2,545 Patentes de junio de 2011 (pag. 72)

  1. 2273.-

    DISPOSITIVO DE CONEXIÓN PARA CABLES MULTICONDUCTORES

    (06/2011)

    Dispositivo de conexión para el establecimiento del contacto de conductores de un cable, que presenta varios conductores , en particular de conductores de un cable plano continuo , en el que los conductores están rodeados, dado el caso, respectivamente por un aislamiento y están incrustados en una envolvente de cable de orden superior, con las siguientes características: a. una carcasa de varias partes, que comprende una sección de base para el alojamiento del cable y una sección de tapa , b. contactos que atraviesan el aislamiento...

  2. 2274.-

    DISPOSITIVO ESCINTIGRÁFICO DE ALTA RESOLUCIÓN ESPACIAL QUE TIENE UN COLIMADOR CON CRISTALES INTEGRADOS

    (06/2011)

    Un dispositivo escintigráfico con colimador con cristales integrados con alta resolución espacial, que comprende en sucesión desde un extremo abierto de un recipiente revestido con un revestimiento de protección que comienza desde la fuente del evento que ha de ser medido: un colimador para fotones gamma de baja energía hecho de un material con un alto número atómico, que tiene internamente una multiplicidad de conductos iguales de longitud determinada, identificados y separados por tabiques de espesor adecuado para absorber...

  3. 2275.-

    PROCEDIMIENTO PARA EL CONTROL DE LA MARCHA POR INERCIA DE UNA MÁQUINA ASÍNCRONA

    (06/2011)

    Procedimiento para el control de la marcha por inercia de una máquina asíncrona , que comprende las siguientes etapas: las siguientes etapas: - determinación y registro del valor de una energía de arranque (Estart) durante la aceleración de la máquina asíncrona desde el estado parado hasta el número de revoluciones de funcionamiento, - frenado de la máquina asíncrona en el modo reversible con una energía de frenado (Estop), que corresponde a la energía de arranque (Estart) multiplicada por un factor de corrección...

  4. 2276.-

    COMPOSICIONES QUE PRESENTAN ALTA ESCR Y QUE COMPRNEDEN POLÍMERO AROMÁTICO DE MONOVINILIDENO Y COPOLÍMERO DE ETILENO/ALFA-OLEFINA

    (06/2011)

    Composición que comprende (A) un polímero aromático de monovinilideno modificado para impacto, y (B) un copolímero de etileno/alfa-olefina (EAO) que satisface la relación matemática y ≤ 20 + 2,35x en la que y es el contenido en etileno en porcentaje en moles (% en moles) del copolímero de EAO, y x es la viscosidad Brookfield en centipoise (cP) a 100ºC del copolímero de EAO y la viscosidad es de al menos 1 cP

  5. 2277.-

    GUÍA FLEXIBLE PARA UN ALAMBRE DE SOLDADURA CON ELEMENTOS INDIVIDUALES ARTICULADOS EN CUALQUIER DIRECCIÓN UNOS CON RESPECTO A OTROS

    (06/2011)

    Guía flexible, en particular para un alambre de soldadura, formada por una pluralidad de elementos individuales conectados entre sí de forma articulada, pudiendo pivotar los elementos individuales unos con respecto a otros en cualquier dirección, caracterizada porque cada elemento individual está dotado de un primer y un segundo par de rodillos guía , estando orientados los ejes de rotación del primer par aproximadamente en perpendicular a los ejes de rotación del segundo par, estando encajados los ejes de apoyo...

