYMH 89 CDR2 de cadena ligera DTSKLAS 108 CDR3 de cadena ligera HQRRSYPWT 147 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 144 CDR2 de cadena pesada YIFPKTGGTHYNQRFKG 117 CDR3 de cadena pesada GPFAY

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 5an053 148 Secuencia de aminoácidos del EIVLTQSPVIMSASPGEKVTMICSASSSISYMH VL 92 CDR1 de cadena ligera SASSSISYMH 89 CDR2 de cadena ligera DTSKLAS 93 CDR3 de cadena ligera HQRSSYPWT 149 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 123 CDR2 de cadena pesada YIFPKTGGTNYNQRFKG 117 CDR3 de cadena pesada GPFAY 5anG12 91 Secuencia de aminoácidos del VL 92 CDR1 de cadena ligera SASSSISYMH 89 CDR2 de cadena ligera DTSKLAS 93 CDR3 de cadena ligera HQRSSYPWT 147 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 144 CDR2 de cadena pesada YIFPKTGGTHYNQRFKG 117 CDR3 de cadena pesada GPFAY 5an052 94 Secuencia de aminoácidos del VL 95 CDR1 de cadena ligera SASSSVSSSYLY 96 CDR2 de cadena ligera STSNLAS 97 CDR3 de cadena ligera HOWSSYPPT 147 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 144 CDR2 de cadena pesada YIFPKTGGTHYNQRFKG 117 CDR3 de cadena pesada GPFAY

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 5an111 102 Secuencia de aminoácidos del VL 84 CDR1 de cadena ligera KASQNVGTNVA 85 CDR2 de cadena ligera SASYRYS 103 CDR3 de cadena ligera QQYNSYPWT 128 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 129 CDR2 de cadena pesada YIFPNTGGTSYNQRFKD 117 CDR3 de cadena pesada GPFAY 5an055 150 Secuencia de aminoácidos del VL 95 CDR1 de cadena ligera SASSSVSSSYLY 96 CDR2 de cadena ligera STSNLAS 97 CDR3 de cadena ligera HQWSSYPPT 122 Secuencia de aminoácidos del VH 115 CDR1 de cadena pesada DYYYMN 123 CDR2 de cadena pesada YIFPKTGGTNYNQRFKG 117 CDR3 de cadena pesada GPFAY

ES 2 552 954 T3   Ac SIN: Descripción Secuencia de aminoácidos* 5anE11 102 Secuencia de aminoácidos del VL 84 CDR1 de cadena ligera KASQNVGTNVA 85 CDR2 de cadena ligera SASYRYS 103 CDR3 de cadena ligera QQYNSYPWT 143 Secuencia de aminoácidos del EVQLQQSGPELVKPGASVRISCKASGYTFSDY VH 115 CDR1 de cadena pesada DYYYMN 144 CDR2 de cadena pesada YIFPKTGGTHYNQRFKG 117 CDR3 de cadena pesada GPFAY 5an183 112 Secuencia de aminoácidos del VL CDR1 de cadena ligera RASESVDSYGNSFMH 21 CDR2 de cadena ligera RASNLES 113 CDR3 de cadena ligera QQSNEDPLT 130 Secuencia de aminoácidos del VH 131 CDR1 de cadena pesada SSWMH 132 CDR2 de cadena pesada EIHTSGHTNYNEKFKG 133 CDR3 de cadena pesada GGLRRGYAMDY "SIN" en la Tabla se refiere a "SEC ID Nº." * Secuencia de aminoácido de la CDR definida por Kabat et al. (citado anteriormente).

Ejemplo 12. Anticuerpos anti-C5a de ser humano humanizados adicionales Se generaron varias regiones variables de cadena pesada de anticuerpo anti-C5a humanizado adicionales, todas ellas, cuando se emparejaron con una región variable de cadena ligera común (la cadena ligera que tiene la secuencia de aminoácidos representada en SEC ID Nº: 16), se unieron a C5a de ser humano con una KD de menos que 1 nM según se determinó mediante análisis Biacore (véase más arriba para metodología). Todos estos anticuerpos humanizados adicionales se unieron específicamente a C5a de ser humano, pero no se unen a C5 de ser humano completamente plegada, a C4a o a C3a, según se determinó por análisis Octet (véase más arriba para metodología). Los anticuerpos humanizados adicionales contenían: (i) una región marco conservada de la región variable de cadena pesada 1, que contienen una de las siguientes secuencias de aminoácidos: QVQLVQSGAEVKKPGASVKVSCKASGYTFT (SEC ID Nº: 68) o QVQLVQSGSELKKPGASVKVSCKASGYTFT (SEC ID Nº: 69); (ii) una región marco conservada de la región variable de cadena pesada 2 que contiene una de las siguientes secuencias de aminoácidos: WVRQAPGQGLEWMG (SEC ID Nº: 70) o WVRQASGKGLEWVG (SEC ID Nº: 71); (iii) una región marco conservada de la región variable de cadena pesada 3 que contiene una de las siguientes secuencias de aminoácidos: RVTITRDTSASTAYMELSSLRSEDTAVYYCAR (SEC ID Nº: 72); RVTITADESTSTAYMELSSLRSEDTAVYYCAR (SEC ID Nº: 73); o RVTITRDRSMSTAYMELSSLRSEDTAMYYCAR (SEC ID Nº: 74); y una región marco conservada de la región variable de cadena pesada 4 que contiene la siguiente secuencia de aminoácidos: WGQGTTVTVSS (SEC ID Nº: 75). Las regiones variables de cadena pesada humanizadas adicionales, ejemplares, que comprenden uno o más de los conjuntos de regiones marco conservadas humanizadas adicionales, descritos en esta sección, se indican en la Figura 5.

