2,866 Patentes de diciembre de 2008 (pag. 65)

  1. 2049.-

    PASTA DE PIGMENTOS

    (12/2008)
    Solicitante/s: AKZO NOBEL COATINGS INTERNATIONAL B.V.. Inventor/es: JANS,ROBERTUS,JOZEF,FRANCISCUS, DE JONG,EUGENE,MICHAEL,ARNOLDUS. Clasificación: C09D17/00, C09D167/08, C09B67/00.

    Una pasta de pigmento para teñir una composición de revestimiento, pasta de pigmento que comprende al menos un material alquídico ramificado que posee una viscosidad inferior a 5 Pa.s a una temperatura de 23ºC a una tasa de cizallamiento de 100 s-1 , y uno o más pigmentos.

  2. 2050.-

    PROCEDIMIENTO DE OXIDACION PARA PREPARAR EL INTERMEDIO ACIDO 6.ALFA., 9.ALFA.-DIFLURO-11.BETA.,17.ALFA.-DIHIDROXI-16.ALFA.-METIL-ANDROST-1,4-DIEN-3-ONA 17 BETA-CARBOXILICO

    (12/2008)
    Ver ilustración. Solicitante/s: GLAXO GROUP LIMITED. Inventor/es: COOTE,STEVEN JOHN,GLAXOSMITHKLINE, ALBINSON,FREDERICK DAVID,GLAXOSMITHKLINE, ROBINSON,JOHN MALCOLM,GLAXOSMITHKLINE. Clasificación: C07J5/00, C07J31/00, C07J3/00.

    Un procedimiento para la preparación de un compuesto de fórmula (I) que comprende las siguientes etapas: (a) oxidación de una solución que contiene el compuesto de fórmula (II), en el que la etapa de oxidación comprende una reacción de oxidación que utiliza aire y/o oxígeno, seguido por; (b) precipitación del compuesto de fórmula (I) en forma cristalina a partir de la mezcla de reacción mediante adición de un antisolvente bajo condiciones de temperatura de 10ºC o más alta.

  3. 2051.-

    PROCEDIMIENTO PARA LA DETERMINACION DE FUERZAS, DEFORMACIONES Y AVERIAS DE PIEZAS CONSTITUIDAS POR UN MATERIAL SOLIDO

    (12/2008)

    Procedimiento para determinar los efectos de una fuerza mecánica sobre un objeto constituido por un material sólido según el cual se calculan las deformaciones y los esfuerzos engendrados por el esfuerzo mecánico en una serie de puntos del objeto por medio de un método de cálculo numérico en modalidad anelástica en la que el comportamiento del material sólido está representado por un modelo de comportamiento microscópico policristalino utilizando una serie de bloques ¿grano¿ cuyas deformaciones son determinadas a partir de una serie de sistemas de deslizamiento propios del material sólido, siendo nula la traza del tensor...

  4. 2052.-

    GLICOSILTRANSFERASAS DE CAMPYLOBACTER PARA LA BIOSINTESIS DE GANGLIOSIDOS Y MIMETICOS DE GANGLIOSIDO

    (12/2008)
    Ver ilustración. Solicitante/s: NATIONAL RESEARCH COUNCIL OF CANADA. Inventor/es: GILBERT, MICHEL, WAKARCHUK, WARREN, W. Clasificación: C12N15/09, C12Q1/68, C12N9/12, C12N15/54, C12N9/10, C12N1/21, C12N9/88, C12P19/18.

    Método para producir un oligosacárido que comprende un residuo de galactosa, comprendiendo el método poner en contacto un sacárido aceptor con una UDP-galactosa y un polipéptido de Beta-1,3-galactosiltransferasa que comprende una secuencia de aminoácidos que es al menos idéntica en un 75% a SEQ ID NO: 15 o SEQ ID NO: 17 a lo largo de una región de al menos 50 aminoácidos de longitud, en el que el polipéptido de Beta-1,3-galactosiltransferasa transfiere el residuo de galactosa desde la UDP-galactosa hasta el sacárido aceptor para formar el oligosacárido que comprende un residuo de galactosa.

