2,128 Patentes de julio de 2015 (pag. 23)

  1. 705.-

    Procedimiento para la producción continua de una mezcla de aislamiento térmico que comprende partículas de ácido silícico y partículas de agente opacificante, caracterizado por que una corriente pre-mezclada que comprende un gas de soporte, partículas de ácido silícico y partículas de agente opacificante se incorpora en un molino por rebotamiento fino, allí se muele y mezcla y, a continuación, el sólido se separa de la corriente de gas, y en el que el molino por rebotamiento fino es un molino de torbellino...

  2. 706.-

    Un método de ensamblar un producto farmacéutico que tiene al menos tres componentes sólidos de comprimidos formados de manera independiente, estando el método caracterizado por: suministrar uno separado de al menos dichos tres componentes sólidos de comprimidos a partir de uno separado de al menos tres almacenes de componentes, dispensar al menos dichos tres componentes sólidos de comprimidos a partir de al menos dichos tres almacenes de componentes; aplicar un líquido de unión al menos a uno de dichos tres componentes de comprimidos; posicionar al menos dichos tres componentes sólidos de comprimidos que son dispensados desde al menos dichos tres almacenes de componentes; conectar juntos al menos dichos tres componentes...

  3. 707.-

    Un ácido nucleico aislado para su uso en terapia, en el que dicho ácido nucleico aislado comprende una secuencia antisentido complementaria a un fragmento de la secuencia que codifica para la proteína de resistencia a la kanamicina, fragmento que es de al menos 50 nucleótidos de longitud y en el que dicho ácido nucleico aislado es capaz de provocar una respuesta inmunitaria en un mamífero.

  4. 708.-

    Un cartucho para albergar y dispensar aplicadores de veteado para un aparato de veteado automático que tiene un soporte de cartucho, de tal manera que el cartucho incluye: - una caja con un extremo de dispensación, un eje longitudinal y una ranura alargada, de tal modo que el extremo de dispensación incluye una posición de dispensación de aplicador en la que un aplicador puede ser al menos parcialmente accesible desde el exterior de la caja; y - un miembro de soporte de aplicadores, confinado dentro de la caja para su movimiento longitudinal en su interior y que es capaz de portar una pila de aplicadores; de tal modo que la ranura alargada es capaz de recibir operativamente un miembro de carga cuando el cartucho...

  5. 709.-

    Un compuesto 4-amino-tieno[2,3-d]-pirimidina para combatir o controlar insectos, arácnidos o nematodos de fórmula I:**Fórmula** donde X se selecciona a partir de halógeno, alquilo C1-C10 o haloalquilo C1-C10; R1 se selecciona a partir del grupo compuesto por hidrógeno, halógeno, formilo, alquilo C1-C10, alquenilo C1- C10, alquinilo C1-C10, haloalquilo C1-C10, haloalquenilo C1-C10, haloalquinilo C1-C10, alcoxi C1-C10, alcoxi C1- C6-alquilo C1-C6, haloalcoxi C1-C10, alquiltio C1-C10, haloalquiltio C1-C10, alquilsulfinilo C1-C10, haloalquilsulfinilo C1-C10, alquilsulfonilo C1-C10, haloalquilsulfonilo C1-C10, alquilamino C1-C10, haloalquilamino C1-C10, di(alquil C1-C10)amino, di(C1-C10)-haloalquilamino,...

  6. 710.-

    Un método para la detección de carcinoma colorrectal en un sujeto, que comprende determinar el nivel de expresión de RASSF2 en una muestra biológica seleccionada del grupo que consiste en plasma sanguíneo, suero sanguíneo, sangre completa, y células sanguíneas, aislada de dicho sujeto, en donde dicho nivel de expresión se determina por medio de la detección de la presencia o ausencia de metilación de CpG dentro de dicho gen, en donde la presencia de metilación indica la presencia de carcinoma colorrectal.

  7. 711.-

    Placa de cocina con una o más hornillas que, en una vista en planta, solamente en la región alrededor de su baricentro de superficie geométrico presenta una o más escotaduras , y con uno o más dispositivos para la aspiración y evacuación de vapores de cocina, en donde estos dispositivos para la aspiración y evacuación de vapores de cocina que se han producido y se producen sobre la o las hornillas aspiran los vapores en una dirección orientada verticalmente hacia abajo, y con un dispositivo provisto en el lado inferior de la placa de cocina y que forma una unidad de montaje con la placa de cocina para el funcionamiento de la placa de cocina y...