ES 2 552 954 T3   Ejemplo 13. Uso de un anticuerpo anti-C5a de ser humano en un modelo de neutropenia de ratón Se utilizó un modelo murino de neutropenia de C5a, para evaluar la eficacia de un anticuerpo anti-C5a libre de ser humano in vivo. Para inducir neutropenia, se administró C5a de ser humano (C5ah) natural, purificada, a ratones Balb/c por medio de inyección intravenosa en la vena de la cola. El número de neutrófilos circulantes se evaluó hasta cinco minutos después de la administración de C5ah. Se encontró de forma consistente que la administración de 300 µg/kg de C5ah inducía la activación de neutrófilos según se midió mediante el ensayo de liberación de mieloperoxidasa (MPO) (véase Ejemplo 5 para uso con suero, en comparación a un sobrenadante de cultivo celular, citado anteriormente) y neutropenia (una reducción del número de neutrófilos circulantes). Además, los niveles plasmáticos de C5ah y del anticuerpo anti-C5a de ser humano BNJ383 (cuando se administró a ratones, citado posteriormente) también se midieron para establecer la respuesta farmacodinámica (véase abajo).

Se examinaron los recuentos de neutrófilos de sangre periférica antes del desafío con C5ah o con el control de vehículo. Comparados con los ratones de control tratados de forma simulada (1,37 ± 0,09 x 106 /ml), el recuento de neutrófilos en ratones tratados con anticuerpo anti-C5a libre de ser humano (1,32 ± 0,13 x 106 por ml a 24 mg/kg; P > 0,05) o con el Acm de control de isotipo (1,31 ± 0.10 x 106 por ml a 24 mg/kg; P>0,05) permanecieron igual. Estos resultados indicaron que el anticuerpo solo no inducía cambios en los recuentos de los neutrófilos circulantes.

Para evaluar la eficacia de un anticuerpo anti-C5a para inhibir la neutropenia inducida por C5ah en ratones, diferentes dosificaciones (24 mg/kg, 12 mg/kg, 6 mg/kg, y 3 mg/kg) del anticuerpo anti-C5a de ser humano BNJ383 se administraron a ratones Balb/c 24 horas antes de la inyección de C5ah. La administración del anticuerpo anti-C5a 24 horas por delante de C5ah, permitió estudiar las propiedades farmacodinámicas del anticuerpo durante la fase β de eliminación de anticuerpo de los ratones. Como se muestra en la Figura 6, el recuento de neutrófilos después del tratamiento se expresa como un porcentaje de la “medida basal” (donde el recuento a tiempo 0 es igual a 100%). En los ratones de control tratados de forma simulada, los recuentos de neutrófilos fueron del 79,02 ± 5,71%, 67,42 ± 3,23%, y 59,54 ± 2,11% de la medida basal a 1, 3 y 5 minutos post administración de C5ah, respectivamente. Los ratones tratados con el anticuerpo de control de isotipo mostraron una reducción significativa (P<0,01) en el recuento de neutrófilos, de 6,76 ± 0,81 % en el minuto 1, 6,68 ± 0,81 % a los 3 minutos, y 8,29 ± 0,79% a los 5 minutos después de la inyección intravenosa de C5ah. El anticuerpo anti-C5a mostró un efecto dependiente de dosis sobre la neutropenia inducida por C5ah. El anticuerpo anti-C5a bloqueó completamente la neutropenia a la mayor dosis, 24 mg/kg. Los recuentos de neutrófilos fueron 70,35 ± 8,64% en el minuto 1, 63,35 ± 6,08% a los 3 minutos, y 59,65 ± 6,51% a los 5 minutos, lo que fue comparable a los niveles de neutrófilos en los animales de control tratados de forma simulada en los mismos momentos. Las menores dosis de 12 mg/kg o 6 mg/kg del anticuerpo anti-C5a, también inhibieron de forma significativa la disminución de neutrófilos (12 mg/kg: 42,61 ± 5,12% al minuto 1, 45,33 ± 8,29% a los 3 minutos, y 41,02 ± 7,08% a los 5 minutos, P<0,01; 6 mg/kg: 18,00 ± 3,8 al minuto, 26,20 ± 4,44% a los 3 minutos, y 28,03 ± 4,51 % a los 5 minutos, P<0,05) después de la administración de C5ah, en comparación con el grupo de anticuerpo de control de isotipo de (6,76 ± 0,81% al minuto 1, 6,68 ± 0,81% a los 3 minutos, y 8,29 ± 0,79% a los 5 minutos). El anticuerpo de control de isotipo es un anticuerpo que se une al antígeno protector de ántrax 63 y contiene una región Fc de isotipo de IgG2/4 de ser humano. La administración de las dosis más bajas del anticuerpo anti-C5a (3 mg/kg) no redujo significativamente la neutropenia (6,28 ± 0,88% al minuto 1, 6,71 ± 2,14% a los 3 minutos, y 8,75 ± 2,98% a los 5 minutos, P>0,05). Véase la Figura 6. El anticuerpo anti-C5a de ser humano inhibe la liberación de MPO inducida por C5ah in vivo Como se discute más arriba, C5a de ser humano activa los neutrófilos a través de la unión de reacción cruzada del receptor de C5a de ratón. La liberación de mieloperoxidasa (MPO) es una consecuencia de la activación de neutrófilos a través de la unión de C5a a C5aR. Véase Darren et al. (2004) Mol Pharm 65(4):868-879. La inyección intravenosa en el ratón de C5a de ser humano recombinante puede inducir neutropenia y activar neutrófilos en circulación. La capacidad de un anticuerpo anti-C5a libre de ser humano para inhibir la liberación de MPO debido a la activación de neutrófilos in vivo, se evaluó usando el anticuerpo anti-C5a para unir C5ah libre y evitar la unión a la C5aR murina. Se realizó un experimento in vivo según se describe más arriba (en el que C5a de ser humano se administró a ratones). El nivel de MPO plasmática a tiempo 0 fue de 79,25 ± 22,88 ng/ml en el grupo de control tratado de forma simulada. Cinco minutos después de la inyección intravenosa del tampón de vehículo, los niveles de MPO no cambiaron significativamente (77,46 ± 21,21 ng/ml, P>0,05). Antes de la inyección intravenosa de C5ah, los niveles de MPO en los animales tratados con anticuerpo de control de isotipo (75,17 ± 14,66 ng/ml) o en los animales tratado con anticuerpo anti-C5a (87,57 ± 14,86 ng/ml) fueron comparables con los niveles observados en los animales de control tratado de forma simulada. Después de la inyección intravenosa de C5ah, los niveles de MPO a todas las dosis de C5a se elevaron y se mantuvieron a niveles significativamente mayores a los 5 minutos (Figura 7).

