Un anticuerpo anti-PDGFRalfa para su uso en el tratamiento de cáncer de huesos metastásico.

Un antagonista de PDGFRa, en el que dicho antagonista de PDGFRa es un anticuerpo o fragmento del mismo quees específico para PDGFRa humano y que comprende SSSYY

(SEC ID Nº: 2) en CDRH1; SFFYTGSTYYNPSLRS(SEC ID Nº: 4) en CDRH2; QSTYYYGSGNYYGWFDR (SEC ID Nº: 6) en CDRH3; RASQSVSSYLA (SEC ID Nº: 10) enCDRL1; DASNRAT (SEC ID Nº: 12) en CDRL2; y QQRSNWPPA (SEC ID Nº: 14) en CDRL3, para su uso en eltratamiento de cáncer de huesos metastásico en un sujeto.

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E09075102.

Solicitante: IMCLONE LLC.

Nacionalidad solicitante: Estados Unidos de América.

Dirección: 450 East 29th Street, 12th Floor New York, NY 10016 ESTADOS UNIDOS DE AMERICA.

Inventor/es: LOIZOS,NICK, DOLLOFF,NATHAN GRAEME, FATATIS,ALESSANDRO.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P35/00 (Agentes antineoplásicos)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/28 (contra receptores, antígenos celulares de superficie o determinantes celulares de superficie)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen péptidos... > A61K38/17 (que provienen de animales; que provienen de humanos)

PDF original: ES-2452115_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Un anticuerpo anti-PDGFRalfa para su uso en el tratamiento de cáncer de huesos metastásico La presente solicitud reivindica el beneficio de la solicitud provisional de EE.UU. nº 60/691.920.

Campo de la invención La divulgación proporciona procedimientos para tratar cáncer de huesos, particularmente cáncer de huesos metastásico, administrando un antagonista de IGF-IR y/o un antagonista de PDGFRα. La presente divulgación también proporciona anticuerpos que se unen a PDGFRα humano y neutralizan la activación del receptor. La presente divulgación proporciona además procedimientos para neutralizar la activación de PDGFRα, y procedimientos para tratar un mamífero con una enfermedad neoplásica usando los anticuerpos solos o en combinación con otros agentes.

Antecedentes de la invención El cáncer de próstata es el cáncer más común entre los hombres, con aproximadamente 220.000 casos y 29.000 muertes anualmente en los Estados Unidos. Una proporción significativa de hombres diagnosticados con cáncer de próstata tienen enfermedad metastásica. Además, las metástasis se desarrollan eventualmente en muchos otros pacientes con cáncer de próstata a pesar de tratamiento con cirugía o radioterapia. El hueso es el sitio más común de metástasis del cáncer de próstata, y también es un sitio al que frecuentemente metastatizan cánceres de mama y cánceres de pulmón. La mayoría de las metástasis del cáncer de próstata son dependientes de andrógenos, de manera que hay una rápida respuesta a castración quirúrgica o médica, pero en prácticamente todos los pacientes, el tumor se vuelve eventualmente independiente de andrógenos, conduciendo a morbilidad y mortalidad significativas. Una vez se producen las metástasis al hueso, las terapias actualmente disponibles tienen efecto limitado. La terapia aprobada más eficaz que se ha descrito para cáncer de próstata metastásico (administración de docetaxel) prolonga la mediana de la supervivencia aproximadamente tres meses. (Petrilak y col., 2004, N. Engl. J. Med. 351:1513; Tannock y col., 2004, N. Engl. J. Med. 351:1502) Por consiguiente, se necesitan urgentemente nuevas terapias para cánceres de huesos metastásicos.

El factor de crecimiento similar al receptor de la insulina (IGF-IR) es un receptor de tirosina cinasas transmembrana ubicuo que es esencial para el crecimiento y desarrollo normal fetal y post-natal. El IGF-IR se localiza sobre la superficie celular de la mayoría de los tipos de células y sirve de molécula de señalización para los factores de crecimiento IGF-I y IGF-II (conjuntamente llamados en adelante IGF) . El IGF-IR puede estimular la proliferación celular, diferenciación celular, cambios en el tamaño de células y proteger células de la apoptosis. También se ha considerado que es casi obligatorio para la transformación celular (revisado en Adams y col., Cell. Mol. Life Sci. 57:1050-93 (2000) ; Baserga, Oncogene 19:5574-81 (2000) ) . Se ha informado de altos niveles de expresión de IGF-IR en muestras de tejido de metástasis al hueso de cáncer de próstata. El hueso contiene el mayor almacén de IGF en el cuerpo.

