2,539 Patentes de mayo de 2005 (pag. 74)

  1. 2337.-

    QUINOXALINADIONAS.

    (05/2005)
    Solicitante/s: PFIZER LIMITED PFIZER INC.. Inventor/es: CROOK, ROBERT, JAMES, STOBIE, ALAN, GAUTIER, ELISABETH, COLETTE, LOUISE, WAITE, DAVID, CHARLES. Clasificación: C07D401/14, A61K31/495.

    La presente invención proporciona un compuesto esencialmente puro de fórmula (I) o una sal o solvato farmacéuticamente aceptable del mismo, junto con las composiciones que lo contienen, los usos del mismo, los procedimientos de fabricación y los productos intermedios utilizados en la preparación de dichos compuestos.

  2. 2338.-

    REVESTIMIENTO PARA EXTERIOR, COMPOSICION UTIL PARA ESTOS REVESTIMIENTOS Y PROCEDIMIENTO DE OBTENCION DE ESTOS REVESTIMIENTOS.

    (05/2005)
    Solicitante/s: RODHIA CHIMIE. Inventor/es: NABAVI, MINOU, JEANNETTE, THIERRY, PRAT, EVELYNE, FROUIN, LAURENT. Clasificación: C08G18/62, C08G18/70.

    LA PRESENTE INVENCION SE REFIERE A UNA COMPOSICION UTIL PARA REVESTIMIENTOS DE SUELOS INDUSTRIALES Y REVESTIMIENTOS EXTERIORES. ESTA COMPOSICION SE DEFINE PORQUE COMPRENDE POR ADICION SUCESIVA O SIMULTANEA: UNA FASE ACUOSA QUE COMPRENDE UNA DISPERSION DE POLIOL CUYA TEMPERATURA DE TRANSICION VITREA (T SUB,G ) ESTA COMPRENDIDA ENTRE -50 Y +40 C; UNA SUBCOMPOSICION DE ISOCIANATO YA EN EMULSION O POR PONER EN EMULSION. APLICACION COMO REVESTIMIENTOS DE SOPORTES MINERALES DE POROSIDAD VARIABLE COMO LOS HORMIGONES, MORTEROS, ENLUCIDOS DE FACHADAS, ESCAYOLA, PIEDRA.

  3. 2339.-

    DISPOSITIVO DE INYECCION.

    (05/2005)
    Ver ilustración. Solicitante/s: DELAB. Inventor/es: CHERIF-CHEIKH, ROLAND. Clasificación: A61M5/32.

    LA INVENCION SE REFIERE A UN DISPOSITIVO PARA INYECTAR UNA COMPOSICION LIQUIDA O SEMISOLIDA A UN SUJETO.

  4. 2340.-

    ARCO COMPUESTO CON UN CONTRAPESO.

    (05/2005)
    Ver ilustración. Solicitante/s: MCPHERSON, MATHEW A. Inventor/es: MCPHERSON, MATHEW A. Clasificación: F41B5/10.

    UN CUERPO DE LEVA SEGUN LA INVENCION INCLUYE UN CONTRAPESO QUE GENERA UNA FUERZA CENTRIFUGA NETA QUE ACTUA CONTRA LA FUERZA HACIA DELANTE DEL ARCO.

  5. 2341.-

    INJERTOS TUBULARES A PARTIR DE SUBMUCOSA PURIFICADA.

    (05/2005)
    Ver ilustración. Solicitante/s: COOK BIOTECH, INC. MED INSTITUTE, INC. Inventor/es: FEARNOT, NEAL, E., HILES, MICHAEL, C. Clasificación: A61F2/06.

    SE HA DESARROLLADO UN TUBO FACIL DE PRODUCIR Y MECANICAMENTE FUERTE DE UNA PROTESIS DE INJERTO IMPLANTABLE QUE SE FABRICA EN CUALQUIER LONGITUD DESEADA, CON CUALQUIER GROSOR Y DIAMETRO. LA CONSTRUCCION PRODUCIDA MEDIANTE EL PROCEDIMIENTO DE LA INVENCION PUEDE UTILIZARSE COMO INJERTO PARA ARTERIAS, VENAS, URETERES, URETRAS, DESVIACIONES O CUALQUIER APLICACION EN LA QUE SE NECESITE UN TUBO ADAPTABLE, COMPATIBLE CON EL TEJIDO. LA MANUFACTURA DE LA PROTESIS DE INJERTO GENERALMENTE COMPRENDE EL ENROLLADO DE LAMINAS MULTIPLES DE UNA ESTRUCTURA DE MATRIZ PURIFICADA, BASADA EN COLAGENO ALREDEDOR DE UN MANDRIL, LA COMPRESION Y EL SECADO DEL TEJIDO SOBRE EL MANDRIL ANTES DE SEPARAR LA CONSTRUCCION PARA SU EVENTUAL UTILIZACION.

  6. 2342.-

    COMPOSICION FARMACEUTICA QUE COMPRENDE UN COMPUESTO QUE TIENE ACTIVIDAD ANTI-XA Y UN COMPUESTO ANTAGONISTA DE LA AGREGACION PLAQUETARIA.