ES 2 552 954 T3   Cuando se comparan con los animales tratados con anticuerpo de control de isotipo (221,00 ± 51,02 ng/ml), los animales tratados con el anticuerpo anti-C5ah mostraron una reducción de los niveles de MPO dependiente de dosis (114,83 ± 23,26 ng/ml, P<0,05, en la cohorte de 24 mg/kg; 104,80 ± 29,83 ng/ml, P<0,05, en la cohorte 12 mg/kg; y 126,90 ± 36,40 ng/ml, P=0,08, en la cohorte de 6 mg/kg). Los niveles MPO de los animales tratados con el anticuerpo anti-C5a a baja dosis (3 mg/kg) (176,55 ± 23,05 ng/ml) no fueron diferentes, de forma significativa, de los animales tratados con el anticuerpo de control (P>0,05). Un anticuerpo anti-C5a reduce los niveles circulantes de C5ah en ratones Como se indica más arriba, C5a es un péptido inflamatorio potente con varias funciones biológicas. Estos estudios anteriores demostraron que C5a de ser humano reacciona de forma cruzada con C5aR murina en neutrófilos, ya que la inyección intravenosa de C5a de ser humano recombinante puede inducir neutropenia. Aunque esta divulgación de ninguna manera se limita por ninguna teoría en particular o mecanismo de acción, el anticuerpo anti-C5a podría estar inhibiendo la neutropenia inducida por C5a de ser humano mediante la formación de complejos con C5ah, y evitando la unión de C5ah a C5aR murina, expresada en la superficie celular. Los niveles de C5ah se midieron en el plasma de ratones antes, y a los 1, 3, y 5 minutos después, de la administración intravenosa de C5ah para confirmar que los efectos del anticuerpo anti-C5ah in vivo se debían a su inhibición, dependiente de unión, de C5ah. Se realizó un experimento según se describe más arriba usando el modelo de neutropenia inducida por C5ah de ratón. Usando un ensayo inmunoabsorbente ligado a enzimas (ELISA), no se detectó C5ah en el plasma de ninguno de los grupos de ratones antes de la administración de C5ah a tiempo 0. El nivel de C5ah en plasma, sin embargo, se incrementó hasta un máximo en el minuto 1 (7783,50 ± 327,73 ng/ml), después se redujo a 4.788,38 ± 260,51 ng/ml a los 3 minutos, y después a 3.855,75 ± 298,99 ng/ml a los 5 minutos después de la inyección intravenosa de C5ah (en los ratones tratado con Acm de control de isotipo). En comparación con los ratones de control tratados con anticuerpo, el nivel de C5ah en ratones tratados con 24 mg/kg del anticuerpo anti-C5a, mostraron un descenso de 43, 30, y 23 veces en el minuto 1 (178,4 ± 14,14 ng/ml), a los 3 minutos (158,4 ± 10,43 ng/ml), y a los 5 minutos (167,2 ± 15,61 ng/ml), respectivamente. El nivel de C5ah en plasma de las cohortes de 12 mg/kg y 6 mg/kg, fueron de 235,00 ± 22,33 y 609,20 ± 78,75 ng/ml en el minuto 1, de 210,80 ± 19,59 y 527,60 ± 52,25 ng/ml a los 3 minutos, de 192,20 ± 7,40 y 505,00 ± 45,96 ng/ml a los 5 minutos, respectivamente. Después de la inyección intravenosa de C5ah, los ratones tratados con anti-C5a mostraron niveles reducidos de forma significativa de C5ah, en una forma dependiente de dosis, durante la neutropenia (P <0,001). Aunque los ratones que recibieron las menores dosis de anticuerpo anti-C5a (3 mg/kg) no evitaron la neutropenia inducida por C5ah, no obstante los ratones tuvieron una reducción significativa de C5ah plasmática (3130,40 ± 433,58 ng/ml al minuto 1; 1932,00 ± 268,92 ng/ml a los 3 minutos; 1593,00 ± 169,68 ng/ml a los 5 minutos) en comparación con los niveles plasmáticos de C5ah encontrados en los ratones tratados con anticuerpo de control de isotipo (P <0.05). Véase Figura 8. Estos datos indican que la administración a ratones del anticuerpo anti-C5a, disminuyó de forma significativa la concentración de C5ah libre en plasma, resultando en una gran mejora de la neutropenia inducida por C5ah. Tomados juntos, estos resultados, presentados en esta sección, indican que un anticuerpo anti-C5a de ser humano descrito en el presente documento puede inhibir el efecto biológico de C5a de ser humano en un contexto de enfermedad in vivo y proporcionan una fuerte evidencia de que los anticuerpos (y los fragmentos de unión a antígeno de los mismo) son útiles en, entre otras cosas, tratar o prevenir trastornos asociados al complemento, tales como cualquiera de aquellos enumerados en el presente documento.

