Anticuerpo anti-adrenomedulina (ADM) o fragmento de anticuerpo anti-ADM o andamiaje proteico sin Ig anti-ADM para su utilización en tratamientos.

Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento

, en el que dicho anticuerpo, fragmento o andamiaje se une a la parte del terminal N, aminoácidos 1 a 21, de adrenomedulina:

YRQSMNNFQGLRSFGCRFGTC; SEC. ID. nº 23.

Tipo: Patente Europea. Resumen de patente/invención. Número de Solicitud: E12193121.

Solicitante: AdrenoMed AG.

Nacionalidad solicitante: Alemania.

Dirección: Neuendorfstrasse 15a 16761 Hennigsdorf ALEMANIA.

Inventor/es: BERGMANN, ANDREAS.

Fecha de Publicación: .

Clasificación Internacional de Patentes:

  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > PREPARACIONES DE USO MEDICO, DENTAL O PARA EL ASEO... > Preparaciones medicinales que contienen antígenos... > A61K39/395 (Anticuerpos (aglutininas A61K 38/36 ); Inmunoglobulinas; Inmunosuero, p. ej. suero antilinfocitario)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P31/00 (Antiinfecciosos, es decir antibióticos, antisépticos, quimioterápicos)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > A61P9/00 (Medicamentos para el tratamiento de trastornos en el aparato cardiovascular)
  • SECCION A — NECESIDADES CORRIENTES DE LA VIDA > CIENCIAS MEDICAS O VETERINARIAS; HIGIENE > ACTIVIDAD TERAPEUTICA ESPECIFICA DE COMPUESTOS QUIMICOS... > Medicamentos para el tratamiento del aparato urinario... > A61P13/12 (de los riñones)
  • SECCION C — QUIMICA; METALURGIA > QUIMICA ORGANICA > PEPTIDOS (péptidos que contienen β -anillos lactamas... > Inmunoglobulinas, p. ej. anticuerpos mono o policlonales > C07K16/26 (contra hormonas)

PDF original: ES-2494191_T3.pdf

 

google+ twitter facebook

Fragmento de la descripción:

Anticuerpo anti-adrenomedulina (ADM) o fragmento de anticuerpo anti-ADM o andamiaje proteico sin Ig anti-ADM para su utilización en tratamientos.

Campo de la invención

Es objeto de la presente exposición un anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti- adrenomedulina o un andamiaje proteico sin Ig anti-ADM, en los que dicho anticuerpo, fragmento o andamiaje es un anticuerpo no neutralizante.

Es objeto de la presente exposición un anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti- adrenomedulina o un andamiaje proteico sin Ig anti-ADM, en los que dicho anticuerpo, fragmento o andamiaje es

un anticuerpo estabilizante de ADM o un fragmento de anticuerpo estabilizante de ADM o un andamiaje proteico sin Ig estabilizante de ADM que aumenta la vida media (ti/2 tiempo medio de retención) de adrenomedulina en el suero, sangre, plasma, por lo menos el 10%, preferentemente por lo menos, el 50%, más preferentemente > 50%, aún más preferentemente > 100% y/o

en el que dicho anticuerpo estabilizante de ADM o un fragmento de anticuerpo estabilizante de adrenomedulina o un andamiaje proteico sin Ig estabilizante de ADM bloquea la bioactividad de ADM hasta menos del 80%, preferentemente menos del 50%.

Lo expuesto anteriormente se refiere al sentido de bloquear la bioactividad de ADM no superior al 80% ni superior al 50%, respectivamente, y por lo tanto debe entenderse como bloqueo limitado de la bioactividad de ADM o reducción de la bioactividad de ADM por el respectivo enlazador de ADM, que es un anticuerpo o un fragmento de anticuerpo o un andamiaje proteico sin Ig estabilizante de ADM. Por implicación, esto significa que continúa habiendo bioactividad de ADM. Por ejemplo, en caso de bloqueo de la bioactividad de ADM no superior al 80%, es decir aproximadamente el 20% de la bioactividad restante de ADM presente. En caso de bloqueo de la bioactividad de ADM no superior al 50%, es decir aproximadamente el 50% de la bioactividad restante de ADM presente.

Es objeto de la presente exposición un anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti- adrenomedulina o un andamiaje proteico sin Ig anti-ADM, en los que dicho anticuerpo, fragmento o andamiaje se une a la parte del terminal N (aa 1-21) de adrenomedulina humana.