  6. 2278.-

    ELEVARRUEDAS Y BÁSCULA CON ELEVARRUEDAS

    (06/2011)

    Elevarruedas con una rampa y un dispositivo elevador , en donde el dispositivo elevador está colocado y concebido de tal manera que con el dispositivo elevador pueda moverse una rueda subiendo o bajado por la rampa , y en donde el dispositivo elevador presenta un dispositivo de palanca, caracterizado porque el dispositivo de palanca comprende una palanca acodada o una disposición de palanca acodada

  7. 2279.-

    COMPOSICIONES FUNGICIDAS

    (06/2011)

    Un método para controlar enfermedades fitopatógenas de plantas útiles o del material de propagación de las mismas, que comprende aplicar a las plantas útiles, en el emplazamiento de las mismas o en el material de propagación de las mismas, una combinación de componentes A) y B) en una cantidad sinérgicamente efectiva, en la que el componente A) es un compuesto de fórmula I en la que R1 es trifluorometilo o difluorometilo y R2 es hidrógeno o metilo; o un tautómero de dicho compuesto; y el componente B) es un...

  8. 2280.-

    FIBRA CONDUCTORA COMPUESTA DE TIPO NÚCLEO-ENVOLVENTE

    (06/2011)

    Fibra conductora compuesta de tipo núcleo-envolvente que comprende un componente envolvente de un polímero formador de fibras que contiene negro de carbón conductor, caracterizada porque el componente núcleo y el componente envolvente cumplen la siguiente relación: r / R ≤ 0,03 donde R representa el radio del círculo inscrito del componente envolvente y r representa la distancia entre los centros de dos círculos inscritos de los componentes núcleo y envolvente de una sección transversal de la fibra

  9. 2281.-

    CONTROL DEL PROCESO DE ABLACIÓN CON LASER EXCIMER DE MATERIALES MULTILAMINADOS

    (06/2011)

    Un método para la ablación de orificios en un material laminado, comprendiendo el método: laminar una primera capa a una segunda capa , en el que dichas primera y segunda capas tienen diferentes coeficientes de expansión térmica y, en el que dicha segunda capa tiene un orifico interno de manera que cuando se forma el sustrato laminado , una región de la primera capa alineada con dicho orificio, no se lamina a la segunda capa y está rodeada de regiones laminadas; y dirigir pulsaciones de energía láser...

  10. 2282.-

    PROCEDIMIENTO PARA LA FABRICACIÓN DE UN INTERCAMBIADOR DE CALOR

    (06/2011)

    Procedimiento para la fabricación de un intercambiador de calor con los siguientes pasos: a) mejorado por inmersión en baño de fusión de una chapa de acero para formar una capa de protección contra la corrosión, conteniendo la capa de protección contra la corrosión zinc y entre 0,5 % y 60 % de aluminio; b) eliminación de la capa de protección contra la corrosión de un lado de la chapa de acero; c) fabricación de un tubo intercambiador de calor de esta chapa de acero, estando la capa de protección contra la corrosión dispuesta en el lado exterior; d) preparación de aletas de aluminio o de una aleación de aluminio; e) preparación de un fundente; f) preparación de un material de soldadura que contiene aluminio...

  11. 2283.-

    DETECCIÓN DE UN ANTICUERPO TERAPÉUTICO EN UN ANIMAL DE EXPERIMENTACIÓN

    (06/2011)

    Método de detección de un anticuerpo terapéutico destinado al uso en un humano en una muestra obtenida de un animal de experimentación que comprende las etapas de a) proporcionar la muestra a analizar, b) incubar dicha muestra con un anticuerpo que se une a dicho anticuerpo terapéutico y no se une a las inmunoglobulinas de dicho animal de experimentación, c) opcionalmente, incubar dicha muestra con un reactivo adecuado para la detección selectiva del anticuerpo terapéutico total, activo o unido al antígeno, y d) correlacionar el complejo formado en (b) o (c) con la concentración de dicho anticuerpo terapéutico

  12. 2284.-

    PRÓTESIS DE ARTICULACIÓN DE RODILLA DE SEGURIDAD LIBRE DE FALLOS

    (06/2011)

    Prótesis de articulación de rodilla de seguridad libre de fallos, que presenta: Un dispositivo de unión con la pierna, el cual comprende un cuerpo principal , un zócalo , un elemento de accionamiento y una unidad de reposición , siendo limitado un espacio de alojamiento por la pared interior del cuerpo principal , y extendiéndose el zócalo partiendo de un extremo del cuerpo principal , y estando prevista la unidad de reposición en el espacio de alojamiento , y estando un extremo de la unidad de reposición unido con el elemento de accionamiento , mientras que el otro extremo de la misma está unido basculante con el cuerpo principal ; un dispositivo de unión con el muslo, que tiene una sección...