Ejemplo 14. El anticuerpo anti-C5a de ser humano reacciona de forma cruzada con C5a de primates que no son seres humanos. Se probó la capacidad de varios anticuerpos anti-C5ah humanizados de reaccionar de forma cruzada con C5a de una o más especies de mamíferos que no son seres humanos. Como se indica más arriba, los beneficios de tal anticuerpo anti-C5a son numerosos, por ejemplo, la capacidad de un investigador o facultativo médico para modelar la eficacia de un anticuerpo anti-C5a terapéutico en un modelo de enfermedad que no sea de ser humano, antes de la administración del anticuerpo a seres humanos. La prueba en mamíferos que no son seres humanos también puede permitir la determinación o aproximación de la dosificación apropiada de un anticuerpo anti-C5a, necesaria para la eficacia en seres humanos.

En resumen, se evaluaron BNJ369, BNJ366, BNJ364, y BNJ383 (descritos más arriba) para determinar si podrían coinmunoprecipitar proteína C5a en el suero activado de varios primates que no sean seres humanos, incluyendo babuino, mono rhesus, y mono cinomolgo. El suero se activó mediante la adición de zymosan. Después de una incubación de una noche de cada anticuerpo con suero activado, los anticuerpos se separaron de la fase en solución usando esferas de agarosa conjugadas a proteína A. Las esferas se lavaron minuciosamente y después se hirvieron en tampón de muestra de electroforesis en gel de poliacrilamina-dodecil sulfato de sodio (SDS-PAGE) conteniendo β-mercaptoetanol. Después las muestras hervidas se sometieron a SDS-PAGE. Se detectó C5a de primate que no es ser humano, mediante transferencia western utilizando el anticuerpo anti-neoepítopo de C5a #2942 disponible de forma comercial (Abeam, Cambridge, MA). Cada uno de los anticuerpos probados fue capaz de inmunoprecipitar C5a (o C5a desarginada) de babuino, mono rhesus, y mono cinomolgo, indicando que el anticuerpo es reactivo en forma cruzada con C5a de estas especies así, como con C5a de ser humano.

ES 2 552 954 T3   La determinación de los parámetros de la afinidad de unión para C5a de mono cinomolgo se determinó como se describe más arriba. En resumen, el anticuerpo BNJ383 se exploró frente a 3-4 concentraciones de C5a de mono cinomolgo recombinante (antígeno) usando una técnica de captura como se describe más arriba. El anticuerpo se capturó mediante un anti-Fc (de ser humano) directamente inmovilizado sobre un chip sensor CM5, con varias concentraciones en el intervalo desde 0,6 nM a 5,9 nM de C5a de mono cinomolgo, pasadas por encima de la superficie del chip sensor. La superficie se regeneró con ClH 20 mM, surfactante P20 al 0,02% (Biacore) después de cada ciclo para eliminar el anticuerpo y el antígeno unidos. Los datos se evaluaron usando el software BIAevaluation de Biacore usando un ajuste de modelo Langmuir 1:1 (Rmáx: ajuste global; RI: ajuste local). Estos experimentos se hicieron con el propósito de exploración, con un número mínimo de concentraciones de analito (3 a 4), con un duplicado. La KD aproximada del anticuerpo para C5a de mono cinomolgo es 3,3 nM. Véase la Tabla 10.

Tabla 10. Determinación de la afinidad por proteínas C5a que no son de ser humano Especies ka (1/Ms) (x 106) kd (1/s) (x 10-4) KD(M) (x 10-12) χ2 Ser humano 0,77 8,32 108 1,23 Mono cinomolgo 1,28 42,3 3300 1,45 Ratón 2,8 10,6 379* 2,38 *Esta es solamente una aproximación de la KD basada en la calidad del ajuste de la curva.