  5. 2053.-

    PROCEDIMIENTO PARA GENERAR UNA SEÑAL DISPARADORA PARA UN DISPOSITIVO DE PROTECCION DE PEATONES

    (12/2008)
    Ver ilustración. Solicitante/s: ROBERT BOSCH GMBH. Inventor/es: MACK,FRANK. Clasificación: B60R21/01, B60R21/34.

    Procedimiento para generar una señal disparadora (AS) para un dispositivo de protección de peatones en el cual se determinan y evalúan datos de los sensores (a , a ) y, en el cual, tras detectar una colisión con un objeto, se generan características de los datos de los sensores (a , a ) que son evaluados para determinar una masa del objeto (mo) y una dureza del objeto (Do), luego se genera la señal disparadora (AS) para el dispositivo de protección de peatones, si la masa del objeto (m o) determinada y la dureza del objeto (D o) determinada se hallan dentro de un área de disparo (AB) que representa una colisión con un peatón, asimismo, los datos de los sensores (a , a ) comprenden informaciones de aceleración, asimismo, para determinar la dureza del objeto (Do) se evalúa una duración de un periodo de las informaciones de aceleración (a , a ), asimismo, se determina una frecuencia correspondiente a la dureza del objeto (Do) a partir de la duración de periodo.

  6. 2054.-

    AGENTES DE UNION SELECTIVOS A ANTIGENOS DE LA PROTEINA DE UNION A OSTEOPROTEGERINA

    (12/2008)
    Ver ilustración. Solicitante/s: AMGEN INC.. Inventor/es: BOYLE, WILLIAM, J., DESHPANDE,RAJENDRA,V, HITZ,ANNA, SULLIVAN,JOHN,KEVIN. Clasificación: A61P35/00, C12N15/13, C12N15/85, C12N5/10, C07K16/28, A61K39/395, C07K16/46, A61K38/22, A61P19/10.

    Un anticuerpo o dominio de unión a antígeno que reconoce un epítopo DE en proteína de unión a osteoprotegerina humana (OPGbp), a) siendo el epítopo DE un epítopo que comprende una porción de la secuencia de aminoácido de la región DE de OPGbp humana desde el radical de aminoácido 212 hasta el radical de aminoácido 250 de la secuencia GFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIP, y b) comprendiendo el epítopo DE la secuencia DLATE.

  7. 2055.-

    PROCEDIMIENTO PARA LA DETERMINACION DE UNA POSICION INTERMEDIA, CON ABERTURAS PARCIALES, DE UNA PERSIANA ARROLLABLE

    (12/2008)

    Procedimiento para la determinación de una posición intermedia con aberturas parciales (PIA) en un sistema de mando de un accionador que permite un desplazamiento de un dispositivo de protección solar, de ocultación o de cierre, que comprende lamas apilables , conectadas entre sí por zonas dotadas de aberturas , caracterizado por comprender las etapas siguientes: - referenciar, por análisis del par de fuerzas ejercido sobre el accionador , la posición de lama final (PLF) en la que la lama inferior se encuentra en el límite de contacto con el tope de la parte de abajo del dispositivo , - atribuir a...

  8. 2056.-

    ELEVADOR PARA EL MATERIAL DE TOMA DE MUESTRAS EN TANQUES VERTICALES DE ALMACENAMIENTO

    (12/2008)

    Elevador para el material de toma de muestras en tanques verticales de almacenamiento.#El elevador es aplicable a grandes tanques contenedores de productos que, por su propia naturaleza no permiten la utilización de elevadores eléctricos que pudieran generar chispas peligrosas, y tiene como finalidad evitar a los operarios tanto el esfuerzo físico como el riesgo que supone subir y bajar las clásicas escaleras laterales del tanque transportando el material para la toma de muestras que se realiza en la extremidad superior de dicho tanque . El elevador se materializa en dos bastidores y , el primero destinado...

  9. 2057.-

    ASIENTO DE VEHICULO AUTOMOVIL

    (12/2008)
    Ver ilustración. Solicitante/s: BROSE FAHRZEUGTEILE GMBH & CO. KOMMANDITGESELLSCHAFT, COBURG. Inventor/es: HOFMANN, JOCHEN, FISCHER,MATTHIAS. Clasificación: B60N2/20.