  8. 712.-

    Un método para recolectar algas de una solución acuosa que contiene algas, que comprende las etapas de (i) primero, proporcionar un coagulante orgánico a dicha solución y mezclar dicha solución, y (ii) posteriormente, proporcionar un material de arcilla inorgánica a dicha solución después de la etapa (i) y mezclar dicha solución para formar algas coaguladas, y (iii) agitar la solución resultante después de la etapa (ii) para formar algas floculadas, y (iv) posteriormente, separar y recolectar las algas floculadas de dicha solución.

  9. 713.-

    Procedimiento para la conversión química del tetracloruro de silicio con hidrógeno en el triclorosilano en un reactor, en el que unos eductos gaseosos se introducen en el reactor a través de un dispositivo de entrada de gases y éstos son distribuidos uniformemente, mediante un dispositivo de distribución de gases, en una zona de calefacción, en la que los eductos gaseosos son calentados mediante unos elementos de calefacción a una temperatura media de 500-1.500°C, y a continuación son conducidos a una zona de reacción, regulándose el calentamiento de los elementos de calefacción mediante unas mediciones de la temperatura en la zona de...

  10. 714.-

    Un método de producir un contenedor transportable para las mercancías a granel que comprende los pasos de: Colocar una bolsa con una parte superior abierta y una base cerrada a través de una abertura formadora definida por un formador de bastidor deslizante que tiene por lo menos una de las paredes , el formador de bastidor deslizante rodeando una parte de la bolsa con la base cerrada estando colocada adyacente a un soporte de fondo y estando la parte superior abierta separada verticalmente de la base cerrada y colocada adyacente a una fuente de alimentación ; Llenar la bolsa con las mercancías a granel desde...

  11. 715.-

    Una chapa de empalme para unir secciones de fuselaje , comprendiendo la chapa de empalme: una correa configurada para servir de puente a las secciones de fuselaje; una barra de cizalladura que recubre la correa ; y un herraje que tiene secciones primera y segunda longitudinalmente extendidas que se extienden más allá de los lados opuestos de la correa, estando configurada cada sección longitudinalmente extendida para recubrir al menos dos larguerillos de una sección de fuselaje respectiva, la chapa de empalme se caracteriza por que: el herraje se coloca entre la correa y la barra de cizalladura...

  12. 716.-

    Conexión de disco de freno y cubo, en la que un disco de freno presenta en su periferia interior una pluralidad de elementos de apoyo distribuidos de una manera uniforme, que se corresponden con elementos de arrastre dispuestos en la periferia exterior de un cubo en el sentido de un seguro contra giro, en la que para la transmisión de un momento de freno, en espacios intermedios formados entre los elementos de arrastre y los elementos de apoyo están dispuestos unos elementos intermedios insertados en la dirección axial del disco de freno con dos brazos que se apoyan entre sí, en cuyas superficies alejadas...

  13. 717.-

    Una máquina eléctrica síncrona que comprende: un generador de imanes permanentes de accionamiento directo; al menos un rotor con un núcleo de rotor interno que comprende imanes permanentes interiores y un núcleo de rotor exterior que comprende imanes permanentes exteriores , en el que el núcleo de rotor exterior se invierte con respecto al núcleo del rotor interior ; y al menos un estator de doble cara con una cara del estator interior y una cara del estator exterior que comprende un apilamiento de laminaciones de doble cara configurado para habilitar al flujo magnético...

  14. 718.-

    Una composición que comprende una espora de Bacillus firmus CNCM I-1582 y un agente de control de insectos, en la que el agente de control de insectos se selecciona de la lista: clotianidina, imidacloprid, tiacloprid, tiametoxam, acetamiprid, metiocarb, tiodicarb, beta-ciflutrina, ciflutrina, deltametrina, teflutrina, emamectina-benzoato, avermectina, spirodiclofen, spiromesifen, spirotetramat, flubendiamida, clorantraniliprol, o Ciantraniliprol 4-{[(6- cloropirid-3-il)metil](2,2-difluoretil)amino} furan-2(5H)-ona conocido a partir del documento WO 2007/115644).

  15. 719.-

    Dispersión acuosa que contiene un poliuretano, compuesto de a) diisocianatos orgánicos b) compuestos dihidroxi con un peso molecular de 500 a 5000 g/mol, que no contienen ningún grupo iónico o grupo que pueda convertirse en un grupo iónico c) alcoholes mono a trihidroxilados, que contienen adicionalmente un grupo iónico d) dado el caso, otros compuestos distintos de a) a c), caracterizada porque el poliuretano contiene menos del 0,6 % en peso de grupos urea (calculado con un peso molecular de 56 g/mol), el grupo iónico de c) está neutralizado al menos parcialmente...