    (05/2005)

    LA PRESENTE INVENCION SE REFIERE A UNA COMPOSICION FARMACEUTICA QUE COMPRENDE UN COMPUESTO DE ACTIVIDAD ANTI - XA, UN COMPUESTO ANTAGONISTA DE LA AGREGACION DE PLAQUETA Y UN VEHICULO FARMACEUTICAMENTE ACEPTABLE. ESTA INVENCION SE REFIERE TAMBIEN A UN PROCEDIMIENTO QUE PERMITE TRATAR O PREVENIR, EN UN PACIENTE, UN ESTADO TROMBOGENO ASOCIADO CON UN TRASTORNO ISQUEMICO DEBIDO A UNA TROMBOSIS Y QUE CONSISTE EN ADMINISTRAR AL PACIENTE UNAS CANTIDADES FARMACEUTICAMENTE EFICACES DE UN COMPUESTO DE ACTIVIDAD ANTI - XA Y DE UN COMPUESTO ANTAGONISTA DE LA AGREGACION...

  7. 2343.-

    METODO PARA AUMENTAR EL RENDIMIENTO DE UN FERTILIZANTE.

    (05/2005)
    Solicitante/s: AUXEIN CORPORATION. Inventor/es: KINNERSLEY, ALAN, M., COLEMAN, ROBERT, D., KINNERSLEY, CHENG-YUH, MCINTYRE, JOHN, L. Clasificación: A01N37/44, A01N33/04, C05G3/00.

    ESTA INVENCION DESCRIBE UNAS COMBINACIONES DE FERTILIZANTES CON COMPUESTOS ORGANICOS, PARA INCREMENTAR LA EFICACIA DEL FERTILIZANTE, LA PRODUCCION VEGETAL, EL CRECIMIENTO Y LA ACUMULACION DE LOS ELEMENTOS NUTRITIVOS. SE OBTIENEN ESTOS EFECTOS BENEFICOS GRACIAS A UNAS COMBINACIONES CONSTITUIDAS POR UN FERTILIZANTE Y POR UN ACIDO AMINADO ESCOGIDO ENTRE EL ACIDO GA - AMINOBUTIRICO, EL ACIDO GLUTAMICO Y UNA MEZCLA DE ACIDO GA - AMINOBUTIRICO Y DE ACIDO GLUTAMICO. SE PUEDEN USAR TAMBIEN UNA FUENTE DE ACIDOS AMINADOS PROTEINADOS Y UN ESQUELETO CARBONADO CON EL FERTILIZANTE Y EL ACIDO AMINADO EN CUESTION. ESTA INVENCION DESCRIBE UNAS COMPOSICIONES Y UNOS PROCEDIMIENTOS QUE UTILIZAN ESTAS COMBINACIONES PARA SACAR PARTIDO DE SUS EFECTOS BENEFICIOSOS.

  8. 2344.-

    PEPTIDOS SENSIBLES A ANTICUERPOS CONTRA UN PEPTIDO CONSENSO DE LAS PROTEINAS DE LA FAMILIA CS4-CFA/I.

    (05/2005)
    Solicitante/s: U.S. DEPARTMENT OF THE ARMY. Inventor/es: CASSELS, FREDERICK, LOOMIS-PRICE, LAWRANCE. Clasificación: A61K39/395, C12P21/08, C07K16/12, A61K38/08, C07K7/08, A61K38/10, C07K14/245.

    LA INVENCION SE REFIERE A SECUENCIAS DE AMINOACIDO PROVENIENTES DE UN PEPTIDO DE CONSENSO DE LA FORMULA: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SECUENCIA NUMERO 1). SE HAN ENSAYADO OCHO PEPTIDO MER PROVENIENTES DEL PEPTIDO DE CONSENSO Y QUE SE DIRIGEN CONTRA UN ANTICUERPO CONTRA EL PEPTIDO DE CONSENSO. SE HAN EFECTUADO ESTUDIOS REFERENTES A UN ANTICUERPO DIRIGIDO CONTRA PROTEINAS DESNATURALIZADAS DE ORGANISMOS NATURALES QUE PRODUCEN LA FAMILIA DE PROTEINAS Y SE HA DEMOSTRADO EL VALOR PARTICULAR DE ALGUNAS SECUENCIAS. SE HA IDENTIFICADO UNA SECUENCIA DE LA FORMULA ASVDPTIDLLQA (SECUENCIA NUMERO 2). TAMBIEN ES DE ESPECIAL INTERES UNA SECUENCIA ALARGADA DE LA FORMULA TVTASVDPTIDLLQAD (SECUENCIA NUMERO 3) ASI COMO SECUENCIAS INTERMEDIAS TALES COMO LAS SECUENCIAS VTASVDPTIDLLQAD (SECUENCIA NUMERO CUATRO), TASVDPTIDLLQAD (SECUENCIA NUMERO 5), Y TASVDPTIDLLQA (SECUENCIA NUMERO 6) YA QUE CONSTITUYEN ZONAS DE UNION PARA LOS ANTICUERPOS DIRIGIDOS CONTRA LAS PROTEINAS DESNATURALIZADAS.

  9. 2345.-

    EVALUACION DE LAS CELULAS CERVICALES.

    (05/2005)
    Solicitante/s: QUANTUM BIOSYSTEMS LTD., (LEGALLY REPRESENTED BY GILLETT, WILLIAM OF CRANE & PARTNERS). Inventor/es: MASON, ROBERT, JAMES, PASCOE, EDWARD, WILLIAM, HOLMES, CHRISTOPHER, HAROLD,UNI OF BRISTOL. Clasificación: G01N33/574, G01N33/577, C07K16/30.

