1,980 Patentes de diciembre de 2011 (pag. 2)

  1. 33.-

    Un compuesto de fórmula: R1-Z1-HSQGTFTSDYSKYLDRARADDFVAWLKST Z2-R2 en la que: R1 es hidrógeno, alquilo C1-4 (por ejemplo, metilo), acetilo, formilo, benzoílo o trifluoroacetilo; R2 es NH2 u OH; Z1 y Z2 están independientemente ausentes o son una secuencia de péptidos de 1-20 unidades de aminoácidos seleccionados del grupo que consiste en Ala, Leu, Ser, Thr, Tyr, Asn, Gln, Asp, Glu, Lys, Arg, His, Met, Har, Dbu, Dpr y Om; o una sal farmacéuticamente aceptable, complejo de coordinación de iones metálicos, éster o hidrato del mismo.

  2. 35.-

    Un preparado líquido acuoso que comprende una sal de adición de ácido del ácido (+)-(S)-4-[4-[(4-clorofenil)(2- piridil)metoxi]piperidino] butírico y un cloruro metálico soluble en agua, en el que dicha sal de adición de ácido se elige entre hidrobromuro, sulfato, nitrato, fosfato, acetato, propionato, hidroxiacetato, 2-hidroxipropionato, piruvato, malonato, succinato, maleato, fumarato, dihidroxifumarato, oxalato, benzoato, cinamato, salicilato, metanosulfonato, etanosulfonato, becenosulfonato, p-toluenosulfonato, ciclohexilsulfamato y 4-aminosalicilato

  3. 36.-

    Método en un dispositivo de comunicación inalámbrica multimodo para identificar un sistema preferido, comprendiendo el método: recibir información de lista de itinerancia preferida que incluye información de identificador de sistema e indicadores de itinerancia mejorados asociados con la información de identificador de sistema; almacenar la información de lista de itinerancia preferida; transmitir , desde dicho dispositivo de comunicación inalámbrica multimodo, una petición de información de tabla de extensión de funcionalidad asociada con los indicadores de itinerancia mejorados; recibir , en dicho dispositivo de comunicación inalámbrica...

  4. 37.-

    Un método para separar al menos un pequeño volumen definido de una muestra de líquido de un volumen indefinido relativamente grande de dicha muestra, caracterizado por las operaciones de: - proporcionar en una superficie de un primer cuerpo al menos una cavidad con dicho pequeño volumen definido; - aplicar dicho volumen relativamente grande de dicha muestra sobre dicha superficie y dentro de al menos una cavidad; - desplazar relativamente dicho primer cuerpo y unos medios de raspado de modo que dichos medios de raspado pasen dicha al menos una cavidad, rascando por consiguiente un volumen de dicha superficie de dicho volumen relativamente grande y dejando...

  5. 38.-

    Substrato transparente que tiene un apilamiento de capas finas de reflexión metálica, de elevada resistencia térmica, en particular adaptado para ser tratado térmicamente (bombeado, temple, recocido), que comprende una capa de base dieléctrica, una capa metálica de reflexión elevada, de cromo o de una aleación metálica que contiene al menos 45% en peso de cromo, y una capa de recubrimiento nitrurada dieléctrica, caracterizado porque la capa de base dieléctrica se compone de capas múltiples, de al menos una capa parcial oxidada, contigua o no del substrato transparente, que tiene un índice de refracción ≥ 2,0, y de una capa parcial nitrurada...

  6. 39.-

    Un dispositivo que puede ajustarse en un endoscopio , comprendiendo el dispositivo: un cuerpo alargado con una masa móvil dispuesta para decelerarse hacia un extremo distal del cuerpo con el fin de impartir un movimiento en una dirección distal al mismo por medio de una transferencia de momentos, y para acelerarse alejándose de dicho extremo distal con el fin de llevar el cuerpo en una dirección distal, utilizando de nuevo la transferencia de momentos, estando conducida la masa móvil bajo la acción de un fluido; medios de control que controlan el flujo del mismo entre la masa móvil y el cuerpo , para efectuar dicha deceleración y...