  16. 720.-

    Un dominio variable único de inmunoglobulina anti-receptor TNFα tipo 1 que comprende la siguiente secuencia de aminoácidos: EVQLLESGGGLVQPGGSLRLSCAASGFTFAHETMVWVRQAPGKGLEWV SHIPPDGQDPFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYHCAL LPKRGPWFDYWGQGTLVTVSS

  17. 722.-

    Sistema modular para delimitación, decoración e iluminación de espacios y volúmenes. El sistema está formado por módulos autoportantes iluminables interiormente que pueden tener diferentes formas y tamaños. Son ensamblables unos con otros por sus caras y/o por sus aristas, permite apilar los módulos y disponerlos de diferentes formas creando configuraciones distintas que dotan el sistema de versatilidad y riqueza compositiva. El sistema es reutilizable y evolutivo, es decir ampliable por la incorporación de nuevos...

  18. 723.-

    Procedimiento de fabricación de al menos una micro-sonda neuronal flexible, biocompatible e implantable, que comprende las etapas de: proporcionar una capa de un sustrato rígido; proporcionar una capa de un polímero soluble sobre dicha capa de sustrato rígido; proporcionar una capa de un primer polímero; grabar en dicha capa de primer polímero al menos una abertura; proporcionar una capa de un material conductor bidimensional sobre dicha capa de primer polímero; grabar en dicha capa de material conductor bidimensional al menos un microelectrodo provisto de al menos un área de contacto; proporcionar un ensamblaje de acabado sobre dicho ensamblaje de microelectrodo; y disolver dicho polímero soluble en una solución....

  19. 724.-

    El inodoro doméstico para perros y otros animales domésticos, se basa en un objeto que comprende un cuerpo con una puerta. La puerta se abre y queda al ras del suelo, en la superficie de la puerta es donde el animal deposita sus excrementos y orinas. Una vez realizada la acción, se cierra la puerta y los residuos caen en el interior del cuerpo. Entonces se acciona la válvula de entrada de líquidos, que están situados en dicho cuerpo del inodoro y empuja y limpia de residuos, conduciendo dichos residuos...

  20. 725.-

    Procedimiento y sistema de depuración de líquidos residuales, apto para su uso con purines, lixiviados o residuos líquidos similares, que utiliza procesos biológicos con la ayuda de reactivos añadidos, mediante una balsa facultativa, un homogeneizador, un sistema de agitación de líquido en el homogeneizador, unos medios de adición del activador químico, un reactor biológico, unos medios de recirculación desde el reactor biológico hasta el homogeneizador, un sistema de inyección de aire en el reactor biológico, un desnitrificador con capacidad anaerobia...

  21. 726.-

    Sistema de producción de energía eléctrica. Comprende un primer circuito de trabajo termodinámico que emplea dióxido de carbono para obtener energía mediante un generador de energía del sistema, y se caracteriza por el hecho de que dicho circuito de trabajo termodinámico está asociado en paralelo a un circuito secundario de absorción y evaporación de amoníaco que está dimensionado para condensar el gas dióxido de carbono procedente del generador , incluyendo dicho sistema un dispositivo (5a, 5b, 5c) de recuperación de energía (E) térmica de bajo nivel que está dimensionado para evaporar amoníaco de la solución de amoníaco del circuito secundario,...

  22. 727.-

    1. Puente de señalización prioritaria para ser ubicado en el techo de un vehículo, caracterizado porque comprende una pluralidad de generadores de vórtice ubicados en la superficie más cercana al techo del vehículo una vez implementado el puente de señalización . 2. Puente de señalización prioritaria, según la reivindicación 1, caracterizado porque los generadores de vórtice se encuentran alineados y equidistantes con respecto a la arista del puente de señalización que recibe el aire.

  23. 728.-

    1. Poste de alumbrado público multifuncional, caracterizado porque está constituido a partir de un cuerpo longitudinal hueco que presenta en un extremo medios para fijarlo al suelo así como un marco rectangular hueco que aloja una unidad con la electrónica necesaria para operar dos pantallas monitoras de emisión de imágenes, la recepción y emisión de señales a través de una antena transceptora, la emisión de sonido, la funcionalidad de una cámara IP y la activación de un emisor de luz, además de una luminaria. 2. Poste de alumbrado público multifuncional, caracterizado, según la reivindicación primera, porque el poste...