También se analizó el anticuerpo BNJ383 frente a 3-4 concentraciones de C5a de ratón recombinante (antígeno) usando una técnica de captura como se describe más arriba, para determinar su afinidad por proteína de ratón. El anticuerpo se capturó, como se describe más arriba, mediante un anti-Fc (de ser humano) inmovilizado directamente sobre un chip sensor CM5, con varias concentraciones en el intervalo desde 0,6 nM a 5,9 nM de C5a de ratón pasadas por encima de la superficie del chip sensor. La superficie se regeneró con ClH 20mM, P20 al 0,02%, después de cada ciclo para eliminar el anticuerpo y antígeno unidos. Los datos se evaluaron usando el software BIAevaluation de Biacore, usando un ajuste de modelo de Langmuir 1:1 (Rmáx: ajuste global; RI: ajuste local). Los resultados anteriores indican que varios de los anticuerpos anti-C5ah humanizados descritos en el presente documento, son reactivos de forma cruzada con C5a de varias especies de primate que no son ser humano incluyendo mono cinomolgo, mono rhesus, y babuino. El anticuerpo BNJ383, por ejemplo, también reacciona de forma cruzada con C5a de ratón. Además, los resultados descritos en esta sección indican que un anticuerpo anti- C5a de ser humano, tal como BNJ383, es útil no solamente en aplicaciones clínicas para tratar trastornos asociados al complemento, sino también en una diversidad de aplicaciones preclínicas en mamíferos que no sean seres humanos, las cuales son necesarias para, o apoyan, la aprobación del uso clínico en seres humanos.

Ejemplo 15. Competición por la unión a C5a Se realizó un experimento para evaluar la unión de un anticuerpo anti-C5a descrito en el presente documento, BNJ383, en presencia de antígenos potencialmente competitivos. En resumen, BNJ383 marcado con rutenio (250 pM) se incubó durante dos horas a temperatura ambiente con C5a biotinilada 1 nM, junto con varias concentraciones (por ejemplo, 400, 133, 44,4, 14,8, 4,9, 1,6, y 0,5 nM) de uno de los siguientes: (a) proteína C5a desarginada de ser humano en solución salina tamponada con fosfato, (b) plasma de ser humano, (c) plasma de mono cinomolgo, (d) plasma de Balb/C (ratón), o (e) plasma de DBA/2J (ratón). Con respecto a los componentes plasmáticos (b), (c), (d), y (e), la concentración se refiere a la concentración final aproximada de antígeno C5 en la mezcla de incubación.

Después del período de incubación, las muestras se pusieron en contacto con pocillos individuales respectivos de una placa de ensayo recubierta de estreptavidina, en condiciones que permitían la unión de C5a biotinilada a la estreptavidina en los pocillos de la placa. Los pocillos se lavaron minuciosamente para eliminar el material no unido. La cantidad de unión de BNJ383 a C5a en presencia de un competidor se determinó mediante la detección de la cantidad de señal producida por la marca de rutenio detectable. Los resultados se muestran en la Figura 9.

Mientras que C5a desarginada de ser humano fue un competidor efectivo, prácticamente no se observó competición en presencia de suero de ratón (17% de reducción de la señal detectable observada, a aproximadamente una proporción de 400:1 de C5 derivada de plasma de ratón Balb/C a C5a de ser humano biotinilada, y una reducción del 25% de la señal detectable observada aproximadamente una proporción 400:1 de C5a derivada de plasma de DBA2/J a C5a de ser humano biotinilada). No se observó cambio en el nivel de unión de BNJ383 a C5a de ser humano biotinilada, a hasta aproximadamente una proporción de 15:1 de C5 derivada de plasma de mono cinomolgo o de ser humano a C5a de ser humano biotinilada. Como se indica anteriormente, aunque la divulgación de ninguna manera se limita a ninguna teoría en particular o mecanismo de acción, los inventores formulan la hipótesis de que el anticuerpo anti-C5a se puede unir a una subpoblación de C5 procesada, no escindida (por ejemplo, C5 plasmática) constituyendo menos que el 10% de la población total de C5 de longitud completa en una muestra (por ejemplo, una muestra de plasma), estando la subpoblación en un todo o en parte desnaturalizada, de tal manera que un neoepítopo de C5a de otra manera obstaculizado, al cual se une el anticuerpo anti-C5a o un fragmento, está expuesto. Así, se cree que el anticuerpo no se une a una completamente funcional, y/o a especies de C5 completamente funcionales y así no se une en verdad

ES 2 552 954 T3   a C5 natural, no escindida. El plasma humano es un competidor al menos 30 a 100 veces más débil, de forma aproximada, por la unión a C5a biotinilada que a C5a desarginada de ser humano. A pesar de estas consideraciones, los resultados indican adicionalmente que anticuerpos anti-C5a de ser humano descritos en el presente documento, tales como BNJ383, se unen preferentemente a C5a de ser humano libre, incluso en presencia de hasta aproximadamente un exceso de 20 veces de proteína C5 de ser humano derivada de plasma, no necesariamente completamente natural, no escindida. Ejemplo 16. Efecto del anticuerpo anti-C5a sobre la actividad de la RA y la RC in vitro