  7. 40.-

    Un fertilizante que comprende: una forma de absorción rápida de un micronutriente o macronutriente seleccionado del grupo constituido por sulfato de cobre, sulfato de cinc, sulfato de manganeso, tetraborato de potasio tetrahidratado, y nitrato de calcio; y una forma de absorción lenta de un micronutriente o macronutriente seleccionado del grupo constituido por óxido de cobre, óxido de cinc, óxido de manganeso, carbonato de calcio y ácido bórico, en donde la forma de absorción rápida se encuentra en una forma que es absorbida más fácilmente por una planta que la forma de absorción lenta, estando recubierta dicha forma de absorción lenta con...

  8. 41.-

    Pseudo-electrodo de referencia de película delgada y procedimiento para su fabricación, en donde el pseudo-electrodo de referencia se compone de un sustrato constituido por una oblea de silicio oxidada, sobre la que directamente está depositada mediante la técnica de sputtering una única película delgada de plata , la cual presenta un espesor comprendido entre 100 nm y 1500 nm

  9. 42.-

    Barbacoa para asar de las destinadas a cocinar alimentos a la brasa mediante la colocación de los mismos en unos pinchos a modo de parrillas rotativas, la cual básicamente comprende una estructura prismática abierta por su cara frontal que constituye un hogar , contando en su interior con una o más placas con orificios , sobre las que se coloca el carbón y bajo las cuales existe un espacio con agua , siendo la cara superior del hogar , y al menos una de sus caras laterales y/o posterior de paredes dobles, estando estas abiertas al descrito espacio inferior con agua de forma que entre dichas dobles paredes se produzca la corriente de aire del tiro mediante la actuación de una...

  10. 43.-

    Perfeccionamientos en la patente de invención P200800991 por sistema para la práctica de la osteotomía.Este sistema comprende: un dispositivo de tornillo canulado con un hueco interior en el se encuentra alojada una pieza porta-cuchillas y con una o más ranuras longitudinales (13, 13'') para el paso de respectivas cuchillas (2, 2'') de la pieza porta-cuchillas, un aplicador para el accionamiento de la pieza porta-cuchillas y un resorte para el retroceso de la mencionada pieza porta-cuchillas. El hueco interior y la pieza porta-cuchillas presentan una sección no circular y definen en las superficies laterales enfrentadas unos medios complementarlos...

  11. 44.-

    Un cemento basado en agua para producir neumáticos, que comprende agua como disolvente, una base de polímero de cadena insaturada reticulable, azufre, una carga de refuerzo, óxido de cinc, aceleradores; estando caracterizado dicho cemento por que comprende un emulsionante de fórmula general (I) en la que: [R1R2R3NR5[N(R4)3]n] (n+1)+ (n+1)X - (I) X es un átomo o grupo aniónico R1, R2 y R3, que pueden ser iguales o diferentes, son cada uno CmH2m+1, en la que m varía entre 1 y 3, o CH2CHCH2 o CHCHCH3 R4 es CH2CHCH2 o CHCHCH3 n es 0 ó 1 R5 es un grupo alifático C15-C22 cuando n es 0; y es un grupo alifático C8-C16 cuando n es 1 cuando n es 0, al menos...

  12. 45.-

    Procedimiento para escribir y leer rápidamente ficheros pequeños para una memoria de datos WORM (Write Once Read Many - escribe una vez y lee cuanto quieras) seguro a toda prueba, utilizando un sistema operativo conocido y un sistema de hardware usual con acceso autorizado de clientes, caracterizado porque en un primer disco duro se encuentran un sistema operativo y un software de servidor WORM con un API (Application Programming Interface - Interfaz de Programación de Aplicaciones) , y un segundo disco duro sirve como área de trabajo y caché, y el archivo de los datos asegurados en unidades de almacenamiento en masa se realiza en Contenedores...