  24. 729.-

    El freno hidráulico duplicado es un novedoso sistema de frenos para todo tipo de vehículos motorizados que aprovecha el tipo de freno por cuña y polea, accionado y controlado mediante un circuito hidráulico de nuevo diseño, el circuito hidráulico define dos subcircuitos independientes entre sí, cada uno de los dos subcircuitos acciona todos los dispositivos de frenado instalados en el vehículo teniendo una gran seguridad ante una avería de uno de los subcircuitos.

  25. 730.-

    Una composición adhesiva activable por fluido para una etiqueta libre de revestimiento que comprende al menos dos materiales poliméricos con diferentes hidrofilicidades, que se activan mediante un fluido de activación que comprende agua y uno o más disolventes no acuosos, en donde los al menos dos materiales poliméricos con diferentes hidrofilicidades comprenden al menos un polímero hidrófilo y al menos un polímero hidrófobo y en donde el al menos un polímero hidrófilo proporciona pegado rápido y el al menos un polímero hidrófobo proporciona adhesión definitiva cuando se expone al fluido de activación.

  26. 731.-

    1. Dispositivo climatizado para ensayos de fractura en modo mixto, caracterizado porque comprende: - una cámara hermética que comprende medios de ensayo , un útil multimodal de sujeción de la probeta a ensayar y medios sensores de las condiciones de temperatura y humedad relativa en el interior de la cámara hermética - una unidad de tratamiento de aire , situada junto a la cámara hermética y conectada con la misma mediante sendas entradas y salidas de aire , donde dicha unidad de tratamiento...

  27. 732.-

    Sistema polimérico metaloorgánico de coordinación a escala micro-/nanométrica procedimiento de obtención y aplicaciones. El objeto de la presente invención es un sistema polimérico metaloorgánico de coordinación de partículas de gran estabilidad y que presentan grupos funcionales en la superficie susceptibles de actuar de puntos de anclaje de diferentes especies que poseen propiedades como luminiscencia, actividad química, catalítica y/o actividad biológica. Son igualmente objetos de la presente invención un procedimiento para la síntesis a nivel micro- y nanométrico del sistema polimérico metaloorgánico,...

  28. 733.-

    Procedimiento de descontaminación de equipos eléctricos desechados que contienen hexafluoruro de azufre y máquina necesaria para tal fin. Procedimiento que comprende las etapas de: recuperación de hexafluoruro de azufre, y de lavado y neutralización por aplicación de fluidos del interior de los compartimentos del gas de los equipos eléctricos, donde además de emplear una disolución alcalina y agua, es utilizado al menos una disolución ácida, donde la operación de lavado comprende las etapas de: recepción , apertura del compartimento de gas,...

  29. 734.-

    Cápsulas que contienen dos fases y procedimiento de obtención de las mismas. La presente invención se refiere a cápsulas recubiertas por una película de alginato de calcio que contienen dos fases inmiscibles o parcialmente miscibles entre sí, tales como por ejemplo una fase acuosa y una fase hidrófoba o una fase líquida y una fase sólida. Además, la presente invención también se refiere al procedimiento mediante el que es posible encapsular y mantener estables dichas dos fases dentro de la cápsula formada.

  30. 735.-

    1. Dispositivo inferior para rodar puertas correderas, consiste en un mecanismo que comprende carcasa , porta-ruedas , ruedas alas de sujeción para rodar por un carril que define la trayectoria de la puerta, caracterizado porque la carcasa en su parte inferior dispone de una sujeción perimetral de la puerta en su totalidad, en forma de U, incorporando a la misma orificio con rosca , que es atravesado por tornillo para sujetar momentáneamente el porta-ruedas , en las diferentes posiciones que le proporcionan las escotaduras y hendidura de mayor profundidad para el recambio...

  31. 736.-

    Hidrogeles bioactivos y su aplicación en regeneración ósea y cartilaginosa. La presente invención se refiere a hidrogeles bioactivos elaborados con ingredientes de origen natural, que están entrecruzados por interacciones de tipo electrostático y que incorporan proteínas morfogénicas óseas (BMP), y al método de elaboración de dichos hidrogeles. La invención también incluye la aplicación de estos hidrogeles bioactivos para elaborar productos sanitarios, composiciones farmacéuticos y/o implantes poliméricos para regeneración ósea y cartilaginosa.

<< · 12 · 17 · 20 · 21 · < · 23 · > · 25 · 28 · 34 · 45 · >>