Se realizó un experimento para evaluar el efecto de un anticuerpo anti-C5a descrito en el presente documento (BNJ383) sobre la actividad del complemento en la ruta alternativa (RA) in vitro usando sueros normales de ser humano agrupados (SNHA). El experimento utilizó el kit Wieslab® Alternative Pathway Complement Kit (Wieslab® COMPL AP330, Euro-Diagnostica, Suecia) y el protocolo asociado se siguió solamente con optimización de rutina, que está dentro del campo de alguien con las habilidades habituales dentro de la materia. En resumen, alícuotas de los SNHA se incubaron en pocillos de una placa recubierta de lipopolisacáridos durante una hora (a 37º C) junto con varias concentraciones (0,778, 0,389, 0,194, 0,097, 0,049, 0,024, 0,012, 0,006, 0,003, y 0,002 µM) de un anticuerpo anti-C5h o un anticuerpo anti-C5ah (BNJ383). El anticuerpo anti-C5 inhibe la escisión de C5 de ser humano en los fragmentos C5a y C5b; como control negativo, varios pocillos se incubaron con SNHA en las mismas condiciones, pero en ausencia de anticuerpo anti-C5h o anticuerpo anti-C5ah. Después de la incubación, los pocillos se lavaron minuciosamente con el tampón de lavado 1X suministrado con el kit. El nivel de activación del complemento en la ruta alternativa se midió mediante absorbancia a 405 nm, después de poner en contacto cada pocillo con un conjugado a enzima suministrado con el kit (un anticuerpo anti-C5b-9 conjugado a fosfatasa alcalina) y sustrato fluorogénico (sobre el que la enzima opera después) y se incubó durante 30 minutos a temperatura ambiente. Los resultados se muestran en la Figura 10. Aunque el anticuerpo anti-C5 inhibe completamente la actividad del complemento por la ruta alternativa a concentraciones mayores que 0,1 µM, el anticuerpo anti-C5ah no inhibe significativamente la actividad del complemento aún a las mayores concentraciones probadas. Se realizó un experimento, utilizando SNHA, para evaluar el efecto de un anticuerpo anti-C5a descrito en el presente documento (BNJ383) sobre la actividad del complemento de la ruta clásica (RC) in vitro. En el experimento se utilizó el kit Wieslab® Classical Pathway Complement Kit (Wieslab® COMPL CP310, Euro-Diagnostica, Suecia) y el protocolo asociado se siguió solo con optimización de rutina, la que está dentro del ámbito del experto con las habilidades habituales. En resumen, se incubaron alícuotas de los SNHA en pocillos de una placa recubierta de anticuerpo IgM de ser humano durante una hora (a 37º C) junto con varias concentraciones (7,2, 3,6, 1,8, 0,9, 0,45, 0,2, 0,1, 0,05, 0,02, o 0,01 µM) de un anticuerpo anti-C5h o un anticuerpo anti-C5ah (BNJ383). El anticuerpo anti-C5 inhibe la escisión de C5 de ser humano para dar los fragmentos C5a y C5b. Como un control, varios pocillos se incubaron con SNHA en las mismas condiciones, pero en ausencia de anticuerpo anti-C5h o anticuerpo anti-C5ah. Después de la incubación, los pocillos se lavaron minuciosamente con el tampón de lavado 1X suministrado con el kit. El nivel de la activación del complemento de la ruta alternativa se midió mediante absorbancia a 405 nm, después de poner en contacto cada pocillo con un conjugado a enzima suministrado con el kit (un anticuerpo anti- C5b-9 conjugado a fosfatasa alcalina) y sustrato fluorogénico (sobre el cual actúa la enzima después) e incubación durante 30 minutos a temperatura ambiente. Los resultados se muestran en la Figura 11. Aunque el anticuerpo anti-C5 inhibe completamente la actividad del complemento de la ruta clásica a concentraciones mayores que 0,1 µM, el anticuerpo anti-C5ah no inhibe significativamente la actividad del complemento incluso a la mayor concentración probada. Estos resultados tomados juntos indican que, in vitro, el anticuerpo anti-C5ah, BNJ383, no afecta significativamente la generación de C5b-9 (activación del complemento terminal) conducida ya sea por la ruta clásica o la alternativa del complemento, aportando así evidencia adicional de que los anticuerpos anti-C5ah descritos en el presente documento tienen como diana, de forma específica, el brazo anafilotoxina de C5a libre de la activación del complemento. Ejemplo 17. El anticuerpo anti-C5a conserva un sitio de unión a antígeno desocupado disponible para unirse a C5a incluso en presencia de un exceso molar de C5h El anticuerpo anti-C5a BNJ383 (indicado más arriba) se incubó a 4º C durante 84 horas en presencia de un exceso molar de 2,1 veces de C5 de ser humano (C5h) para permitir por completo la formación del complejo anticuerpo C5. Se realizó un experimento paralelo usando un anticuerpo que se une a C5 de ser humano, a una estequiometría de 2:1 (en lo sucesivo el anticuerpo anti-C5). Los complejos anticuerpo:C5 se resolvieron en una columna de exclusión por tamaño TSK™ G4000 SW (Tosoh, Tokio), utilizando un sistema de HPLC Waters™ 2690/5 con un detector de longitud de onda dual Waters™ W2487, para determinar la ocupación de los sitios de unión. Se observaron los picos

ES 2 552 954 T3   a una longitud de onda de 214 nm. La fase móvil para el análisis de HPLC contenía la siguiente composición de tampón: NaH2PO4 3,9 mM, Na2HPO4 6,1 mM, y NaCl 150 mM, a pH 7,0. El caudal fue de 1,0 ml por minuto y el tiempo de proceso fue de 20 minutos. Los datos se obtuvieron y analizaron con el software de cromatografía Waters Empower™ 2.