En una forma de realización preferida el objeto de la presente exposición es un anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-adrenomedulina o un andamiaje proteico sin Ig anti-ADM, en los que dicho anticuerpo, fragmento o andamiaje se une a la parte del terminal N (aa 1) de adrenomedulina humana.

Antecedentes

El péptido adrenomedulina (ADM) se describió por primera vez en 1993 (Kitamura, K., et a/.,"Adrenomedullin: A Novel Hypotensive Peptide Isolated From Human Pheochromocytoma", Biochemical and Blophyslcal Research Communications, vol. 192 (2), págs. 553-560 (1993)) como nuevo péptido hipotensor que comprende 52 aminoácidos, que había sido aislado a partir de un feocromocitoma humano; SEC. ID. n° 21. En el mismo año, se describieron también el ADNc que codifica un péptido precursor que comprende 185 aminoácidos y la secuencia de aminoácidos completa de este péptido precursor. El péptido precursor, que comprende, entre otras cosas, una secuencia señal de 21 aminoácidos en el extremo del terminal en N, es conocido como"preproadrenomedul¡na" (pre- proADM). En la presente descripción, todas las posiciones de los aminoácidos especificados por lo general se refieren a la pre-proADM que comprende los 185 aminoácidos. El péptido adrenomedulina (ADM) es un péptido que comprende 52 aminoácidos (SEC. ID. n° 21) y que comprende los aminoácidos 95 a 146 de la pre-proADM, de la que se forma por escisión proteolítica. Hasta la fecha, sustanclalmente sólo unos pocos fragmentos de los fragmentos peptídicos formados en la escisión de la pre-proADM se han caracterizado más exactamente, en particular, la péptidos fisiológicamente activos adrenomedulina (ADM) y"MAPP", un péptido que comprende 20 aminoácidos (22-41) que sigue a los 21 aminoácidos del péptido señal en la pre-proADM. El descubrimiento y caracterización de ADM en 1993 desencadenó intensa actividad de investigación, cuyos resultados se han resumido en diversos artículos de revistas, en el contexto de la presente descripción, haciendo referencia en particular a los artículos que se encuentran en un número de"Peptides"dedicado a ADM en particular (Editorial, Takahashi, K.,"Adrenomedullin: from a pheochromocytoma to the eyes", Peptides, vol. 22, pág. 1691 (2001)) y (Eto, T.,"A revlew of the biological properties and clinical implications of adrenomedullln and proadrenomedullln N-termmal 20 peptide (MAPP), hypotensive and vasodilating peptides", Peptides, vol. 22, págs. 1693-1711 (2001)). Una nueva reseña es (Hinson, ef a/.,"Adrenomedullin, a Multifunctional Regulatory Peptide", Endocrine Reviews, vol. 21(2), págs. 138-167 (2000)). En las investigaciones científicas hasta la fecha, se ha descubierto, entre otras cosas, que ADM puede considerarse como un péptido regulador polifuncional. Se libera en la circulación en una forma inactiva extendida por la glicina (Kitamura, K., et al."The intermedíate form of glycine-extended adrenomedullln is the major circulating molecular form in human plasma", Biochem. Biophys. Res. Commun., vol. 244 (2), págs. 551-555 (1998). Sólo

resumen). Existe también una proteína de unión (Pió, R., et a/.,"Complement Factor H is a Serum-binding Protein for adrenomedullin, and the Resulting Complex Modulates the Bioactivities of Both Partners", The Journal of Biological Chemistry, vol. 276(15), págs. 12292-12300 (2001)) que es específico para ADM y probablemente del mismo modo modula el efecto de ADM. Esos efectos fisiológicos de ADM, así como de MAPP, que son de vital importancia en las investigaciones hasta la fecha eran los efectos que influyen en la presión arterial.