  13. 2285.-

    INGENIO VOLANTE CON ALAS BATIENTES

    (06/2011)

    Ingenio volante con alas batientes, comprendiendo el ingenio un chasis sobre el cual dos pivotes están montados pivotantes según dos ejes de articulación paralelos (X), llevando cada uno de los pivotes una ala, comprendiendo el ingenio un primer generador de oscilaciones para provocar una oscilación de los pivotes con vistas a provocar un aleteo de las alas, comprendiendo el primer generador de oscilaciones: - dos brazos solidarios cada uno de uno de los pivotes ; - unos medios de sincronización de la rotación de los dos pivotes de manera que los pivotes tengan unas rotaciones iguales y opuestas; caracterizado porque el primer generador de oscilación comprende además: - dos manivelas articuladas cada una...

  14. 2286.-

    COMPUESTO DE AZUFRE ORGÁNICO CON CONTENIDO EN FLÚOR Y COMPOSICIÓN PLAGUICIDA QUE LO CONTIENE

    (06/2011)

    Un compuesto de azufre orgánico con contenido en flúor representado por la fórmula (I): R 2 representa un átomo de halógeno, un átomo de hidrógeno, o un grupo hidrocarburo de cadena de C1-C4 que está opcionalmente sustituido con un átomo de halógeno; R 3 y R 4 representan cada uno de ellos independientemente un grupo hidrocarburo de cadena de C1-C4 o un átomo de hidrógeno; R 5 representa un átomo de flúor; o un grupo haloalquilo de C1-C5 que contiene al menos un átomo de flúor; R 6 representa un átomo de halógeno, un grupo ciano, un grupo nitro o un grupo -(G 1 )q-R 8 ; R 7 representa un grupo amino, un grupo alquilamino de C1-C4 que está sustituido opcionalmente con un átomo de halógeno, un grupo...

  15. 2287.-

    COMPOSICIONES EN COMPRIMIDOS QUE CONTIENEN ATAZANAVIR

    (06/2011)

    Un comprimido que comprende raltegravir y gránulos que contienen sulfato de atazanavir y un lubricante intragranular, teniendo dichos gránulos una sección interior y una superficie exterior y en el que al menos una parte del lubricante intragranular está presente en la sección interior de los gránulos

  16. 2288.-

    VÁLVULA DE SOLENOIDE PARA UN CONSUMO DE ENERGÍA REDUCIDO

    (06/2011)

    Un sistema de válvula de control , que comprende: (a) un alojamiento que presenta una entrada , una primera salida y una segunda salida , estando caracterizado el sistema porque comprende además: (b) una válvula con un elemento móvil que puede colocarse en al menos una primera posición en la que se establece una comunicación de fluido entre dicha entrada y dicha primera salida , una segunda posición en la que se establece una comunicación de fluido entre dicha entrada y dicha segunda salida , y una tercera posición en la se impide generalmente una comunicación de fluido entre dicha entrada y dicha primera salida o dicha segunda salida , empujándose dicha válvula hacia dicha...

  17. 2289.-

    PROCEDIMIENTO PARA EL MECANIZADO DE LOS ASIENTOS DE COJINETE DE LOS COJINETES PRINCIPALES Y COJINETES DE ELEVACIÓN DE LOS CIGÜEÑALES

    (06/2011)

    Procedimiento para el mecanizado de los asientos de cojinete de los cojinetes principales y cojinetes de elevación de los cigüeñales , en el que los asientos de cojinete de los cojinetes principales (HL) y cojinetes de elevación (PL) se someten a las operaciones de mecanizado siguientes después de la formación original del cigüeñal por forja o fundición: - conformación por mecanizado con arranque de viruta con filo de corte definido, - laminado fijo de todos las gargantas huecas o escotaduras de los asientos de cojinete, - enderezamiento del cigüeñal, - mecanizado de precisión con arranque de viruta con una fresa de punta respectivamente por - fresado rotativo con precorte a velocidad elevada...