    Asiento de vehículo automóvil con - un respaldo (R) montado de manera giratoria, con una inclinación ajustable, que presenta un lado (V) anterior que sirve para apoyar la espalda de un usuario del asiento, y - una disposición (D, L) de resorte con al menos un elemento (D) elástico, con el que el respaldo (R) está pretensado elásticamente de tal modo, que tiene la tendencia a girar hacia delante y a apoyarse con su lado (V) anterior contra la espalda del usuario del asiento, - pudiendo regularse la inclinación del respaldo (R) mediante la acción de fuerza sobre su lado anterior en contra de la acción de la disposición (D, L) de resorte, caracterizado porque la disposición (D, L) de resorte se engancha con un elemento de transmisión, que está acoplado con el respaldo (R) y al que está asociado un dispositivo de bloqueo, con el que el elemento de transmisión puede bloquearse en diferentes posiciones.

  10. 2058.-

    METODO DE FABRICACION DE UN COMPONENTE PARA UN APARATO DE DEPOSITO DE GOTITAS

    (12/2008)
    Ver ilustración. Solicitante/s: XAAR TECHNOLOGY LIMITED. Inventor/es: DRURY, PAUL, RAYMOND. Clasificación: B41J2/16, B41J2/14.

    Un método de formación de un componente de placa de boquillas para un aparato de depósito de gotitas, comprendiendo dicho método las operaciones: formar un cuerpo de un primer material, teniendo dicho cuerpo una periferia, formar una placa de segundo material alrededor de dicho cuerpo de tal modo que la placa se extienda alrededor de al menos una parte de dicha periferia de dicho cuerpo, y formar una boquilla que se extienda a través de dicho cuerpo.

  11. 2059.-

    DEMULTIPLEXADOR OPTICO

    (12/2008)
    Ver ilustración. Solicitante/s: UNIVERSIDAD POLITECNICA DE VALENCIA. Inventor/es: SANCHEZ DEHESA,JOSE, HAKANSSON,ANDREAS. Clasificación: G02B27/09.

    El demultiplexador óptico.#El demultiplexador es un dispositivo ultracompacto que separa espacialmente un haz incidente en al menos dos haces con sendas longitudes de onda (·1, ·2), formando entre sí un ángulo (·) prefijado. El dispositivo, representado por dos rejillas de barras , consta de una pluralidad de capas de barras , fabricadas en material dieléctrico. Disponiendo de un plano , que determina la región donde tales longitudes de onda (·1, ·2) son recogidas para su análisis, situado a una distancia (xf) del dispositivo, los haces dispersados presentan una determinada anchura (·) y se separan del eje del haz incidente con una distancia de separación (d). Tanto el grosor del dispositivo, la sección de las barras, como el material de su fabricación vienen determinados por el ángulo (·) de separación requerido, optimizándolos para minimizar la diafonía entre canales ópticos a dichas longitudes de onda (·1, ·2).

  12. 2060.-

    UN PROCESO DE INJERTO CONTROLADO DE RADICAL DE UNA POLI-OLEFINA

    (12/2008)
    Ver ilustración. Solicitante/s: UNIVERSITA' DI PISA. Inventor/es: CIARDELLI, FRANCESCO, PASSAGLIA,ELISA, COIAI,SERENA. Clasificación: C08F8/00, C08F255/02, C08F8/30, C08F8/34.

    Un proceso controlado de injerto de radical de una poli-olefina, procedente de unidades monoméricas formadas por alfa-olefinas, que comprende la reacción de la poli-olefina y al menos un iniciador de reacción de radical con un sistema de injerto que comprende al menos un compuesto de injerto que tiene un anillo heterocíclico donador de electrones conjugado con al menos un grupo -HC=CR1R2, en el que al menos uno de R1 y R2 es un grupo funcional aceptor de electrones, en el que dicho sistema de injerto incluye además al menos un compuesto insaturado que presenta al menos un grupo que es capaz de reaccionar con un grupo funcional amínico y/o carboxílico y/o hidroxílico y se escoge entre compuestos acrílicos y metacrílicos, anhídrido maleico, derivados éster de anhídrido maleico y sus mezclas.