Por consiguiente, ADM es un vasodilatador eficaz, y por lo tanto es posible asociar el efecto hipotensor con los segmentos peptídicos específicos en la parte del terminal C de ADM. Además, se ha constatado que el péptido MAPP más fisiológicamente activo mencionado anteriormente formado a partir de pre-proADM presenta asimismo un efecto hipotensor, incluso si parece que tiene un mecanismo de acción diferente del de ADM (véase además de los artículos de la reseña antes citados (Eto, T.,"A review of the biological properties and clinical implications of adrenomedullin and proadrenomedullin N-terminal 20 peptide (MAPP), hypotensive and vasodilating peptides", Peptides, vol. 22, págs. 1693-1711 (2001)) y (Hinson, et a/.,"Adrenomedullin, a Multifunctional Regulatory Peptide", Endocrine Reviews, vol. 21(2), págs. 138-167 (2000)) también (Kuwasako, K., et a/.,"Purification and characterization of MAPP-12 (MAPP-20) in porcine adrenal medulla as a major endogenous biologically active peptide", FEBS Lett, vol. 414(1), págs. 105-110 (1997). Resumen solamente), (Kuwasaki, K., et al." Increased plasma proadrenomedullin N-terminal 20 peptide in patients with essential hypertension", Ann. Clin. Biochem., vol. 36 (Pt. 5), págs. 622-628 (1999). Resumen solamente) o (Tsuruda, T., et a/.,"Secretion of proadrenomedullin N-terminal 20 peptide from cultured neonatal rat cardiac cells", Life Sci.., vol. 69 (2), págs. 239-245 (2001). Resumen solamente) y el documento EP-A2 0 622 458). Además, se ha constatado que las concentraciones de ADM que se pueden medir en la circulación y otros líquidos biológicos son, en numerosos estados patológicos, significativamente superiores a las concentraciones que se encuentran en las personas de referencia sanas. Por lo tanto, la concentración de ADM en pacientes con insuficiencia cardíaca congestiva, infarto de miocardio, enfermedades renales,... [Seguir leyendo]

 


Reivindicaciones:

1. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento, en el que dicho anticuerpo, fragmento o andamiaje se une a la parte del terminal N, aminoácidos 1 a 21, de adrenomedulina:

YRQSMNNFQGLRSFGCRFGTC; SEC. ID. n° 23.

2. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento según la reivindicación 1, en el que dicho anticuerpo, fragmento de anticuerpo o andamiaje es monoespecífico.

3. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento según la reivindicación 1 o 2, en el que dicho anticuerpo, fragmento o andamiaje presenta una afinidad de unión a ADM de por lo menos 10'7 M.

4. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento, según cualquiera de las reivindicaciones 1 a 3, en el que dicho anticuerpo, fragmento o andamiaje no es la proteína-1 de unión a ADM, factor H del complemento.

5. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento, en el que dicho anticuerpo, dicho fragmento o dicho andamiaje según cualquiera de las reivindicaciones 1 a 4 se une a un epítopo que contiene el extremo del terminal N; el aminoácido 1; de adrenomedulina.

6. Anticuerpo anti-adrenomedulina (ADM) o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o el andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento según cualquiera de las reivindicaciones 1 a 5, caracterizado por que dicho anticuerpo, fragmento de anticuerpo o andamiaje sin Ig no se une a la parte del terminal C de ADM, que son los aminoácidos 43-52 de ADM

PRSKISPQGY-NH2; SEC. ID. n° 25.

7. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento según cualquiera de las reivindicaciones 1 a 6, en el que dicho anticuerpo, dicho fragmento o dicho andamiaje es un anticuerpo, fragmento o andamiaje estabilizante de ADM que aumenta la vida media, el tiempo medio de retención t-i/2, de adrenomedulina en el suero, la sangre, el plasma, por lo menos el 10%, o por lo menos el 50%, o > 50%, o el 100% y/o en el que dicho anticuerpo, fragmento o andamiaje bloquea la bioactividad de ADM circulante no más del 50%, como se determina en un análisis funcional de cAMP receptor de adrenomedulina recombinante humana.

8. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento según cualquiera de las reivindicaciones 1 a 7, en el que dicho anticuerpo, fragmento o andamiaje es un anticuerpo, fragmento o andamiaje anti-ADM modulador que aumenta la vida media, el tiempo medio de retención t-i/2, de adrenomedulina en el suero, la sangre, el plasma, por lo menos el 10%, o por lo menos el 50%, o > 50%, o el 100% y que bloquea la bioactividad de ADM a no más del 50%, según se determina en un análisis funcional de cAMP receptor de adrenomedulina recombinante humana.

9. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina para su utilización como medicamento según cualquiera de las reivindicaciones 1 a 8, en el que dicho anticuerpo o fragmento es un anticuerpo monoespecífico o un fragmento de anticuerpo monoespecífico que se une a ADM o un fragmento de anticuerpo del mismo que se une a ADM, en el que la cadena pesada comprende las secuencias:

SEC. ID. n° 1 GYTFSRYW

SEC. ID. n° 2 ILPGSGST

SEC. ID. n° 3 TEGYEYDGFDY

y comprendiendo la cadena ligera las secuencias

SEC. ID. n° 4 QSIVYSNGNTY

SEC. ID. n° 5 RVS

SEC. ID. n° 6 FQGSHIPYT.

10. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina para su utilización como medicamento según cualquiera la reivindicación 9, en el que dicho anticuerpo o fragmento es un anticuerpo o fragmento monoespecífico que se une a ADM o un fragmento de anticuerpo del mismo, en el que dicho anticuerpo o fragmento comprende las secuencias:

SEC. ID. n° 7;

AM-VH-C

QVQLQQSGAELMKPGASVKJSCKATGYTFSRYWIEWVKQRPGHGLEWIGEILPGSGS

TNYNEKFKGKATITADTSSNTAYMQLSSLTSEDSAVYYCTEGYEYDGFDYWGQGTT

ltvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf

PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKHHHHHH

SEC ID n°: 8;

AM-VH1

qvqlvqsgaevkkpgssvkvsckasgytfsrywiswvrqapgqglewmgrilpgsg

stnyaqkfqgrvtitadeststaymelsslrsedtavyyctegyeydgfdywgqgt

tvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht

fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkhhhhhh

SEC ID n°: 9;

AM-VH2-E40

qvqlvqsgaevkkpgssvkvsckasgytfsrywiewvrqapgqglewmgrilpgsg

stnyaqkfqgrvtitadeststaymelsslrsedtavyyctegyeydgfdywgqgt

tvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht

fpavlqssglyslsswtvpssslgtqtyicnvnhkpsntkvdkrvepkhhhhhh

SEC ID n°: 10;

AM-VH3-T26-E55

qvqlvqsgaevkkpgssvkvsckatgytfsrywiswvrqapgqglewmgeilpgsg

stnyaqkfqgrvtitadeststaymelsslrsedtavyyctegyeydgfdywgqgt

TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT

FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKHHHHHH

SEC ID n°: 11;

AM-VH4-T26-E40-E55

QVQLVQSGAEVKKPGSSVKVSCKATGYTFSRYWIEWVRQAPGQGLEWMGEILPGSG

STNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCTEGYEYDGFDYWGQGT

TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT

FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKHHHHHH

SEC ID n°: 12;

AM-VL-C

DVLLSQTPLSLPVSLGDQATISCRSSQSIVYSNGNTYLEWYLQKPGQSPKLLIYRVSNR FSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPYTFGGGTKLEIKRTVAAP S VFIFPPSDEQLKSGT ASW CLLNNFYPRE AKVQ WKVDNALQSGN SQES VTEQD SKD STYSLS STLTLSKAD Y EKHKVYACEVTHQGLSSPVTKSFNRGEC

SEC ID n°: 13;

AM-VL1

DWMTQSPLSLPVTLGQPASISCRSSQSIVYSNGNTYLNWFQQRPGQSPRRLrYRVSN

RDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHIPYTFGQGTKLEIKRTVA

APSWIFPPSDEQLKSGTASWCLLNNPYPREAKVQWKVDNALQSGNSQESVTEQDS

KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

SEC ID n°: 14;

AM-VL2-E40

DWMTQSPLSLPVTLGQPASISCRSSQSrVYSNGNTYLEWFQQRPGQSPRRLIYRVSNR DSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHEPYTFGQGTKLEIKRTVAA PSVFIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK D STYS LSSTLTLSKAD Y EKHKVY ACE VTHQGLS SP VTKSFNRGEC

11. Anticuerpo antl-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina según cualquiera de las reivindicaciones 1 a 10 y un vasopresor, por ejemplo, catecolamina para su utilización como medicamento.

12. Anticuerpo antl-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina según cualquiera de las reivindicaciones 1 a 10 y una administración de fluido por vía intravenosa para su utilización como medicamento.

13. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina según cualquiera de las reivindicaciones 1 a 10, y un anticuerpo contra el TFN-alfa para su utilización como medicamento.

14. Anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina según cualquiera de las reivindicaciones 1 a 11 y antibióticos para su utilización como medicamento.

15. Composición farmacéutica, que comprende un anticuerpo anti-adrenomedulina o un fragmento de anticuerpo anti-ADM que se une a adrenomedulina o un andamiaje proteico sin Ig anti-ADM que se une a adrenomedulina para su utilización como medicamento según cualquiera de las reivindicaciones 1 a 14.