  18. 2290.-

    PROCEDIMIENTO PARA LA PREPARACIÓN DE DIÓXIDO DE TITANIO

    (06/2011)

    Procedimiento para la preparación de partículas de dióxido de titanio por reacción de tetracloruro de titanio con un gas que contiene oxígeno en un reactor tubular, caracterizado porque el tetracloruro de titanio se introduce en el reactor al menos en dos etapas y exclusivamente en forma líquida

  19. 2291.-

    CONJUGADO CITOTÓXICO ESPECÍFICO PARA EL ANTÍGENO CA6 Y MÉTODOS PARA USAR EL MISMO

    (06/2011)

    Un anticuerpo humanizado o fragmento de unión a epítopo del mismo que comprende al menos una región variable de cadena pesada al menos un 98% idéntica a una secuencia de aminoácidos de la SEC ID Nº: 10 ó 11 y al menos una región variable de cadena ligera al menos un 98% idéntica a una secuencia de aminoácidos de la SEC ID Nº: 8, en el que dicha al menos una región variable de cadena pesada o fragmento de la misma comprende tres regiones determinantes de complementariedad secuenciales que tienen secuencias de aminoácidos representadas por las SEC ID Nº: 1, 21 y 3, respectivamente y en el que dicha al menos una región variable de cadena ligera o fragmento de la misma comprende...

  20. 2292.-

    ADAPTACIONES PARA TRANSPORTE ORIENTADO A CONEXIÓN EN UNA RED DE COMUNICACIONES DE PAQUETES CONMUTADOS

    (06/2011)

    Sistema de control para controlar una red de comunicaciones de paquetes conmutados para enviar paquetes de datos de un formato de paquete predeterminado, donde un conjunto de direcciones que tiene un formato de dirección predeterminado se asignan a la red, y donde la red comprende una pluralidad de nodos de red , estando caracterizado el sistema de control por comprender un plano de control sin conexión dispuesto para permitir y controlar un transporte sin conexión de paquetes de datos a través de dicha red, un plano de control orientado a conexión dispuesto para permitir y controlar un transporte orientado a conexión de paquetes de datos a través de dicha red, y un gestor...

  21. 2293.-

    PÉPTIDOS APTOS PARA TRANSLOCACIÓN EN UNA MEMBRANA

    (06/2011)

    Un procedimiento para aislar un compuesto que muestra actividad de translocación en membrana a partir de una genoteca de exhibición de péptidos, comprendiendo dicha genoteca una pluralidad de secuencias de ácido nucleico que codifican péptidos exhibidos, y que comprende las etapas de: a) Expresión de una pluralidad de construcciones de ácido nucleico, en la que cada construcción de ácido nucleico comprende una secuencia promotora enlazada en forma operativa a la secuencia de ácido nucleico, resultando dicha expresión de la pluralidad de de construcciones de ácido nucleico en la formación de una pluralidad de complejos de péptido de ácido nucleico, comprendiendo cada complejo...

  22. 2294.-

    CONTROLADOR DE HUMEDAD

    (06/2011)

    Aparato controlador de humedad que acepta un primer flujo de aire y un segundo flujo de aire y suministra a un espacio interior o bien el primer flujo de aire deshumidificado o bien el segundo flujo de aire humidificado, en el que: el aparato controlador de humedad comprende una primera unidad de adsorción y una segunda unidad de adsorción , teniendo cada una de las unidades de adsorción primera y segunda un adsorbente respectivo que se pone en contacto con aire, el aparato controlador de humedad está configurado para realizar, repetida y alternativamente a un intervalo de tiempo de conmutación predeterminado, una primera operación en la que se humidifica el segundo flujo...