  13. 2061.-

    METODO PARA DISMINUIR EL CONTENIDO DE ACETALDEHIDO DE POLIESTERES PROCESADOS EN ESTADO FUNDIDO

    (12/2008)
    Ver ilustración. Solicitante/s: THE COCA-COLA COMPANY. Inventor/es: RULE, MARK, SHI, YU. Clasificación: C08K5/20, C08K5/00, C08K5/21.

    Un método para disminuir el contenido de acetaldehído de un poliéster procesado en estado fundido, que comprende combinar con el poliéster un compuesto orgánico el cual es sustancialmente térmicamente estable a la temperatura de procesado del poliéster en estado fundido, que al menos comprende dos fragmentos moleculares componentes, en el que al menos uno de los fragmentos moleculares componentes incluye un anillo preformado y cada fragmento molecular componente al menos comprende dos heteroátomos de nitrógeno, sustituidos con átomos de hidrógeno, enlazados a átomos de carbono del fragmento molecular componente, y en el que cada uno de los fragmentos moleculares componentes reacciona con acetaldehído en el poliéster para formar agua y un fragmento molecular orgánico resultante que comprende un anillo no puenteado de 5 ó 6 miembros que al menos incluye dos heteroátomos de nitrógeno.

  14. 2062.-

    FORMULACION DISPERSABLE DE MICROPARTICULAS DE ALENDRONATO

    (12/2008)
    Ver ilustración. Solicitante/s: SANOVEL ILAC SANAYI VE TICARET ANONIM SIRKETI. Inventor/es: ONER,LEVENT, IFTER,UMIT, SAKARYA,NISA, TURKYILMAZ,ALI. Clasificación: A61K31/663, A61K9/50, A61K31/734.

    Una formulación farmacéutica dispersable para administración oral a dosis terapéuticas que comprende micropartículas de alendronato y ácido algínico o alginato de sodio o mezclas de los mismos, caracterizada porque dichas micropartículas de alendronato están recubiertas con un polímero resistente al pH salival de 6-7,5, pero soluble en el pH gástrico de 1-4.

  15. 2063.-

    DISPOSITIVO OPTICO DE MEDICION DE LA POSICION

    (12/2008)
    Ver ilustración. Solicitante/s: DR. JOHANNES HEIDENHAIN GMBH. Inventor/es: MAYER,ELMAR, BENNER,ULRICH. Clasificación: G01D5/347, G02B3/00, G01B1/00, G01D5/38.

    Un dispositivo óptico de medición de la posición con una unidad de exploración , que contiene una fuente de luz , un plano de representación y una óptica de lentes para la generación de una imagen de una estructura de red periódica en el plano de representación caracterizado porque la óptica de lentes se compone de una serie de lentes periódica con el periodo de red o la separación mutua entre lentes adyacentes (Ver fórmula) con A G (r) el periodo de red de la serie de lentes, t (r) el periodo de la estructura de red periódica , |Beta(r)| la magnitud absoluta de la escala de representación Beta de la serie de lentes , psi un salto de fase predeterminable, definido, r el radio de la disposición de red, donde para una red lineal r = infinito y A G, t y |Beta| son constantes, i, k, n epsilon N, es decir, son números naturales incluyendo el cero.

  16. 2064.-

    MEJORAS RELACIONADAS CON ARTICULOS DE LIMPIEZA DE LA TAZA DEL RETRETE

    (12/2008)

    Un artículo de fabricación para la taza del retrete , que comprende: a) Una composición de agentes de limpieza, agentes desinfectantes, agentes para el tratamiento del agua o agentes desincrustantes , y sus mezclas; b) Un perfume gelificado ; y c) Una caja que comprende: (i) una primera cámara que tiene una cubierta para contener dicha composición, primera cámara que tiene una cubierta y que al menos tiene un orificio de entrada y al menos un orificio de salida ; dicho al menos orificio de entrada está colocado en la primera cámara; (ii) una segunda cámara que contiene dicho perfume;...