    ESTA INVENCION SE REFIERE A UN PROCEDIMIENTO PARA DETERMINAR UNA ANOMALIA EN UNA MUESTRA DE TEJIDO QUE CONTIENE CELULAS DEL CUELLO UTERINO. DICHO PROCEDIMIENTO CONSISTE EN VALORAR EN ENLACE DE SUSTANCIAS VINCULADAS ESPECIFICAS A LA MUESTRA Y EN COMPARAR EL ENLACE DE DICHAS SUSTANCIAS VINCULANTES ESPECIFICAS A UNA MUESTRA DE CELULAS NORMALES DEL CUELLO UTERINO. ESTAS SUSTANCIAS ESPECIFICAS VINCULANTES PUEDEN SER ANTICUERPOS. LOS HIBRIDOMAS QUE PRODUCEN ANTICUERPOS ADECUADOS SE HAN DEPOSITADO EN LA COLECCION EUROPEA DE LOS CULTIVOS DE CELULAS DE ANIMALES (ECACC, "EUROPEAN COLLECTION OF ANIMAL CELL CULTURES"), EN EL CENTRO DE INVESTIGACION Y DE MICROBIOLOGIA APLICADA, EN SALISBURY, WHITSHIRE SP4 OJG, REINO UNIDO, EL 6 DE FEBRERO DE 1995 BAJO LOS NUMEROS DE ORDEN ECACC 95020718, 95020716, 95020720, 95020717 Y 95020719.

  10. 2346.-

    ADQUISICION EN UN RECEPTOR GPS.

    (05/2005)
    Solicitante/s: GENERAL ELECTRIC COMPANY. Inventor/es: HARRISON, DANIEL, DAVID, TIEMANN, JEROME, JOHNSON. Clasificación: H04B1/707, G01S5/14.

    UN RECEPTOR DE ESPECTRO EXTENDIDO DE SECUENCIA DIRECTA MUESTREA UNA SEÑAL Y GUARDA LA MUESTRA EN LA MEMORIA. ANTES DEL MUESTREO Y EL ALMACENAMIENTO, LA SEÑAL ENTRANTE SE TRADUCE A UNA SEÑAL FI. TAMBIEN ANTES DEL ALMACENAJE, LA SEÑAL FI SE CORRIGE PARA UNA SEÑAL DE DECALADO DE FRECUENCIA. EL DECALADO DE FRECUENCIA PUEDE TENER VARIAS FUENTES, POR EJEMPLO, UNA VARIACION DE LA FRECUENCIA POR EL EFECTO DOPPLER O UN ERROR DEL OSCILADOR LOCAL. UNA VEZ CORREGIDA LA SEÑAL PARA EL DECALADO DE FRECUENCIA, LA MUESTRA DE LA SEÑAL SE GUARDA EN LA MEMORIA. LA MUESTRA DE LA MEMORIA SE LEE DESDE LA MEMORIA SEGUN SEA NECESARIO PARA PROCESAR LA SEÑAL. ESTE RECEPTOR ES UTIL EN EL PROCESAMIENTO DE SEÑALES GSP (SISTEMA DE POSICIONAMIENTO GLOBAL) EN DONDE LA SEÑAL ENTRANTE CONTIENE VARIAS TRANSMISIONES POR SATELITE CODIFICADAS CON UNA CODIFICACION CDMA.

  11. 2347.-

    BANDA DE ACERO DE LAMINACION EN CALIENTE Y METODO PARA SU FABRICACION.

    (05/2005)
    Solicitante/s: THYSSEN STAHL AKTIENGESELLSCHAFT. Inventor/es: ESPENHAHN, MANFRED, HELLER, THOMAS, ESDOHR, JURGEN. Clasificación: C22C38/04, C21D8/02.

    LA INVENCION TRATA DE UNA BANDA CALIENTE DE UN GROSOR COMO MUCHO DE 5 MM FORMADA A PARTIR DE ACERO DE ELEVADA RESISTENCIA, EL CUAL CONTIENE 0,08 HASTA 0,25 % DE C, 1,20 HASTA 2,0 % DE MN Y 0,02 HASTA 0,05 % DE AL Y PRESENTA UNA MICROESTRUCTURA PRINCIPALMENTE MARTENSITICA.

  12. 2348.-

    METODO SELECTIVO DE ACILACION.

    (05/2005)
    Solicitante/s: NOVO NORDISK A/S. Inventor/es: HANSEN, LOUIS, BRAMMER. Clasificación: C07K14/62.

    ESTA INVENCION SE REFIERE A UN PROCEDIMIENTO SELECTIVO DE ALCILACION DE INSULINA, DE UN ANALOGO DE INSULINA Y DE SU PRECURSOR QUE TIENE UN GRUPO EP - AMINA LIBRE DE UN RESIDUO LYS, Y POR LO MENOS UN GRUPO AL - AMINO LIBRE. DICHO PROCEDIMIENTO CONSISTE EN PROVOCAR LA REACCION DEL GRUPO EP AMINA LIBRE CON UNA AMIDA ACTIVADA EN UN DISOLVENTE POLAR EN PRESENCIA DE UNA BASE.

  13. 2349.-

    COMPOSICION FARMACEUTICA DESTINADA A UNA ADMINISTRACION POR VIA ORAL.

    (05/2005)
    Solicitante/s: NEGMASTEBA INTERNATIONAL DEVELOPMENT N.V. Inventor/es: METZIGER, PIERRE, COHEN, AVRAHAM. Clasificación: A61K9/48.