Como se describe en la Figura 12, BNJ383 solo (Figura 12A) y C5h sola (Figura 12B) se resuelven, cada una, como un pico único centrado en alrededor de los 10,2 minutos y > 95% de los complejos de anticuerpo anti-C5a:C5h se resuelven como un pico único centrado en alrededor de los 9,2 minutos (Figure 12C). En contraste, los complejos de C5h y el anticuerpo anti-C5 se resuelven en dos picos centrados en alrededor de los 8,6 minutos (39%) y 9,2 minutos (61%) (Figura 12D). Así, incluso en un exceso molar de C5h, el 95,2% del BNJ383 tiene un brazo Fab libre que puede ser capaz de unirse a C5a de ser humano. Estas muestras se examinaron adicionalmente para determinar si el anticuerpo BNJ383 conservaba la capacidad de unir C5a en presencia de concentraciones saturantes de C5. El anticuerpo libre, o complejos anticuerpo:C5, se titularon desde 500 a 0,5 ng/ml en una placa recubierta con estreptavidina, en la que se había inmovilizado C5ah conjugada a biotina. El anticuerpo capturado se detectó con un anticuerpo anti-Fc de ser humano conjugado a peroxidasa de rábano picante. Los resultados representados en la Figura 13 demuestran que incluso BNJ383 formando un complejo con C5h, es capaz de unir C5a y que la concentración de anticuerpo disponible para unir C5a no disminuye, de forma detectable, en la presencia de C5 saturante. Así, los resultados descritos en el presente documento indican que el anticuerpo, incluso en la presencia de un exceso molar de C5 no escindida, conserva la capacidad de unirse a C5a libre con alta afinidad y de esta forma conserva, incluso en ese exceso molar, la capacidad de inhibir la actividad proinflamatoria de C5a. Ejemplo 18. BNJ383 es un antagonista potente de C5a pero es un antagonista incompleto/parcial de la formación del complejo del complemento terminal in vivo Se administró de forma intravenosa a monos cinomolgos, una dosis única del anticuerpo anti-C5a BNJ383 de 1 mg/kg, 10 mg/kg, 100 mg/kg, 250 mg/kg o 400 mg/kg. Después de la administración del anticuerpo, se recogieron muestras de plasma de los monos a diferentes tiempos en el intervalo desde 1 día a 30 días. Se determinaron los niveles de C5a/C5a desarginada en plasma, mediante un ensayo de electroquimioluminiscencia (ECL) en el que un C5a libre/C5a desarginada se capturó sobre una placa de microtitulación recubierta con un anticuerpo específico por un neoepítopo sobre C5a/C5a desarginada y se detectó con un anticuerpo C5a no competitivo conjugado a un resto de ECL conteniendo rutenato, y se leyó en un lector de placa SECTOR 2400™ (MesoScale Discovery). Se determinaron las concentraciones circulantes de anticuerpo mediante un ensayo inmunoabsorbente ligado a enzima (ELISA) en el que el anticuerpo libre (BNJ383) se capturó en una placa de microtitulación recubierta con C5a desarginada de ser humano y se detectó con un anticuerpo de ratón anti-ser humano conjugado a peroxidasa de rábano picante (HRP). Como se muestra en la Figura 14, de forma similar a los resultados descritos en el Ejemplo 13, concentraciones circulantes de BNJ383 tan bajas como 10 µg/ml empobrecen los niveles plasmáticos de C5a/C5a desarginada por debajo de límites detectables en monos cinomolgos. Estos resultados también subrayan que el anticuerpo, incluso en presencia de un exceso molar de C5 no escindida, conserva la capacidad de unirse a C5a libre con una afinidad alta y de esta manera conservar, incluso en ese exceso molar, la capacidad de inhibir la actividad proinflamatoria de C5a.

Para determinar si BNJ383 tenía un efecto sobre la actividad hemolítica de suero de mono, el anticuerpo se evaluó en un ensayo de hemólisis de glóbulos rojos in vitro. El ensayo de hemólisis de glóbulos rojos se describe de forma general en detalle en, por ejemplo, Rinder et al.

(1995) J Clin Invest 96:1564-1572. En resumen, muestras de suero obtenidas de monos a los que se administró BNJ383 (como se describe más arriba) se añadieron a varios pocillos de una placa de ensayos de 96 pocillos, de manera que la concentración del suero en cada pocillo fue de aproximadamente 10%. Las muestras de suero, en virtud de los puntos de tiempo en los que se obtuvieron, contenían diversas concentraciones del anticuerpo BNJ383. La actividad hemolítica de los sueros de monos que no recibieron BNJ383, sirvió como un control negativo y como la medida basal del nivel de actividad hemolítica. Eritrocitos de pollo (Lampire Biological Laboratories, Pipervilie, PA) se lavaron y resuspendieron en tampón a una concentración final de 5 x 107 células/ml. Los eritrocitos se sensibilizaron para la lisis mediante la incubación de las células con una composición de anticuerpo policlonal anti glóbulo rojo de pollo. Los eritrocitos sensibilizados se añadieron a los pocillos de la placa de 96 pocillos y la placa se incubó a 37º C durante 30 minutos. La liberación de hemoglobina se midió mediante absorbancia aparente a 415 nm, utilizando un lector de microplaca. Como se muestra en la Figura 15A, en estas condiciones experimentales de ensayo hemolítico ex vivo, incluso altas concentraciones de BNJ383 no inhibieron considerablemente la hemólisis de eritrocitos.

ES 2 552 954 T3   También se evaluó el anticuerpo BNJ383 para determinar si este tenía un efecto sobre la activación del complemento de suero de mono, utilizando un ensayo CH50eq ex vivo. El ensayo CH50eq es un método para medir la actividad del complemento clásico total en suero. Esta prueba es un ensayo inmunoabsorbente ligado a enzimas, que usa gammaglobulinas de ser humano y anticuerpos monoclonales de ratón como el activador de la ruta del complemento clásica, y captura el complejo del complemento terminal (CCT) generado en un pocillo de microtitulación recubierto con un anticuerpo específico contra un neoepítopo del CCT. El CCT capturado se detecta con un anticuerpo de cabra anti-CCT conjugado a peroxidasa de rábano picante. El ensayo CH50eq proporciona una medida directa de la formación del complejo del complemento terminal (CCT).