  17. 2065.-

    POLIMEROS QUE REDUCEN LA RESISTENCIA AL AVANCE Y DISOLUCIONES Y SUSPENSIONES DE POLIMEROS QUE REDUCEN LA RESISTENCIA AL AVANCE

    (12/2008)
    Ver ilustración. Solicitante/s: CONOCOPHILLIPS COMPANY. Inventor/es: MILLIGAN,STUART, SMITH,KENNETH W. Clasificación: C08K5/00, C08F2/00, C08L101/00, C08J3/00, F17D1/17, C08F210/00, C08F2/02, F17D1/16, C08L23/24, C08F212/02.

    Un copolímero de peso molecular ultra-elevado útil como agente reductor de la resistencia al avance para hidrocarburos, que comprende: a) un monómero aromático de vinilo, en el que el monómero aromático de vinilo comprende uno o más monómeros que se escogen en el grupo formado por estireno, alquil-estireno con un grupo alquilo que tiene entre 1 y 10 átomos de carbono, vinilnaftaleno, y vinil alquilnaftaleno con un grupo alquilo que tiene entre 1 y 10 átomos de carbono y; b) un primer monómero de alfa-olefina que tiene una longitud de cadena carbonada de entre 2 y 20 átomos de carbono, en el que el copolímero de peso molecular ultra-elevado es considerablemente no cristalino y tiene un peso molecular mayor que 5 millones.

  18. 2066.-

    USO DE UN LIPOPEPTIDO O UNA LIPOPROTEINA COMO ADYUVANTE EN LA VACUNACION TERAPEUTICA O PROFILACTICA

    (12/2008)
    Ver ilustración. Solicitante/s: GBF GESELLSCHAFT FUR BIOTECHNOLOGISCHE FORSCHUNG MBH. Inventor/es: MIHLRADT, PETER, GUZMAN,CARLOS,ALBERTO. Clasificación: A61K39/39, A61P31/00.

    Uso de un lipopéptido o una lipoproteína de estructura (I) (Ver fórmula) en la que R1 y R2 que pueden ser iguales o distintos entre sí, representan alquilo C7 - 25, alquenilo C7 - 25 o alquinilo C7 - 25 X representa S, O o CH2, R3 y R4 independientemente entre sí representan H o metilo e Y representa una secuencia de aminoácidos no inmunógena por sí misma en la especie usada y compatible fisiológicamente, compuesta por de 1 a 25 restos de aminoácido, y el átomo de carbono asimétrico marcado con * tiene según la regla de Cahn-Ingold-Prelog la configuración R absoluta, como adyuvante mucoso en la vacunación terapéutica o profiláctica a través de las mucosas.

  19. 2067.-

    FORMULACIONES FARMACEUTICAS DE AGENTES ANTINEOPLASICOS, EN PARTICULAR TEMOZOLOMIDA, PROCEDIMIENTOS DE OBTENCION Y DE USO

    (12/2008)
    Ver ilustración. Solicitante/s: SCHERING CORPORATION. Inventor/es: UGWU,SYDNEY, RADHAKRISHNAN,VINAY, IHNAT,PETER,M, WITCHEY-LAKSHMANAN,LEONORE,C. Clasificación: A61P35/00, A61K47/12, A61K47/18, C07D487/04, A61K31/66, A61K47/10, A61K47/26, A61K9/08, A61K31/395, A61K47/34, A61K31/704, A61K47/36, A61K47/38, A61K31/4188, A61K9/19, A61K47/04, A61K47/40.

    Una formulación farmacéutica que comprende temozolomida o una de sus sales farmacéuticamente aceptables, al menos un diluyente acuoso, y al menos un agente mejorador de !a disolución suficiente para disolver sustancialmente dicha temozolomida, en donde el agente mejorador de la disolución es urea, L-histidina, L-treonina, L-asparagina, L-serina, L-glutamina y sus mezclas.