    LA INVENCION SE REFIERE A UNA COMPOSICION FARMACEUTICA ADECUADA PARA LA ADMINISTRACION POR VIA ORAL. LA COMPOSICION COMPRENDE: UN ACEITE LIQUIDO DE SOPORTE ELEGIDO ENTRE UN ACEITE VEGETAL, ANIMAL O MINERAL, UN AGENTE DE SUSPENSION, UN AGENTE HOMOGENIZADOR, UN TENSOACTIVO, MEZCLADO CON EL PRINCIPIO ACTIVO DEL MEDICAMENTO Y UNO O VARIOS EXCIPIENTES O SOPORTES FARMACEUTICAMENTE ACEPTABLES. APLICACION: MEDICAMENTOS INSOLUBLES O DEBILMENTE SOLUBLES EN EL AGUA Y LOS ACEITES ELEGIDOS ENTRE LA DIACEREINA, LA REINA O UNA DE SUS SALES FARMACEUTICAMENTE ACEPTABLES.

  14. 2350.-

    TEJAMANIL DE TEJADO Y PROCEDIMIENTO PARA CUBRIR UN TEJADO CON TEJAMANILES.

    (05/2005)
    Ver ilustración. Solicitante/s: NOWACEK, DAVID. Inventor/es: NOWACEK, DAVID. Clasificación: E04D1/22.

    LA INVENCION SE REFIERE A TEJAS DE CUBIERTA FABRICADAS A PARTIR DE NEUMATICOS USADOS , ASI COMO A UN METODO PARA SU FABRICACION. SE CORTAN POR AMBOS BORDES UNOS NEUMATICOS USADOS , A LO LARGO DE SU CIRCUNFERENCIA, PARA SEPARAR LA PARTE DE LA BANDA DE RODAMIENTO DE LOS FLANCOS Y DEL ACERO DEL TALON. A CONTINUACION SE CORTA LA PARTE DE LA BANDA DE RODAMIENTO , POR MEDIO DE UNA TERRAJA, UNA CIZALLA U OTRO METODO, EN UN NUMERO DE PIEZAS MAS CORTAS O TEJAS . LAS TEJAS SE FIJAN SEGUIDAMENTE, MONTANDO UNAS SOBRE OTRAS, GENERALMENTE CON LA CARA DEL DIBUJO HACIA FUERA, PARA CONSTITUIR LA CUBIERTA IMPERMEABLE DE UN EDIFICIO O DE CUALQUIER OTRA ESTRUCTURA.

  15. 2351.-

    PROCEDIMIENTO DE DETERMINACION CUANTITATIVA DE LOS COLESTEROLES DE LA LIPOPROTEINAS DE BAJA DENSIDAD.

    (05/2005)
    Ver ilustración. Solicitante/s: DAIICHI PURE CHEMICALS CO. LTD.. Inventor/es: NAKAMURA, MITSUHIRO, DAIICHI PURE CHEM. CO., LTD, NAKANISHI, KAZUO, DAIICHI PURE CHEM. CO., LTD, HINO, KOICHI, DAIICHI PURE CHEM. CO., LTD, MANABE, MITSUHISA, DAIICHI PURE CHEM. CO., LTD. Clasificación: C12Q1/60.

    PROCEDIMIENTOS PARA LA DETERMINACION CUANTITATIVA DEL COLESTEROL LDL, QUE INCLUYE LOS PASOS DE AÑADIR AL SUERO UN TENSOACTIVO SELECCIONADO ENTRE FENIL ETERES DE POLIOXIETILENO- ALQUILENO Y ETERES TRIBENCILFENIL DE POLIOXIETILENEALQUILENO Y UN COLESTEROL- ENSAYANDO UN REACTIVO ENZIMATICO QUE PREFERENTEMENTE HAGA REACCIONAR COLESTEROLES CON ALTA DENSIDAD- Y COLESTEROLES DE MUY BAJA DENSIDAD ENTRE LIPOPROTEINAS, Y A CONTINUACION DETERMINANDO LA CANTIDAD DE COLESTEROL QUE REACCIONA POSTERIORMENTE. ESTE PROCEDIMIENTO PUEDE ELIMINAR LA POSIBILIDAD DE PRETRATAMIENTOS TALES COMO CENTRIFUGACION Y ELECTROFORESIS, PERMITIENDO QUE LA DETERMINACION CUANTITATIVA SEA REALIZADA DE UNA FORMA EFICIENTE Y SIMPLE, Y PUDIENDO SER APLICADO CON VARIOS ANALIZADORES AUTOMATICOS.

  16. 2352.-

    DERIVADOS DE ALQUILAMONOBENZOTIAZOLES Y DE ALQUILAMINOBENZOXAZOLES.

    (05/2005)
    Ver ilustración. Solicitante/s: JANSSEN PHARMACEUTICA N.V.. Inventor/es: KENNIS, LUDO, EDMOND, JOSEPHINE, MERTENS, JOSEPHUS, CAROLUS, PIETERS, SERGE, MARIA, ALOYSIUS. Clasificación: A61K31/425, A61K31/42, C07D277/82, A61K51/04, C07B59/00, C07D263/58.