  13. 46.-

    Un procedimiento para la preparación de un sólido celular, cuyo procedimiento comprende las etapas de: a. preparar una solución de fase oleosa de tensioactivo de alrededor de 3-40% (peso/peso) en aceite, en donde el tensioactivo comprende un tensioactivo iónico y uno no iónico, mediante calentamiento de la solución hasta una temperatura en la que el tensioactivo funde en el aceite; b. preparar una solución de fase acuosa calentada mediante calentamiento de la solución a alrededor de la temperatura de la fase oleosa calentada según a.); c. combinar la solución de fase acuosa y la solución de fase oleosa para formar una composición de aceite/tensioactivo/acuosa;...

  14. 47.-

    Detector de transpondedores de RFID, que comprende: un primer par LC que incluye una primera bobina de inducción y un primer condensador de sintonía ; un segundo par LC que incluye una segunda bobina de inducción y un segundo condensador de sintonía , estando acoplado dicho primer par LC a dicho segundo par LC; una antena acoplada a dicho primer y segundo pares LC; un controlador acoplado a dicho primer y segundo pares LC para aplicar unos primeros impulsos y unos segundos impulsos a dicho primer y segundo pares LC, resonando de este modo dicho primer y segundo pares LC para producir una secuencia de primera y segunda señales...

  15. 48.-

    Polinucleótido aislado seleccionado del grupo que consiste en: (a) una secuencia de ácidos nucleicos que codifica un polipéptido CIP2 que tiene actividad de unión a celulosa y que tiene por lo menos un 85% de identidad en la secuencia con la secuencia de aminoácidos presentada como SEC ID NO:9, o el complemento de la misma; (b) una secuencia de ácidos nucleicos que codifica un polipéptido CIP2 que tiene actividad de unión a celulosa y que tiene por lo menos un 90% de identidad en la secuencia con la secuencia de aminoácidos presentada como SEC ID NO:9, o el complemento de la misma; (c) una secuencia de ácidos nucleicos que codifica un...

  16. 49.-

    Materiales composites basados en bio-híbridos zeína-arcilla, su procedimiento de obtención y usos de estos materiales.La presente invención describe un material composite que comprende un biohíbrido de zeína y arcilla con un polímero que puede ser de diversa naturaleza, así como un procedimiento de obtención de dicho material. La composición característica de este tipo de materiales los hace idóneos para diversos usos tales como material de embalaje y envasado de alimentos, soporte de medicamentos, soporte de herbicidas, insecticidas, fungicidas y otros plaguicidas, absorbente o secuestrante de micotoxinas, soporte para el crecimiento de células...

  17. 50.-

    Un método para el diagnóstico de la vaginosis bacteriana que comprende la detección de la actividad de la sialidasa en una muestra, cuyo método comprende las etapas siguientes: (a) contactar la mencionada muestra con un reactivo de prueba que comprenda el acido neuramico acetilo 5- bromo-4-cloro-3 indolyl α-D-N o bien una sal del mismo; y (b) detectar un cambio en el reactivo de prueba

  18. 51.-

    Un botón de prensión del tipo que comprende por una parte, una base o zócalo adaptado para ser fijado a un capó de tapa para artículo culinario y para delimitar, con el capó, un canal de evacuación de vapor, y, por otra parte, un órgano de prensión montado giratorio, según un eje de rotación , alrededor de la base , en una región angular de regulación de vapor delimitada por dos posiciones angulares extremas de regulación, de manera que pueda obstruir la abertura de salida del canal de evacuación en función de su posición angular en esta región, caracterizado por que la base y el órgano de prensión comprenden...