  20. 2068.-

    RECEPTACULO DE PARED PARA UN SISTEMA DE AIRE ACONDICIONADO

    (12/2008)
    Ver ilustración. Solicitante/s: AERMEC S.P.A. Inventor/es: RIELLO, VALERIO GIORDANO. Clasificación: F24F13/20, F24F13/32.

    Un módulo para permitir el acabado de un espacio realizado en una pared , el mencionado espacio siendo adecuado para permitir de forma desmontable el montaje mural de un terminal de un sistema de acondicionamiento de aire, el módulo comprendiendo una estructura que puede ser incrustada, al menos parcialmente, en la pared en la que está formado el mencionado espacio , la mencionada estructura incluyendo elementos verticales y elementos transversales unidos al menos a las extremidades superiores de los mencionados elementos verticales, los mencionados elementos verticales y elementos transversales definiendo el borde perimétrico de la estructura, caracterizado porque incluye además mallas de colocación y soporte , que se proyectan transversalmente desde el borde perimétrico de la estructura.

  21. 2069.-

    SENSOR DE LLUVIA, EN ESPECIAL PARA UN VEHICULO DE MOTOR

    (12/2008)
    Ver ilustración. Solicitante/s: ROBERT BOSCH GMBH. Inventor/es: WOLF, FRANK, SAUTTER, HELMUT, YANG, ZISHAO, JERGER,ARMIN, THOMINET,VINCENT, HOCHENBLEICHER,GERHARD. Clasificación: B60S1/08, G01N21/55.

    Sensor de lluvia, en especial para un vehículo de motor, con al menos un emisor que emite una radiación, al menos un receptor que recibe la radiación del emisor y al menos un elemento (22a, 22b) difractivo configurado holográficamente, dispuesto en la región del emisor, caracterizado porque el elemento (22a, 22b) presenta una estructura de tipo rejilla lineal y difracta la radiación en un primer y en un primer orden negativo, y porque están previstos más receptores que emisores.

  22. 2070.-

    COMPUESTOS DE GABA N-ALQUILADOS, PROCEDIMIENTOS PARA SU PREPARACION Y SU USO COMO MEDICAMENTOS

    (12/2008)

    Un compuesto de fórmula (I) (Ver fórmula) incluyendo isómeros geométricos, enantiómeros, diasteréomeros, racematos y sus sales farmacéuticamente aceptables, en la que: - R 0 se selecciona del grupo formado por -OR 1 , -SR 1 o -NR 2 R 1 ; - R 1 y R 2 se seleccionan independientemente del grupo formado por hidrógeno, alquilo, alquenilo, alquinilo, cicloalquilo, cicloalquenilo, heterociclo, arilo, aril-alquilo, derivados acilo, imidoílo, amido, ester, oxo y -(L 1 )-R 3 , o conjuntamente son -L 2 -; si R 0 es -NR 2 R 1 , entonces R 1 puede ser también derivados oxi- o derivados amino; - R 3...

  23. 2071.-

    DISPOSITIVO DE DISPENSACION Y METODO PARA SU LLENADO

    (12/2008)
    Ver ilustración. Solicitante/s: AFA POLYTEK B.V. Inventor/es: MAAS, WILHELMUS, JOHANNES, JOSEPH, HURKMANS, PETRUS, LAMBERTUS, WILHELMUS. Clasificación: B05B11/00, B65D47/34, B65D83/76, B65D41/17, B67B3/22.

    Dispositivo de dispensación, que comprende un recipiente y una cabeza de dispensación conectados al mismo, incluyendo dichos recipiente y cabeza medios de acoplamiento por salto elástico que comprenden una pluralidad de orejetas dispuestas sobre una de las dos partes que han de ser conectadas y una pluralidad de rebajes dispuestos en la otra parte para recibir las orejetas , caracterizado porque al menos una de las orejetas es deformable elásticamente y al menos otra de las orejetas es relativamente rígida y no deformable.

  24. 2072.-

    ALETA COMPRESOR

    (12/2008)
    Ver ilustración. Solicitante/s: LG ELECTRONICS INC.. Inventor/es: LEE,CHANG-SOO,SEOKBONG-MAEUL DAEDONG. Clasificación: F04C2/356, F04C18/356, F01C1/356.