    LA PRESENTE INVENCION SE REFIERE A COMPUESTOS DE FORMULA (I), LAS FORMAS N - OXIDO, LAS SALES DE ADICION DE ACIDOS Y FORMAS ESTEREOQUIMICAMENTE ISOMERICAS DE LOS MISMOS, EN LA QUE X ES O O S; N ES 2, 3, 4 O 5; R 1 ES HIDROGENO, ALQUILO C SUB,1-6 , ALQUILOXI C 1-6 O HALO; R 2 ES HIDROGENO, A LQUILO C 1-6 , FENILO, FENILALQUILO C 1-6 O FENILCARBONILO; R 3 Y R 4 SE SELECCIONAN CADA UNO, INDEPENDIE NTEMENTE, DEL HIDROGENO, HALO, NITRO, ALQUILO C 1-6 , ALQUILOXI C 1-6 , HALOALQUILO C 1-6 , AMINOSULFONILO, MONO O DIAMINOSULFONIL(ALQUILO C 1-4 ; O R 3 Y R 4 SE PUEDEN TOMAR JUNTOS PARA FORMAR UN RADICAL BIVALENTE DE FORMULA - CH=CH - CH=CH -; TAMBIEN SE REFIERE A PROCEDIMIENTOS PARA SU PREPARACION, A COMPOSICIONES QUE LOS CONTIENEN ASI COMO A SU UTILIZACION EN MEDICINA. TAMBIEN SE PRESENTAN COMPUESTOS DE FORMULA (I) QUE CONTIENEN UN ISOTOPO RADIACTIVO, UN PROCEDIMIENTO PARA LA PRODUCCION DE PUNTOS RECEPTORES DE LA DOPAMINA D4 Y UN PROCEDIMIENTO PARA LA FORMACION DE IMAGENES DE UN ORGANO.

  17. 2353.-

    METODO DE ENSAYO.

    (05/2005)
    Ver ilustración. Solicitante/s: APPLIED RESEARCH SYSTEMS ARS HOLDING N.V.. Inventor/es: COOKSON, ALAN, DEREK, DANIELS, PHELIM. Clasificación: G01N33/543.

    PROCEDIMIENTO CINETICO DE VALORACION PARA CUANTIFICAR UN ANALITO EN UNA MUESTRA.

  18. 2354.-

    AGENTE ANTI-OBESIDAD CUYO PRINCIPIO ACTIVO ES LA PROCIANIDINA.

    (05/2005)

    UN AGENTE ANTIOBESIDAD QUE TIENE, ADEMAS DEL EFECTO ANTIOBESIDAD, LOS EFECTOS DE INHIBICION DE LAS ENZIMAS DIGESTIVAS SACAROLITICAS, DE SUPRESION DEL AUMENTO DEL NIVEL DE AZUCAR SANGUINEO, DE INHIBICION DE LA ABSORCION DE MONOSACARIDOS, DE ABSORCION Y EXCRECION DEL ACIDO COLICO, DE DISMINUCION DEL NIVEL DE COLESTEROL Y DEL NIVEL DE TRIGLICERIDOS SANGUINEOS Y DE INHIBICION DE LA LIPASA, SIENDO UTIL NO SOLO COMO AGENTE ANTIOBESIDAD, SINO TAMBIEN COMO AGENTES ANTILIPOTROFICOS, ANTIHIPERLIPIDEMICOS , ANTIARTERIOSCLEROTICOS Y ANTIDIABETICOS. UN EXTRACTO...

  19. 2355.-

    DERIVADOS FOSFOLIPIDOS DE ACIDOS FOSFONOCARBOXILICOS, SU PREPARACION, ASI COMO SU USO COMO MEDICAMENTOS ANTIVIRICOS.

    (05/2005)
    Ver ilustración. Solicitante/s: BOEHRINGER MANNHEIM GMBH. Inventor/es: HERRMANN, DIETER, ZIMMERMANN, GERD, OPITZ, HANS-GEORG, ZILCH, HARALD. Clasificación: A61K31/66, C07F9/40.

    SON OBJETO DE LA PRESENTE INVENCION LOS NUEVOS DERIVADOS LIPIDICOS DE ACIDOS FOSFONCARBOXILICO DE FORMULA GENERAL (I), EN LA QUE EL SIGNIFICADO DE LOS SIMBOLOS ESTA DESCRITO EN LA DESCRIPCION, SUS TAUTOMEROS Y SUS PROFARMACOS Y SALES DE BASES INORGANICAS Y ORGANICAS, ASI COMO EL PROCEDIMIENTO PARA LA PRODUCCION Y LOS MEDICAMENTOS QUE CONTIENEN ESTOS COMPUESTOS.

  20. 2356.-

    DERIVADOS DE MORFINA CON ACTIVIDAD ASNALGESICA.

    (05/2005)
    Ver ilustración. Solicitante/s: NYCOMED IMAGING AS. Inventor/es: HARTMANN, MICHAEL, KOCH, ANDREAS, STIMMEDER, DAGMAR, ENGELSEN, STEINAR, ROVENSZKY, FRANZ, KREMMINGER, PETER, HUTZINGER, MICHAEL. Clasificación: A61K31/485, C07D489/02.

    LA INVENCION SE REFIERE A DERIVADOS DE MORFINA DE FORMULA (I), AL PROCEDIMIENTO DE PREPARACION DE LOS MISMOS, Y A SU UTILIZACION COMO ANALGESICOS.

  21. 2357.-

    ELIMINACION DEL BELLO POR FOTOTERMOLISIS SELECTIVA CON UN LASER DE ALEJANDRITA.

    (05/2005)
    Ver ilustración. Solicitante/s: LASER INDUSTRIES LIMITED. Inventor/es: SLATKINE, MICHAEL, WALDMAN, AMIR, BRAUDE, OFER, ROZENBERG, ZVI, KLEIN, ARIE. Clasificación: A61N5/06.