  23. 2295.-

    VACUNA SINTÉTICA PARA EL CONTROL DE GARRAPATAS

    (06/2011)

    Una vacuna sintética contra garrapatas que comprende el inmunógeno sintético SBm4912 (Boophilus microplus 4912 sintético), que consiste en una secuencia continua y definida con cuarenta y tres aminoácidos que se encuentran en diferentes posiciones en la secuencia de la proteína Bm86, polimerizada con cisteína en el N-terminal y en el C-terminal, que consiste en CLSKHVLRKLQACEHSSICSDFGNEFCRNACDCGEWGAMNMTTRC, el cual, cuando se inocula en bovinos, se caracteriza por la producción de inmunidad contra garrapatas, reduciendo su número y su capacidad reproductiva

  24. 2296.-

    AGUJA DE MUESTREO

    (06/2011)

    Una aguja de recuperación de ovocitos vaginales que comprende una primera región tubular en comunicación fluida con una segunda región tubular , comprendiendo la primera región tubular un extremo delantero para la inserción en un sujeto y comprendiendo la segunda región tubular un extremo trasero para la comunicación fluida con un medio para recibir un fluido, en la que la primera región tubular tiene un diámetro externo que es inferior al diámetro externo de la segunda región tubular y la primera región tubular tiene un diámetro interno que es inferior al diámetro interno de la segunda región tubular , en la que la segunda región tubular...

  25. 2297.-

    MÉTODO PARA FORMAR UN CONJUNTO DE DOCUMENTOS

    (06/2011)

    Método para formar un conjunto de documentos , conjunto de documentos formado con hojas rectangulares del mismo tamaño y que comprende una hoja de sobre individual y por lo menos una hoja de inserción , caracterizado porque incluye los pasos que consisten en: - Imprimir dicha hoja de sobre individual con información de sobre, comprendiendo dicha información de sobre un identificador de código único de autorreferencia para identificar únicamente dicha hoja de sobre individual ; - Imprimir cada una de al menos las mencionadas hojas de inserción con información de inserción, comprendiendo dicha información de inserción otro identificador de código...

  26. 2298.-

    PROCEDIMIENTO DE DECORACIÓN DE UN SOPORTE QUE COMPRENDE UNOS CALADOS, Y SOPORTE ASÍ DECORADO

    (06/2011)

    Procedimiento de decoración de un soporte que comprende unos calados con un material polimérico fluido que se puede solidificar, que comprende las etapas siguientes: - depositar el material polimérico en estado fluido sobre un primer lado del soporte, - ejercer una presión (P) sobre el material polimérico antes de que se solidifique para hacerlo pasar a través de calados del soporte y hacer que sobresalga por un segundo lado , opuesto al primero , del soporte, - permitir que el material polimérico se solidifique después de pasar a través de los calados del soporte

  27. 2299.-

    COMPUESTOS DE AZETIDINA COMO ANTAGONISTAS DEL RECEPTOR DE OREXINA

    (06/2011)

    Un compuesto de fórmula (I) Fórmula (I) en la que: X representa C(O) o SO2; R1 representa arilo, en el que el arilo no está sustituido, o está mono, di o trisustituido, en el que los sustituyentes se seleccionan independientemente del grupo que consiste en alquilo (C1-4), alcoxi (C1-4), trifluorometilo, trifluorometoxi, NR3R4, N(R3)C(O)R4, C(O)NR3R4 y fenilo no sustituido, o mono, di o trisustituido, en el que los sustituyentes se seleccionan independientemente del grupo que consiste en alquilo(C1-4), alcoxi (C1-4), halógeno, ciano, trifluorometilo y trifluorometoxi; o R1 representa heteroarilo, en el que el heteroarilo no está sustituido, o está mono, di o trisustituido,...