    Aleta de compresor que comprende: una preforma de aleta que está insertada en una ranura de un cilindro que tiene un espacio de compresión (P), presenta un grosor y un área predeterminados para dividir el espacio de compresión del cilindro en una zona de succión (a) y una zona de compresión (b), y tiene un lado de contacto lineal en un pistón giratorio , realizando un movimiento alternativo lineal de acuerdo con el giro del pistón giratorio , haciendo contacto lineal en el pistón giratorio que se encuentra situado en el espacio de compresión del cilindro ; caracterizado por el hecho de que comprende, además, fibra que está insertada en el interior de la preforma de aleta y formada en la misma dirección que la dirección de movimiento de la aleta.

  25. 2073.-

    PROCEDIMIENTO DE FABRICACION DE ANAGRELIDA

    (12/2008)

    Un procedimiento de fabricación de una 6,7-dihalo-1,5-dihidroimidazo[2,1-b]quinazolin-2(3H)-ona de la fórmula (III) a partir de un 2,3-dihalobenzaldehído de la fórmula (IX) que comprende las etapas de: (a) nitrar un compuesto de la fórmula (IX): (Ver fórmula) para formar un compuesto de la fórmula (X): (Ver fórmula) (b) hacer reaccionar el compuesto de la fórmula (X) en condiciones de reducción para formar un compuesto de la fórmula (XI): (Ver fórmula) (c) hacer reaccionar el compuesto de la fórmula (XI) en condiciones de cloración para formar un compuesto de la fórmula (VIII):...

  26. 2074.-

    ACOPLAMIENTO

    (12/2008)

    Acoplamiento simétrico rotatorio con un cubo en forma de anillo, que está constituido por un material esencialmente rígido y está rodeado por un anillo exterior de material goma elástico, así como con un contorno exterior dispuesto en el diámetro exterior , a través del cual se transmiten pares de torsión por unión positiva, en el que en el anillo exterior en la proximidad del contorno exterior está incrustado un cuerpo sólido rígido , esencialmente en forma de anillo, en el material goma elástico del anillo exterior , que presenta de la misma manera un contorno exterior...

  27. 2075.-

    DISPOSITIVO DE GUIA DE ONDAS LANZADOR PARA LA EXCITACION DE UN RECINTO

    (12/2008)
    Ver ilustración. Solicitante/s: M.E.S. TECHNOLOGIES. Inventor/es: GERMAIN, ALAIN, BERTEAUD, ANDRE-JEAN, MAHE, PATRICK, DELMOTTE,MICHEL. Clasificación: H01P5/103.

    Dispositivo de guía de ondas lanzador para la excitación de un recinto mediante microondas procedentes de un emisor apto para hacer que reine en la guía de ondas del dispositivo un campo (E, H) electromagnético de microondas que tienen una longitud de onda lambdag, comprendiendo el dispositivo un emplazamiento para el emisor que define un plano (P0) del emisor y dos paredes de reflexión de onda cerca de las cuales están situadas respectivamente dos salidas principales para las microondas, caracterizado porque las dos paredes de reflexión de onda están respectivamente alejadas del plano del emisor una distancia (D1) sensiblemente igual a 0,2 lambdag + k lambdag/2 y una distancia (D2) sensiblemente igual a 0,3 lambdag + p lambdag/2, donde k y p son números enteros.

  28. 2076.-

    MEDIO DE GRABACION DE INFORMACION, APARATO DE GRABACION, APARATO DE REPRODUCCION, PROCEDIMIENTO DE GRABACION, Y PROCEDIMIENTO DE REPRODUCCION

    (12/2008)
    Ver ilustración. Solicitante/s: MATSUSHITA ELECTRIC INDUSTRIAL CO., LTD.. Inventor/es: UEDA, HIROSHI, ISHIDA, TAKASHI, YAMAMOTO, YOSHIKAZU, SHOJI,MAMORU, ITO,MOTOSHI, NAKAMURA,ATSUSHI. Clasificación: G11B7/24, G11B7/0045, G11B20/12, G11B7/00, G11B7/125, G11B7/007, G11B5/09.