    ESTA INVENCION ES UN ELIMINADOR DE VELLO MEDIANTE LA UTILIZACION DE UN LASER DE ALEXANDRITA QUE EMITE UNA ENERGIA ENTRE 0,2 JULIOS Y 40 JULIOS POR PULSO, PARA SUMINISTRAR UN FLUJO DE ENERGIA ENTRE 15 JULIOS Y 70 JULIOS POR CENTIMETRO CUADRADO, Y QUE PRESENTA UNA DURACION DEL PULSO DE ENTRE 100 MICROSEGUNDOS Y 10 MILISEGUNDOS. PUEDE UTILIZARSE UN ANALIZADOR PARA DIRIGIR EL HAZ DE LASER SOBRE EL TEJIDO . LA PIEL EN EL AREA QUE VA A SER IRRADIADA PUEDE SER AFEITADA ANTES DE LA EXPOSICION AL TRATAMIENTO CON LASER, Y TAMBIEN PUEDE SER CUBIERTA CON UNA SUSTANCIA PROTECTORA QUE SIRVE COMO SUMIDERO DE CALOR.

  22. 2358.-

    DISPOSITIVO QUE PERMITE MEJORAR LA DIFUSION O LA EXTRACCION TRANSDERMICA DE UNA SUSTANCIA.

    (05/2005)
    Ver ilustración. Solicitante/s: ALZA CORPORATION. Inventor/es: CORMIER, MICHEL, J., N., NEUKERMANS, ARMAND, P., BLOCK, BARRY, NAT, AVTAR, S. Clasificación: A61N1/30.

    SE EXPONE UN DISPOSITIVO PARA ALIMENTACION O MUESTREO PERCUTANEO DE UN AGENTE, QUE COMPRENDE UNA LAMINA QUE TIENE AL MENOS UNA ABERTURA A TRAVES DE ELLA, Y UNA SERIE DE MICROCUCHILLAS PARA PERFORAR LA PIEL A FIN DE AUMENTAR EL FLUJO TRANSDERMICO DE UN AGENTE. LAS MICROCUCHILLAS TIENEN UN BORDE DE ATAQUE (11, 11') EN ANGULO RELATIVAMENTE AGUDO, QUE SE CONVIERTE EN UN BORDE DE CUCHILLA EN ANGULO DE FORMA RELATIVAMENTE GRADUAL (13, 13').

  23. 2359.-

    DISPOSITIVO DE MEJORA DE TOMA DE MUESTRAS TRANSDERMICAS.

    (05/2005)
    Ver ilustración. Solicitante/s: ALZA CORPORATION. Inventor/es: CORMIER, MICHEL, J., N., THEEUWES, FELIX, T. Clasificación: A61N1/30.

    SE EXPONE UN DISPOSITIVO PARA PERFORAR LA CAPA CORNEA DE LA SUPERFICIE DEL CUERPO A FIN DE FORMAR VIAS A TRAVES DE LAS CUALES PUEDA RETIRARSE UN AGENTE. EL DISPOSITIVO COMPRENDE: UNA LAMINA QUE TIENE UNA SERIE DE MICROCUCHILLAS , QUE SE EXTIENDEN HACIA ABAJO A PARTIR DE LA MISMA, PARA PERFORAR LA CAPA CORNEA, Y UN COLECTOR SITUADO EN LA LAMINA , QUE RETIRA EL AGENTE A TRAVES DE LAS VIAS DE PASO.

  24. 2360.-

    METODO Y APARATO PARA LA PROTECCION DE DATOS QUE PERMITE MULTIPLES NIVELES DE CIFRADO APLICABLES EN UN NIVEL DEL TIPO DE ELEMENTO DE DATOS.

    (05/2005)

    LA INVENCION SE REFIERE A UN PROCEDIMIENTO Y APARATO PARA PROCESO DE DATOS QUE DEBEN SER PROTEGIDOS. LOS DATOS SE ALMACENAN COMO VALORES DE ELEMENTOS DE DATOS CODIFICADOS (DV) EN REGISTROS (P) DE UNA PRIMERA BASE DE DATOS (O-DB), ENCONTRANDOSE CADA VALOR DE ELEMENTO DE DATOS VINCULADO A UN TIPO CORRESPONDIENTE DE ELEMENTO DE DATOS (DT). EN UNA SEGUNDA BASE DE DATOS (IAM-DB), SE ALMACENA UN CATALOGO DE PROTECCION DE LOS ELEMENTOS DE DATOS (DC), QUE, PARA CADA TIPO INDIVIDUAL DE ELEMENTOS DE DATOS (DT), CONTIENE UNO O MAS ATRIBUTOS DE PROTECCION...

  25. 2361.-

    CONVERTIDOR DE ENERGIA DE OLAS.

    (05/2005)
    Ver ilustración. Solicitante/s: APPLIED RESEARCH & TECHNOLOGY LIMITED. Inventor/es: WELLS, ALAN ARTHUR. Clasificación: F03B13/24, E02B9/08, F03B13/14.

    UNA ESTRUCTURA DE COLECTOR DE OLAS PARA LA GENERACION DE ENERGIA ELECTRICA, ACCIONADA MEDIANTE LA ENERGIA DE LAS OLAS, QUE COMPRENDE UN LABIO QUE SE EXTIENDE HACIA FUERA Y COLGANTE HACIA ABAJO POR DEBAJO DEL CUAL SE ENCUENTRA SITUADA UNA BOCA DEL COLECTOR. EL COLECTOR COMPRENDE ADEMAS LAS PAREDES LATERALES QUE SE EXTIENDEN HORIZONTALMENTE EN FORMA SUBSTANCIAL HASTA Y MAS ALLA DEL LABIO, ENCERRANDO PARCIALMENTE UN VOLUMEN DE AGUA ENTRE EL LABIO Y LAS PAREDES LATERALES. EL COLECTOR SE SITUA EN SU EMPLAZAMIENTO DESEADO MEDIANTE EL SELLADO HERMETICO DE LA BOCA CON PUERTAS (NO MOSTRADAS), Y HACIENDO FLOTAR LA ESTRUCTURA HASTA SU EMPLAZAMIENTO DESEADO. LAS VALVULAS DE CONTROL SE ABREN PARA PERMITIR QUE EL AGUA ENTRE AL COLECTOR PARA HACER HUNDIR LA ESTRUCTURA HASTA EL LECHO DEL FONDO MARINO EN DONDE SE ABREN LAS PUERTAS.