  19. 52.-

    Procedimiento para la preparación de derivados pirido[2,1-a]isoquinolina de fórmula: en la que R 2 , R 3 y R 4 se seleccionan, cada uno independientemente, de entre el grupo que consiste de hidrógeno, halógeno, hidroxi, alquilo C1-C6, alcoxi C1-C6 y alquenilo C1-C6, en el que alquilo C1-C6, alcoxi C1-C6 y alquenilo C1- C6 pueden sustituirse opcionalmente con un grupo seleccionado de entre alcoxicarbonilo C1-C6, arilo y heterociclilo, comprendiendo una o más de las etapas a), b), c) o d), en el que a) comprende la resolución óptica de una enamina de fórmula: en la que R 2 , R 3 y R 4 son tal como se ha definido anteriormente, y...

  20. 53.-

    Un método para detectar la presencia de un componente extraíble con ácido que produce un anillo de dispersión de rayos X a ángulos pequeños de sincrotrón (SAXS) en una muestra de pelo tomada de un sujeto para determinar si el sujeto tiene o no cáncer de mama, que comprende las etapas de: a) exponer la muestra de pelo a un ácido orgánico de manera que penetre en la muestra de pelo, produciendo de este modo una sustancia biológica derivada; b) obtener datos de la sustancia biológica derivada; c) comparar los datos obtenidos de la sustancia biológica derivada con un segundo grupo de datos contenidos en una base de datos de referencia...

  21. 54.-

    Un compuesto que tiene la estructura de Fórmula IIIm: Fórmula IIIm o una sal farmacéuticamente aceptable del mismo, en la que R81 se selecciona de un grupo que consiste en hidrógeno, halógeno, alquilo C1-C6 opcionalmente sustituido, alquenilo C2-C6 opcionalmente sustituido, alquinilo C2-C6 opcionalmente sustituido, cicloalquilo opcionalmente sustituido, heterocicloalquilo opcionalmente sustituido, arilo opcionalmente sustituido, heteroarilo opcionalmente sustituido, - OH, -NH2, -CN, -NO2, -C(O)OH, -S(O)2NH2, -C(O)NH2, -C(S)NH2, - NHC(O)NH2, - NHC(S)NH2, -NHS(O)2NH2, -OR68, -SR68, -NR69R68, -C(O)R68, -C(S)R68, -C(O)OR68, -C(O)NR69R68,...

  22. 55.-

    Hidrogeles basados en poloxámeros con estructura de estrella para liberación controlada de sustancias activas.La presente invención describe una serie de compuestos basa. La presente invención describe un compuesto basado en poloxámeros y un hidrogel que comprende estos compuestos, así como el uso de estos hidrogeles como vehículos para la administración de sustancias activas o como adyuvantes en composiciones farmacéuticas, especialmente en las que se administran por vía tópica ocular

  23. 56.-

    Sistema para identificar objetos y localizaciones geográficas, junto con información anexa a los mismos, dicha identificación realizada por un dispositivo portado por un usuario, comprendiendo:- una etiqueta RFID ubicado en cada objeto o localización a identificar, configurado para ser sondeado y transmitir una respuesta con información de localización;- el dispositivo de identificación portado por el usuario, comprendiendo:- un emisor/receptor RFID para emitir periódicamente la señal de radiofrecuencia y recibir la respuesta de la etiqueta RFID;- medios de decodificación para decodificar la respuesta y obtener una señal decodificada;- medios...

  24. 57.-

    Material aplicable para obtener filmes biodegradables para bolsas por extrusión y soplado, y método de preparación del mismo que se centra en la formulación y procesado de bioplásticos a partir de almidones reactivos, polialcoholes reactivos y derivados celulósicos reactivos que, mediante coextrusión-soplado con poliésteres biodegradables, puedan dar lugar a filmes para bolsas biodegradables. Para ello, se mezclan, en diferentes etapas: a) almidón funcionalizado con grupos isocianatos en hidroxilos terminales y cadenas polialcohólicas igualmente funcionalizadas; b) mezcla de poliéster y de derivado de celulosa funcionalizado terminalmente; y,...