  28. 2300.-

    OLIGONUCLEÓTIDOS PARA LA DETECCIÓN DE SALMONELLA

    (06/2011)

    Par de cebadores oligonucleotídicos caracterizado porque consiste en dos oligonucleótidos de por lo menos 9 nucleótidos que hibridan en condiciones astringentes con la secuencia nucleotídica que corresponde a la parte Cterminal del gen iagA definda entre las posiciones 1318 y 1755 de la secuencia iagA representada en la figura 1, siendo dicho par capaz de amplificar una secuencia de ADN o de ADNc de Salmonella enterica y de Salmonella bongori comprendida en la secuencia iagA

  29. 2301.-

    PIEZA DE ENGANCHE 0PARA UN CARRIL DE RUEDAS, CARRIL DE RUEDAS PROVISTO DE TAL PIEZA, SISTEMA DE CARRILES DE RUEDAS Y SISTEMA DE SOPORTE, MANIPULACIÓN, LOGÍSTICA, DISTRIBUCIÓN O ALMACENAJE QUE CONPRENDE AL MENOS TAL SISTEMA DE CARRILES DE RUEDAS

    (06/2011)

    Sistema de carriles de ruedas que comprende un soporte perfilado y dos carriles de ruedas que forman parte de una misma pista, dispuestos en continuidad de alineación de conjunto uno respecto del otro; en el cual un primer carril de ruedas comprende una pieza de enganche con pata de enganche media; en el cual un segundo carril de ruedas está destinado especialmente a formar en asociación con uno u otros varios carriles de ruedas separados transversalmente y dispuestos paralelamente, una pista de circulación para un sistema de soporte, manipulación, logística, distribución o almacenaje, apto para soportar y para permitir...

  30. 2302.-

    MANGO DE PUERTA PARA UN APARATO DOMÉSTICO

    (06/2011)

    Mango de puerta para un aparato doméstico con un asidero alargado , provisto al menos en un extremo de una ranura y con al menos una sujeción para unir el asidero con una puerta , donde una cabeza de la sujeción entra en el asidero a través de la ranura , caracterizado por que la cabeza porta una pieza de pinza elásticamente deformable que entra con sobredimensión en una sección sin ranura del asidero

  31. 2303.-

    COMPOSICIONES DE LAVADO DE ROPA

    (06/2011)

    Un suavizante en la composición detergente de lavado, que comprende: (a) al menos 1% en peso de un tensioactivo detersivo distinto del jabón, con un peso molecular por debajo de 1.000 daltons; (b) al menos 1% en peso de un jabón C6-C30; (c) de 0,005% a 5% en peso de un tensioactivo no iónico polimérico que tiene un peso molecular por encima de 2.200 daltons; y (d) de 0,001% a 15% en peso de uno o más polímeros catiónicos solubles en agua capaces de formar un complejo con (b)

  32. 2304.-

    GENERACIÓN DE ARCHIVOS DE DATOS DE CITOMETRÍA DE FLUJO CON UN NÚMERO POTENCIALMENTE INFINITO DE DIMENSIONES DERIVADAS DE LA FUSIÓN DE UN GRUPO DE ARCHIVOS DE DATOS DE CITOMETRÍA DE FLUJO SEPARADOS Y SU RECONSTRUCCIÓN MULTIDIMENSIONAL TANTO CON DATOS DE CITOMETRÍA DE FLUJO MEDIDOS REALMENTE COMO ESTIMADOS

    (06/2011)

    Un procedimiento para la generación de nuevos archivos de datos de citometría de flujo a partir de archivos de datos originales que contienen datos de parámetros acerca de eventos medidos en diferentes partes alícuotas de la misma muestra, en el que cada archivo de datos originales comprende datos de parámetros comunes que corresponden a parámetros medidos para todas las partes alícuotas y datos de parámetros no comunes que corresponden a parámetros medidos solo para algunas partes alícuotas, comprendiendo el procedimiento la etapa de: a) fusionar dos o más archivos de datos originales en un archivo; caracterizado por...

<< · 36 · 54 · 63 · 67 · 69 · 70 · < · 72 · > · 74 · 76 · >>