El IGF-IR es un heterotetrámero preformado que contiene dos cadenas alfa y dos beta covalentemente ligadas por enlaces disulfuro. Las subunidades de receptor se sintetizan como parte de una única cadena de polipéptidos de 180 kd, que luego se procesa proteolíticamente en subunidades alfa (130 kd) y beta (95 kd) . La cadena alfa entera es extracelular y contiene el sitio para la unión a ligando. La cadena beta posee el dominio transmembrana, el dominio de tirosina cinasa y una extensión del extremo C que es necesaria para la diferenciación y transformación celular, pero es dispensable para la señalización y protección de mitógeno de la apoptosis.

El IGF-IR es altamente similar al receptor de insulina (IR) , particularmente dentro de la secuencia de la cadena beta (70 % de homología) . Debido a esta homología, estudios recientes han demostrado que estos receptores pueden formar híbridos que contienen un dímero de IR y un dímero de IGF-IR (Pandini y col., Clin. Canc. Res. 5:1935-19 (1999) ) . La formación de híbridos se produce en tanto células normales como transformadas y el contenido de híbrido depende de la concentración de los dos receptores de homodímero (IR y IGF-IR) dentro de la célula. Aunque los receptores de híbrido están compuestos por pares de IR y IGF-IR, los híbridos se unen selectivamente a IGF, con afinidad similar a la de IGF-IR, y solo se unen débilmente a insulina (Siddle y Soos, The IGF System. Humana Press. pág. 199-225. 1999) . Por tanto, estos híbridos pueden unirse a IGF y transducir señales en tanto células normales como transformadas.

Un segundo receptor de IGF, IGF-IIR, o receptor de manosa-6-fosfato (M6P) , también se une a ligando de IGF-II con alta afinidad, pero carece de actividad de tirosina cinasas (Oates y col., Breast Cancer Res. Treat. 47:269-81 (1998) ) . Debido a que produce la degradación de IGF-II, se considera un sumidero para IGF-II, antagonizando los efectos promotores del crecimiento de este ligando. La pérdida de IGF-IIR en células tumorales puede potenciar el potencial de crecimiento mediante la liberación de su efecto antagonista sobre la unión de IGF-II con IGF-IR (Byrd y col., J. Biol. Chem. 274:24408-16 (1999) ) .

Los receptores alfa y beta del factor de crecimiento derivado de plaquetas (PDGFRα y PDGFRβ) son tirosina cinasas de receptor tipo III. PDGFRα es crítico para el desarrollo y satisface importantes funciones en la edad adulta. Por ejemplo, ratones homocigóticos para una mutación nula mueren durante la embriogénesis. En etapas tardías del

desarrollo, PDGFRα se expresa en muchas estructuras mesenquimatosas, mientras que células epiteliales adyacentes producen factores de crecimiento derivados de plaquetas (PDGF) . Las muestras de tejido de glándulas prostáticas normales o hiperplásicas dan negativo para PDGFRα, mientras que tumores de próstata primarios y masas esqueléticas de sujetos similares expresan PDGFRα. Además de líneas celulares de próstata obtenidas de diferentes sitios metastásicos, PDGFRα se encuentra en células PC3 derivadas de metástasis al hueso, pero no en líneas celulares obtenidas de metástasis al ganglio linfático (LNCaP) y cerebro (DU-145) .

La familia de factores de crecimiento derivados de plaquetas de factores de crecimiento consiste en cinco dímeros ligados por disulfuro diferentes, PDGF-AA, -BB, -AB, -CC y -DD, que actúan mediante PDGFRα y PDGFRβ. Estos factores de crecimiento son moléculas dímeras compuestas por cadenas de polipéptidos ligadas por disulfuro que se unen a dos proteínas de receptor simultáneamente e inducen la dimerización de receptores, autofosforilación y señalización intracelular. PDGFRα y PDGFRβ son estructuralmente similares y pueden formar heterodímeros, además de homodímeros. Debido a que PDGFRβ no se une a la cadena de PDGF-A con alta afinidad, PDGF-AA activa solo dímeros de receptores αα, mientras que PDGF-AB y PDGF-CC activan heterodímeros de receptores αα y αβ.