  26. 2362.-

    COMPOSICIONES DE VIDRIO BIOACTIVO PARA USO EN EL TRATAMIENTO DE ESTRUCTURAS DENTALES.

    (05/2005)
    Solicitante/s: UNIVERSITY OF MARYLAND, BALTIMORE USBIOMATERIALS CORPORATION. Inventor/es: LITKOWSKI, LEONARD, J., HACK, GARY, D., GREENSPAN, DAVID, C. Clasificación: A61K7/16, A61K6/06, C03C3/097, C03C4/00, C03C3/078, A61K6/027.

    UN NUEVA COMPOSICION DE VIDRIO BIOACTIVO A BASE DE SILICE QUE SE PUEDE UTILIZAR JUNTO CON UN SUMINISTRADOR COMO PASTA DE DIENTES, GEL, ETC, Y QUE TIENE UN TAMAÑO DE PARTICULA < 90 MIM QUE FORMARA UNA REACCION RAPIDA Y CONTINUA CON FLUIDOS CORPORALES DEBIDO A SU LIBERACION INMEDIATA Y DURADERA DE IONES DE CA Y P DESDE LAS PARTICULAS DE SILICE DEL NUCLEO, PARA PRODUCIR UNA CAPA DE HIDROXICARBONATOAPATITO CRISTALINA Y ESTABLE DEPOSITADA SOBRE Y DENTRO DE LOS TUBULOS DE DENTINA PARA LA REDUCCION INMEDIATA Y DE LARGA DURACION DE LA HIPERSENSIBILIDAD DE LA DENTINA Y REMINERALIZACION DE LA SUPERFICIE DENTAL.

  27. 2363.-

    MEZCLA DE VECTORES DE VACCINIA RECOMBINANTES COMO VACUNAS POLIGUEUR CONTRA EL VIH.

    (05/2005)
    Ver ilustración. Solicitante/s: ST. JUDE CHILDREN'S RESEARCH HOSPITAL. Inventor/es: HURWITZ, JULIA, COLECLOUGH, CHRISTOPHER, OWENS, RANDALL, SLOBOD, KAREN. Clasificación: C12N15/86, C07K14/16, A61K39/21.

    SE PROPORCIONAN VACUNAS POLIENV QUE CONTIENEN MEZCLAS DE AL MENOS 4 HASTA 10.000 DIFERENTES VIRUS RECOMBINANTES, EXPRESANDO CADA UNO UNA VARIANTE ENV DE VIH DIFERENTE O UNA PORCION DE LA MISMA QUE CONTIENE REGIONES TANTO VARIABLES COMO CONSTANTES, ASI COMO METODOS PARA FABRICAR Y UTILIZAR DICHAS VACUNAS Y VIRUS POLIENV, INCLUYENDO EL USO DE LA VACUNA POLIENV EN FORMA VIVA, ATENUADA O INACTIVADA, PARA LA PROFILAXIS O TRATAMIENTO DE LA INFECCION POR VIH. LAS VACUNAS VIRALES DE LA INVENCION SE COMBINAN DE FORMA OPTIMA CON UN REFUERZO DE ENV DE VIH RECOMBINANTE, O UNA VACUNA INICIAL O DE REFUERZO CON DNA DEL GEN ENV.

  28. 2364.-

    CATALIZADOR DE CONVERSION DE HIDROCARBUROS Y SU USO.

    (05/2005)
    Solicitante/s: EXXON CHEMICAL PATENTS INC.. Inventor/es: SMITH, ROBERT, S., MOHR, GARY, D. Clasificación: C10G35/095, B01J29/04, C07C5/27, C10G11/05, C10G45/64, C07C1/20, C07C5/41, C07C4/18.

    CATALIZADORES Y PROCESOS DE CONVERSION PARA CONVERTIR LOS HIDROCARBUROS MEDIANTE LOS CATALIZADORES. LOS CATALIZADORES CONSTAN DE UN PRIMER TAMIZ ALUMINOFOSFOMOLECULAR Y UNA UNION QUE CONSTA DE UN SEGUNDO TAMIZ ALUMINOFOSFOMOLECULAR. LOS PROCESOS DE CONVERSION DE EJEMPLO INCLUYEN LA CONVERSION DE OXIGENADOS EN OLEFINAS, DESPARAFINAJE, REFORMA, DESALQUILACION, DESHIDROGENACION, TRANSALQUILACION, ALQUILACION E ISOMERIZACION.

  29. 2365.-

    TRATAMIENTO MORFOGENETICO DE LA INSUFICIENCIA RENAL CRONICA.

    (05/2005)
    Solicitante/s: CREATIVE BIOMOLECULES, INC.. Inventor/es: COHEN, CHARLES, M., SAMPATH, KUBER, T.. Clasificación: A61K38/18, A61P13/12.