  25. 58.-

    Colector concentrador solar que comprende una pluralidad de elementos reflectores solares individuales que tienen movimiento de giro vertical independiente y que están soportados en una estructura que comprende al menos un eje vertical giratorio y una pluralidad de ejes horizontales, está caracterizado porque cada elemento reflector solar individual refleja los rayos solares sobre un elemento absorbedor de la energía solar que está situado separadamente del colector concentrador solar y que absorbe la energía de los rayos solares para el uso directo del calor o su transmisión a un elemento que deba ser calentado. Un concentrador solar de este...

  26. 59.-

    Un stent implantable que comprende: a. una estructura de flanco de stent que comprende una pluralidad de vástagos y huecos en la estructura de flanco , en la que al menos un vástago (110a) comprende una superficie abluminal , una superficie luminal y una primera superficie lateral , y en la que el vástago (110a) comprende un primer material; b. al menos una cavidad dispuesta en el al menos un vástago (110a), en la que la cavidad tiene una primera abertura que está en comunicación fluida con la superficie abluminal y una segunda abertura que está en comunicación fluida con la primera superficie lateral , en la que...

  27. 60.-

    Procedimiento para la descontaminación por radiación de un producto que presenta por lo menos una cara parcialmente transparente a las radiaciones, que comprende por lo menos una etapa de exposición durante la cual se utilizan dos generadores de radiación para exponer por lo menos una primera parte de dicho producto a un primer nivel de radiación y por lo menos una segunda parte de dicho producto a un nivel segundo de radiación, caracterizado porque dicha por lo menos una cara parcialmente transparente a las radiaciones de dicho producto comprende una primera parte de dicho producto que comprende un contorno periférico...

  28. 61.-

    Dispositivo de compresión peniana , que comprende un primer brazo de soporte semi-rígido ; un segundo brazo de soporte semi-rígido , estando conectados el primer y el segundo brazos de soporte por sus extremos opuestos en la dirección longitudinal de los mismos, estando desviados el primer y el segundo brazos de soporte el uno hacia el otro en una posición de reposo, y pudiendo comprimirse desde la dirección longitudinal, de manera que los brazos de soporte pueden deformarse separándose el uno del otro; una región abierta formada entre el primer y el segundo brazos de soporte cuando los brazos de soporte se deforman; en el...

  29. 62.-

    Composición farmacéutica soluble que comprende una insulina acilada y que además comprende más de 4 átomos de zinc por cada 6 moléculas de insulina acilada, donde la insulina acilada comprende una molécula de insulina con una cadena lateral unida a un grupo -amino de un residuo Lys presente en la cadena B de la insulina inicial, la cadena lateral tiene la siguiente fórmula general: donde W es: X es: que Y es: Z2 es: -W-X-Y-Z2 - un residuo de -aminoácido que tiene un grupo ácido carboxílico en la cadena lateral que forma el residuo, con uno de sus grupos ácido carboxílico, un grupo amida junto con un grupo -amino de...

  30. 63.-

    Un sistema de tratamiento por radiación , que comprende: un sistema de formación de imágenes estereoscópicas configurado para establecer un primer centro de formación de imágenes en una primera localización para posibilitar el tratamiento mediante tratamiento por radiación de una estructura anatómica objetivo desde una primera región en un marco de tratamiento de referencia, estando configurado adicionalmente el sistema de formación de imágenes para establecer un segundo centro de formación de imágenes en una segunda localización para posibilitar el tratamiento mediante tratamiento por radiación de la estructura...

  31. 64.-

    Dispositivo de control para controlar un consumo de energía de una carga en una red eléctrica, dicho dispositivo de control comprendiendo: medios para la detección de valores en un período de tiempo de una variable física de la red, dicha variable física variando dependiendo de una relación entre generación de electricidad y carga en la red; caracterizada por medios para determinar un promedio de movimiento de la variable física de la red a partir de lecturas del pasado de dichos valores de la variable física de la red; y medios para aumentar el consumo de energía de dicha carga cuando un valor detectado de dicha variable...

<< · 2 · > · 5 · 9 · 17 · 32 · >>