Breve resumen de la invención La presente divulgación se refiere al tratamiento de tumores óseos primarios y metastásicos, que incluyen tumores que se originan en la próstata, mama o pulmón y expresan factor de crecimiento similar al receptor de la insulina-I (IGF-IR) y/o el receptor de factor de crecimiento derivado de plaquetas alfa (PDGFRα) .

Los tumores a tratar pueden ser dependientes de hormona/andrógenos o independientes de hormona/andrógenos, y pueden haberse originado, por ejemplo, en la próstata, mama o pulmón.

La presente divulgación proporciona... [Seguir leyendo]

 


Reivindicaciones:

1. Un antagonista de PDGFRα, en el que dicho antagonista de PDGFRα es un anticuerpo o fragmento del mismo que es específico para PDGFRα humano y que comprende SSSYY (SEC ID Nº: 2) en CDRH1; SFFYTGSTYYNPSLRS (SEC ID Nº: 4) en CDRH2; QSTYYYGSGNYYGWFDR (SEC ID Nº: 6) en CDRH3; RASQSVSSYLA (SEC ID Nº: 10) en CDRL1; DASNRAT (SEC ID Nº: 12) en CDRL2; y QQRSNWPPA (SEC ID Nº: 14) en CDRL3, para su uso en el tratamiento de cáncer de huesos metastásico en un sujeto.

2. El antagonista de PDGFRα para su uso según la reivindicación 1, en el que el anticuerpo o fragmento del mismo comprende un dominio variable de la cadena pesada que tiene

QLQLQESGPGLVKPSETLSLTCTVSGGSINSSSYYWGWLRQSPGKGLEWIGSFFY TGSTYYNPSLRSRLTISVDTSKNQFSLMLSSVTAADTAVYYCARQSTYYYGSGNY YGWFDRWDQGTLVTVSS ( SEC ID Nº: 8) o un dominio variable de la cadena ligera que tiene EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRAT GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPAFGQGTKVEIK (SEC ID Nº: 16) .

3. El antagonista de PDGFRα para su uso según la reivindicación 1, en el que el anticuerpo o fragmento del mismo comprende un dominio variable de la cadena pesada que tiene

QLQLQESGPGLVKPSETLSLTCTVSGGSINSSSYYWGWLRQSPGKGLEWIGSFFY TGSTYYNPSLRSRLTISVDTSKNQFSLMLSSVTAADTAVYYCARQSTYYYGSGNY YGWFDRWDQGTLVTVSS (SEC ID Nº: 8) y un dominio variable de la cadena ligera que tiene EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRAT GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPAFGQGTKVEIK (SEC ID Nº: 16) .

4. El antagonista de PDGFRα para su uso según la reivindicación 3, en el que el anticuerpo o fragmento del mismo comprende una cadena pesada que tiene

MGWSCIILFLVATATGVHSQLQLQESGPGLVKPSETLSLTCTVSGGSINSSSYYWG WLRQSPGKGLEWIGSFFYTGSTYYNPSLRSRLTISVDTSKNQFSLMLSSVTAADT AVYYCARQSTYYYGSGNYYGWFDRWDQGTLVTVSSASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS SLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVV SVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK (SEC ID Nº: 31) y una cadena ligera que tiene MGWSCIILFLVATATGVHSEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQ QKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSN WPPAFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGEC (SEC ID Nº: 33) .

5. El antagonista de PDGFRα para su uso según una cualquiera de las reivindicaciones precedentes, en el que el tumor ha metastatizado de un cáncer de próstata, cáncer de mama o cáncer de pulmón.

6. El antagonista de PDGFRα para su uso según una cualquiera de las reivindicaciones 1 a 4, en el que el anticuerpo o fragmento del mismo inhibe la unión de PDGFRα o neutraliza PDGFRα.