Como se muestra en la Figura 15B, altas concentraciones de BNJ383 presentes en el suero de mono fueron capaces de inhibir de forma sustancial, la formación del CCT en estas condiciones ex vivo. Estos resultados indican que el anticuerpo BNJ383 no solo es capaz de unirse a y secuestrar C5a libre sino que también es capaz de, en función de la concentración, inhibir parcial o sustancialmente la formación del CCT.

Se realizó un experimento ex vivo para evaluar el efecto de BNJ383 sobre la actividad del complemento de la ruta clásica (RC), usando las muestras de suero de mono descritas más arriba. El experimento utilizó el kit Wieslab® Classical Pathway Complement Kit (Wieslab® COMPL CP310, Euro-Diagnostica, Suecia) y el protocolo asociado se siguió solo con optimización de rutina, que está dentro del ámbito del experto con habilidades habituales solamente con optimización de rutina que está dentro del ámbito del técnico con las habilidades habituales. En resumen, alícuotas de las muestras de suero de mono se incubaron en pocillos de una placa recubierta con anticuerpo IgM de ser humano, durante una hora. Como un control, varios pocillos se incubaron en las mismas condiciones con suero de monos a los que no se administró el anticuerpo BNJ383. Después de la incubación, los pocillos se lavaron minuciosamente con tampón de lavado 1X suministrado con el kit.

El nivel de la activación del complemento de la ruta alternativa se midió mediante absorbancia a 405 nM, después de poner en contacto cada pocillo con un conjugado a enzima suministrado con el kit (un anticuerpo anti-C5b-9 conjugado a fosfatasa alcalina) y un sustrato flourogénico (sobre el cual actuó la enzima después) e incubación durante 30 minutos a temperatura ambiente. Los resultados se muestran en la Figura 15C.

El anticuerpo anti-C5ah inhibió de forma significativa, aunque no de forma completa, la actividad del complemento en una manera dependiente de dosis. Estos resultados tomados juntos, descritos en el presente documento, indican que BNJ383 no solo es un antagonista potente de C5a, sino que también es un antagonista incompleto/parcial de la formación del complejo del complemento terminal in vivo. Así, el anticuerpo y los anticuerpos compartiendo estas propiedades, son útiles para tratar una diversidad de trastornos asociados al complemento, en los que la inflamación mediada por C5a es el contribuidor primario de los efectos patológicos nocivos, y el CCT podría desempeñar un papel menos significativo, e incluso beneficioso, en la patología. Aunque la presente divulgación se describió con referencia a las realizaciones específicas de la misma, los expertos en la técnica deberían entender que podrían hacerse diversos cambios y que los equivalentes podrían sustituirse.

Además, se pueden hacer muchas modificaciones para adaptar una situación particular, material, composición de la materia, proceso, etapa del proceso o etapas.

ES 2 552 954 T3  

REIVINDICACIONES

1. Un anticuerpo aislado o fragmento de unión a antígeno del mismo que se une a un polipéptido C5a libre, en el que el C5a libre es un polipéptido humano (C5ah) que tiene la secuencia de aminoácidos representada en SEC ID Nº: 1, y en el que el anticuerpo o fragmento de unión a antígeno del mismo se une al polipéptido C5ah libre in vitro con una KD que es menor que 1,25 x 10-9 M según se mide mediante resonancia de plasmón superficial (RPS) en presencia de un exceso molar de C5 de ser humano natural no escindido, y donde el anticuerpo o fragmento de unión a antígeno del mismo comprende: I.

(a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; o (ii) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y (b) un polipéptido de cadena pesada que comprende: (i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30; o (ii) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47; II.

(a) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27; (b) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada SEC ID Nº: 36 un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33; (c) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 27; (d) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 25; (e) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; (f) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 40 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33; (g) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 33; (h) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 19 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45; (i) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 44; (j) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 17 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49;

ES 2 552 954 T3   (k) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 37 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45; o (1) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 36 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49; o III.

(a) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 42 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 45; (b) un polipéptido de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 40 y un polipéptido de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 49; o 2. El anticuerpo aislado o fragmento de unión a antígeno del mismo de acuerdo a la reivindicación 1, en el que el anticuerpo o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: (i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30.

3. El anticuerpo aislado o fragmento de unión a antígeno del mismo de acuerdo a la reivindicación 1, en el que el anticuerpo o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 21; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47.

4. El anticuerpo aislado o fragmento de unión a antígeno del mismo de acuerdo a la reivindicación 1, en el que el anticuerpo o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: (i) una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 29; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 30.

5. El anticuerpo aislado o fragmento de unión a antígeno del mismo de acuerdo a la reivindicación 1, en el que el anticuerpo o fragmento de unión a antígeno del mismo comprende: (a) un polipéptido de cadena ligera que comprende: (i) una CDR1 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 20; una CDR2 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 38; y una CDR3 de cadena ligera que comprende la secuencia de aminoácidos representada en SEC ID Nº: 22; y un polipéptido de cadena pesada que comprende: una CDR1 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 28; una CDR2 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 46; y una CDR3 de cadena pesada que comprende la secuencia de aminoácidos representada en SEC ID Nº: 47.

ES 2 552 954 T3