    LA PRESENTE INVENCION PROPORCIONA PROCEDIMIENTOS PARA EL TRATAMIENTO, Y PRODUCTOS FARMACEUTICOS QUE PUEDEN UTILIZARSE EN EL TRATAMIENTO, DE SUJETOS MAMIFEROS QUE SUFREN, O TIENEN EL RIESGO DE SUFRIR, INSUFICIENCIA RENAL CRONICA, O QUE SE ENCUENTRAN EN RIESGO DE NECESITAR UNA TERAPIA DE SUSTITUCION RENAL. LOS PROCEDIMIENTOS INCLUYEN LA ADMINISTRACION DE CIERTAS PROTEINAS DE, O BASADAS EN, LA FAMILIA DE PROTEINAS OSTEOGENICAS/PROTEINAS MORFOGENETICAS OSEAS (OP/BMP) DE LA SUPERFAMILIA TGF BE DE PROTEINAS, O LA ADMINISTRACION DE CIERTOS MORFOGENES, INDUCTORES DE DICHOS MORFOGENES, AGONISTAS DE LOS RECEPTORES DE LOS MORFOGENES CORRESPONDIENTES, O IMPLANTACION DE CELULAS RENALES INDUCIDAS CON DICHOS MORFOGENES. LOS MORFOGENES UTILES EN LA INVENCION SON IGUALMENTE MIEMBROS DE LA FAMILIA DE PROTEINAS OP/BMP O SE BASAN EN ELLA.

  30. 2366.-

    DISPOSITIVO CASQUETE DE FIJACION UNITARIO QUE FIJA UNA VARILLA SITUADA EN LA PARTE CABEZAL DE UN TORNILLO DE PEDICULO.

    (05/2005)
    Ver ilustración. Solicitante/s: FASTENETIX, L.L.C. Inventor/es: ERRICO, THOMAS, J., RALPH, JAMES, D., TATAR, STEPHEN. Clasificación: A61B17/70, A61B17/86.

    MECANISMO DE TAPON UNITARIO PARA FIJACION QUE SE UTILIZA CON TORNILLOS DE PEDUNDULO Y OTROS IMPLANTES ORTOPEDICOS QUE ACOPLAN HUESOS A VARILLAS. TIENE UN BORDE Y UNA SUJECION ACOPLADOS Y QUE GIRAN UNO RESPECTO A OTRO PARA PERMITIR EL MOVIMIENTO EN RELACION UNO CON OTRO. EL BORDE TIENE UN CUERPO CILINDRICO CON UN EXTREMO ABIERTO Y OTRO CERRADO . EL EXTREMO CERRADO TIENE ALTERNATIVAMENTE UN ORIFICIO CONCENTRICO DEFINIDO POR UN COLLARIN DIRIGIDO HACIA DENTRO. EL TAPON DE FIJACION UNITARIO SE PROVEE EN VARIAS MATERIALIZACIONES DEL INVENTO. CADA UNA DE ELLAS ESTA DISEÑADA ALTERNATIVAMENTE PARA QUE LA SUJECION O LA SUPERFICIE INTERNA DEL BORDE ESTEN ROSCADAS DE TAL MANERA QUE PUEDAN COINCIDIR CON UNA ROSCA (114A, 114B) EN LAS PIEZAS QUE CONFORMAN EL CANAL INTERNO O EXTERNO EN FORMA DE U (105A, 105B) QUE SE PROLONGA HACIA ARRIBA EN LAS CABEZAS DE LOS TORNILLOS DE PEDUNCULO (100A, 100B).

  31. 2367.-

    ADNASA II HUMANA.

    (05/2005)
    Ver ilustración. Solicitante/s: GENENTECH, INC.. Inventor/es: BAKER, KEVIN P., BARON, WILL, F. Clasificación: C12N9/00.

    LA PRESENTE INVENCION SE REFIERE A UNA NUEVA DESOXIRRIBUNOCLEASA, DENOMINADA ADNASA II. LA INVENCION PROPORCIONA SECUENCIAS DE ACIDOS NUCLEICOS QUE CODIFICAN LA ADNASA II HUMANA, PERMITIENDO ASI LA PRODUCCION DE ADNASA HUMANA POR PROCEDIMIENTOS DE ADN RECOMBINANTES, EN CANTIDADES SUFICIENTES PARA USO CLINICO. LA INVENCION SE REFIERE IGUALMENTE A COMPOSICIONES FARMACEUTICAS Y A USOS DIAGNOSTICOS Y TERAPEUTICOS DE LA ADNASA II HUMANA.

  32. 2368.-

    ANALISIS PARA DETECTAR LA PRESENCIA DE UNA ENFERMEDAD CEREBRAL DEGENERATIVA.

    (05/2005)
    Solicitante/s: BTG INTERNATIONAL LIMITED. Inventor/es: POMFRETT, CHRISTOPHER. Clasificación: A61B5/0245.

    PROCEDIMIENTO PARA DETECTAR LA PRESENCIA DE UNA ENFERMEDAD CEREBRAL DEGENERATIVA, COMO LA EEB O LA DIC. SE EFECTUA UNA MEDICION DE LA ARRITMIA SINUSAL RESPIRATORIA DE CUALQUIER MAMIFERO QUE SE SOSPECHA QUE SUFRE LA ENFERMEDAD CEREBRAL DEGENERATIVA. SE SUPONE QUE EL MAMIFERO SUFRE DICHA ENFERMEDAD SI LA ASR SE ENCUENTRA FUERA DE UNA ESCALA DE REFERENCIA PREESTABLECIDA. LA ESCALA DE REFERENCIA PODRIA DETERMINARSE A PARTIR DE DATOS QUE FORMAN LA BASE PARA EL CALCULO DE LA ESCALA DE ASR, A TRAVES DE APLICACION DE UNA PRUEBA ADECUADA DE RANDOMIZACION.

<< · 37 · 55 · 64 · 69 · 71 · 72 · < · 74 · > · 77 · >>