    Medio óptico de grabación de información que comprende: una pluralidad de capas de grabación ; y un área de información del disco que presenta un área para almacenar información relacionada con el disco, en el que el área de información del disco está prevista en una primera capa de grabación , que es una de la pluralidad de las capas de grabación, y una segunda capa de grabación , que es otra de la pluralidad de las capas de grabación, caracterizado porque se graban unos datos ficticios en el área restante del área de información del disco, y porque la longitud del área para almacenar los datos ficticios es un múltiplo entero de la longitud del área para almacenar la información del disco.

  29. 2077.-

    HERRAMIENTA ELECTRICA PORTATIL

    (12/2008)
    Ver ilustración. Solicitante/s: HILTI AKTIENGESELLSCHAFT. Inventor/es: STREICHER, HARALD, DR., GOEDICKEMEIER, MARTIN, KOSLOWSKI,OLIVER, MELZER,LARS. Clasificación: B25F5/00.

    Herramienta eléctrica portátil con una carcasa y un accionamiento dispuesto en la carcasa y con un canal de refrigerante para un medio refrigerante para la refrigeración del accionamiento , caracterizada por, al menos, un medio compensador de volumen para el canal del refrigerante.

  30. 2078.-

    AGENTES LIQUIDOS DE LAVADO Y LIMPIEZA CON POLIMEROS QUE CONFIEREN CONSISTENCIA

    (12/2008)

    Agentes líquidos de lavado, limpieza, desinfección y blanqueo, que contienen copolímeros obtenidos por copolimerización de a1) de 1 a 50% en peso de los monómeros que proporcionan una unidad estructural repetida de la fórmula (Ver fórmula) significando n un número entero de 2 a 9, o a2) de 1 a 50% en peso de una mezcla de los monómeros, que proporcionan una unidad estructural repetida de la fórmula y de la unidad estructural repetida de la fórmula (Ver fórmula) pudiendo R, R 1 y R 2 ser iguales o diferentes y significando hidrógeno o un grupo alquilo o alquenilo lineal...

  31. 2079.-

    COMPOSICIONES ACUOSAS CURABLES DE ENERGIA EN FASE UNICA

    (12/2008)
    Ver ilustración. Solicitante/s: SUN CHEMICAL CORPORATION. Inventor/es: GAUDL, KAI-UWE, LAKSIN, MIKHAIL, CHATTERJEE, SUBHANKAR, TURGIS,JEAN-DO, JONES,RICHARD M, YOUNG,NEIL, LINZER,VOLKER, ROONEY,JOHN. Clasificación: C09D11/00, C09D4/00.

    Composición acuosa curable por radiación de haz de electrones, que comprende: (a) agua; (b) un oligómero etilénicamente insaturado; (c) una resina etilénicamente insaturada soluble en agua que contiene grupos funcionales básicos o ácidos neutralizados, que es un material tensioactivo que incorpora químicamente estructuras hidrófilas e hidrófobas; en la que la composición resultante una disolución de una sola fase, que no contiene un fotoiniciador.

  32. 2080.-

    DEPOSITO DE COMBUSTIBLE PARA COMPACTADORAS ACCIONADAS POR MOTOR DE COMBUSTION Y RECEPTACULO DEL DEPOSITO DE COMBUSTIBLE DE UNA COMPACTADORA

    (12/2008)
    Ver ilustración. Solicitante/s: HILTI AKTIENGESELLSCHAFT. Inventor/es: ROSENBAUM, ULRICH, WOLF, IWAN, BONIG,STEFAN, ZAHNER,MARIO. Clasificación: B25C1/08.

    Depósito de combustible para compactadoras portátiles, con un elemento de unión presentando un medio de fijación y con una salida de válvula para la salida del combustible, caracterizado porque el elemento de unión con el medio de fijación se dispone en una zona final apartada de la salida de válvula.

<< · 33 · 49 · 57 · 61 · 63 · < · 65 · > · 68 · 71 · 77 · >>